GenomeNet

Database: RefSeq
Entry: NC_015711
LinkDB: NC_015711
Original site: NC_015711 
LOCUS       NC_015711            9003593 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Myxococcus fulvus HW-1 chromosome, complete genome.
ACCESSION   NC_015711
VERSION     NC_015711.1  GI:338529680
DBLINK      Project: 68443
            BioProject: PRJNA68443
KEYWORDS    RefSeq.
SOURCE      Myxococcus fulvus HW-1
  ORGANISM  Myxococcus fulvus HW-1
            Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
            Cystobacterineae; Myxococcaceae; Myxococcus.
REFERENCE   1  (bases 1 to 9003593)
  AUTHORS   Li,Z.F., Li,X., Liu,H., Liu,X., Han,K., Wu,Z.H., Hu,W., Li,F.F. and
            Li,Y.Z.
  TITLE     Genome Sequence of the Halotolerant Marine Bacterium Myxococcus
            fulvus HW-1
  JOURNAL   J. Bacteriol. 193 (18), 5015-5016 (2011)
   PUBMED   21868801
REFERENCE   2  (bases 1 to 9003593)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 9003593)
  AUTHORS   Li,Y.Z., Li,Z.F., Li,X., Liu,H., Liu,X., Han,K., Wu,Z.H. and Hu,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2011) State Key Laboratory of Microbial
            Technology, College of Life Science, Shandong University, 27#
            Shanda Nanlu, Jinan, Shandong 250100, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002830.
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9003593
                     /organism="Myxococcus fulvus HW-1"
                     /mol_type="genomic DNA"
                     /strain="HW-1"
                     /isolation_source="seawater"
                     /culture_collection="ATCC:BAA-855"
                     /db_xref="taxon:483219"
                     /country="China"
     gene            1217..1708
                     /locus_tag="LILAB_00005"
                     /db_xref="GeneID:10881826"
     CDS             1217..1708
                     /locus_tag="LILAB_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="YP_004663015.1"
                     /db_xref="GI:338529681"
                     /db_xref="GeneID:10881826"
                     /translation="MAAQRLSMRKLRELFRLRFEAKLTTRAIAASLGIGNGTVCDYLG
                     RARVAKLTWPLPPELDDDAALTALLFPEDAKALTERPEPDWAHVHAELKKKGVTKLLL
                     WQECLEAVPGGYQYSRFCERVRAEPGVRARAADRAPGARPSHRAGVHRRKAQAAHLKQ
                     AHD"
     misc_feature    1307..>1687
                     /locus_tag="LILAB_00005"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     gene            complement(1812..2408)
                     /locus_tag="LILAB_00010"
                     /db_xref="GeneID:10874465"
     CDS             complement(1812..2408)
                     /locus_tag="LILAB_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663016.1"
                     /db_xref="GI:338529682"
                     /db_xref="GeneID:10874465"
                     /translation="MTFESIILNHGWDRAAWELANLFLLSVGAELLGPDTPRVVGISE
                     ETTSYVSPGYFAEGDPFAGFIVHEAAHIIHNCKRRTIGLCETRTKEWLLDIEYRQRET
                     FAYSCEAYARVLACGRGTGERRALAADTQHRRASRKSASTRPRSRPSSRRRPPRGAGG
                     RCSSRGARRGPSRARRFSSRARCSLPEILLTNYTRSGT"
     gene            complement(2452..4290)
                     /locus_tag="LILAB_00015"
                     /db_xref="GeneID:10874466"
     CDS             complement(2452..4290)
                     /locus_tag="LILAB_00015"
                     /note="COG1479 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663017.1"
                     /db_xref="GI:338529683"
                     /db_xref="GeneID:10874466"
                     /translation="MSTFDSTKTLLSDLLTKVVKGKLQLPDFQRGWVWDDEHIQSLLV
                     SIARSFPIGAVMLLETGGEARFQVRAVEGVDLPPNSNPEELILDGQQRLTSLTQVLKL
                     DKPVATRDAKKRELKLHYYFDIEKALLGPQALEDAIVTVDEQRTQREDFGRKVVLDLS
                     TREKEINAFHFPCSQILNSDDWEQALSEHAPEKLARFMKFRRQVVEPFRNYALPVISL
                     RKETSKEAVCLVFEKVNTGGVPLSVFELITATWAVDGFNLRDDWFGGRGKSGRHARLG
                     KRPLLRDLQPTDFLQGVSLLHSFDRRTQDLAAGRSGKEATGVTAKREHILEMPLGAFE
                     KWAESLTQGFEEAERFLRSEGFHHPKFLPYRTQLTPLGAVLAHLGERWLEPQIKTKLA
                     RWFWCGVLGELYGGAVETRIALDVQQLLAWVNEPSAPEPATVQSAGFNPNRLDTLRSR
                     TSAAYRGLYVLLQREGACDFFWKARMVDLDRDDAKLDIHHIFPKKWCEDHDIPPRVFN
                     AIVNKTAISYKANRMIGGSAPSKYLAQLQGHVQVKLDDAAMDTIVKSHVINPALLRAD
                     SFQAFYAARKAALLALVERAMGKASAEATAIGADDEDGDEDEGEAT"
     misc_feature    complement(3544..4260)
                     /locus_tag="LILAB_00015"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     pfam03235"
                     /db_xref="CDD:251819"
     misc_feature    complement(2512..3525)
                     /locus_tag="LILAB_00015"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3472"
                     /db_xref="CDD:226003"
     gene            4551..4922
                     /locus_tag="LILAB_00020"
                     /db_xref="GeneID:10874467"
     CDS             4551..4922
                     /locus_tag="LILAB_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663018.1"
                     /db_xref="GI:338529684"
                     /db_xref="GeneID:10874467"
                     /translation="MSGWTSAGTHLWKASVSSTHVPVLALFDGTQLLDVGREFDANEN
                     GGWRFEDGSAAPSTLTLAPFQAVAAGARGARRRRPCGSRPSFRSTSAVCASRKASPDT
                     PMPEAARAPRAEVTPNRSSRH"
     gene            5314..5859
                     /locus_tag="LILAB_00025"
                     /db_xref="GeneID:10874468"
     CDS             5314..5859
                     /locus_tag="LILAB_00025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663019.1"
                     /db_xref="GI:338529685"
                     /db_xref="GeneID:10874468"
                     /translation="MDEGRPKRCVACGRGAYEGGGLGLHGHGLVERQQRGPPTADEAP
                     RCEVVLCRRYRCKPCGAVMRVVPPSVRPRKHFSGEAIGFALALWTLCGLRADEVRRRT
                     SDWTRLGDAARGWRSLARWARQLGARQLFGALPLGAVAQGPRALAARAAQALCAHAPL
                     AWRGAPLERRSSIKPSPEPAM"
     gene            5968..6864
                     /locus_tag="LILAB_00030"
                     /db_xref="GeneID:10874469"
     CDS             5968..6864
                     /locus_tag="LILAB_00030"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_004663020.1"
                     /db_xref="GI:338529686"
                     /db_xref="GeneID:10874469"
                     /translation="MDAGSGKETSMDELVPKDHGEEIAVFRSQVIGPVVHRQLTRGEL
                     RGALRELTRQKFRPPGAERTWHFSMPTLERWYYRFRRHGLAALRPQPRKDAGRAKALD
                     ERQKQLVCDVRREHLSASAELILTTLVRQGRVREGAVSAATVRRLLAERGLDRVSLRG
                     TGEGVERRRWEAAYPGALWHGDVCHGPVLTGGTKWEPLRIHALLDDRSHYVVALEARS
                     TEREDDMLGLLVRAARQHGVPETLYLDNRSSWAPSGRWPTSTGAGPSTLTGRPSRVPW
                     RWTSWPAPPTSSSSHPRAWARR"
     misc_feature    <6169..6423
                     /locus_tag="LILAB_00030"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    6178..6411
                     /locus_tag="LILAB_00030"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    6490..>6711
                     /locus_tag="LILAB_00030"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            6549..7421
                     /locus_tag="LILAB_00035"
                     /db_xref="GeneID:10874470"
     CDS             6549..7421
                     /locus_tag="LILAB_00035"
                     /note="COG1484 DNA replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposition helper protein"
                     /protein_id="YP_004663021.1"
                     /db_xref="GI:338529687"
                     /db_xref="GeneID:10874470"
                     /translation="MGAAAHPRTARRQEPLRRRPRGALHRARGRHARPAGAGRAPARR
                     ARDALPRQPLQLGTLRTMADFDWGWPKHIDRTAVESALALDFMARPANVVLVAPQGLG
                     KTMIAQNIAYNAVQAGHSVLFTTAQPCSSSTTSDCGPSRVRRASTCTRLSVVATSVRP
                     LASPPIAPWRSGLRCLVTHCWPAPPWTDCCTTPMSSPSRVTATATHRSPSAPEHRARP
                     TLTPPHADTWRSPCRTGLAEPARPTPSRFLGASRPDLIGRTEQRPDWPSLDMVKARGY
                     PGGYEQVKRYAPPR"
     misc_feature    6777..>6926
                     /locus_tag="LILAB_00035"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    6837..6860
                     /locus_tag="LILAB_00035"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    6840..6863
                     /locus_tag="LILAB_00035"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     gene            complement(7592..8671)
                     /locus_tag="LILAB_00040"
                     /db_xref="GeneID:10874471"
     CDS             complement(7592..8671)
                     /locus_tag="LILAB_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663022.1"
                     /db_xref="GI:338529688"
                     /db_xref="GeneID:10874471"
                     /translation="MPFLALALASAVGLLGVTPAHAELPRTPLRGELARVGDADSAVI
                     WLAGQNGEVDMAVVAKYPHRPLVAPRFFLKHSAEEVFLAVAPDSQPLPEALMSRESLT
                     RSASQREQLRRDNAAELATMPEFVAEQSSSLAGSCTAQQRTWAASVYGDPTCGQPPAG
                     NPIFTATVSDYYCEGCENPLGSEEPNACTPDLLPCDRVRRESTSVRLRTTSWNGPVTF
                     QHSGHSAHFAVHNCTGNGPVTFNFSRTGWSGSGSVQLDPQEMWNIKVGDFSAANAAKK
                     VTMGQWAIGRPESGPTYVFNAMSVDANSGATDAITACGDIITKYRMTDLTVPSCHGNA
                     YVALCNGTNCNNACFHCYGPNGCPN"
     gene            complement(8956..9573)
                     /locus_tag="LILAB_00045"
                     /db_xref="GeneID:10874472"
     CDS             complement(8956..9573)
                     /locus_tag="LILAB_00045"
                     /note="COG1309 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_004663023.1"
                     /db_xref="GI:338529689"
                     /db_xref="GeneID:10874472"
                     /translation="MEEPVSQSVAGQRRRRGAALEEAILRAAADELTESGYAGLTMDK
                     VAARAGTNKNTLYRRWPHRLALGIAAYRQLAKTVLPPDTGTLRGDALELLRRANRHWS
                     SPLGAILRELLSAAGGASEFLAQLPEQSNDAAAALWLTLLGRAVKRGEASPEALHPRV
                     STVAIVLLRNEFVMRGVPTIPDDVLVEIIDEVYLPLVRKRGPPPR"
     misc_feature    complement(8962..9540)
                     /locus_tag="LILAB_00045"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(9364..9504)
                     /locus_tag="LILAB_00045"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            9694..10719
                     /locus_tag="LILAB_00050"
                     /db_xref="GeneID:10874473"
     CDS             9694..10719
                     /locus_tag="LILAB_00050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663024.1"
                     /db_xref="GI:338529690"
                     /db_xref="GeneID:10874473"
                     /translation="MRAKGISYDTGFLFKGAFSREVFDLEVVKHELRIIRDDLHCNAV
                     RVIGGDPDRLELAATYAADLGLEVWFSPYPLGLSIEEMLSLFTDCAERAERLRKRGAE
                     VVFVTGAELSLMNDGFLPGDSLEERVALLSQPDRLREQVIAVSARVNDFLRKATSRVR
                     ARFGGKVTYAAIPLERVDWTPFDIISLDLYRSAETADRFRDGFRALVAQGKPVAITEF
                     GAASYRGAGDRGARGLEIVEYCKATRRPLRLTGEYVRDEAGQAAYLCELLEIFDAEGV
                     DSSFVFIFALNDHVHRPDGAPQDDLDLASYGIVKVFENRNGDTYPDLPWEPKVAFSAL
                     AEFYRAH"
     gene            10966..12336
                     /locus_tag="LILAB_00055"
                     /db_xref="GeneID:10874474"
     CDS             10966..12336
                     /locus_tag="LILAB_00055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663025.1"
                     /db_xref="GI:338529691"
                     /db_xref="GeneID:10874474"
                     /translation="MSRVAGWLVLVLALLVSYRPAEAAQAKKAQAQTTKVAVLRPEGR
                     QAAALRRVLTQELGKKGRGRQVLPAKKVDAQVRRIRGGPKTDAQRQALAKKLGADVLV
                     LASVKGTKRWAVEVRAYSGKDGTLLAEERWDVRANRAFPDVRRELEPRLGAALKAGLE
                     RRLPPAAVTPPTPLSEPEVAPPAPIAEAPRPAGVKPPPPTVKREEPPVESEPTAAGLR
                     DLDGPILEALLSGQGLFRRFNFSGNNANALPDYNLNSAAAASLAVSYFPLSHFTDGVV
                     HNLGIVARGSRALGLSSRLPDGSEYGTTAQLLEGGLRFRLPLRWLEVSVSALYGIHTF
                     AVDLPPESTFALPDVDYRFAHVELGLRKALTERWAIAARVGYQHVLSGGELSSDDYFP
                     ELSGSGLDGELAVEFALTRTLGLRLGGELRSYSFTAGAADGAPVIAGGAKDLYFSGQL
                     GVYLRL"
     gene            12762..14285
                     /locus_tag="LILAB_00060"
                     /db_xref="GeneID:10874475"
     CDS             12762..14285
                     /locus_tag="LILAB_00060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative secreted protein"
                     /protein_id="YP_004663026.1"
                     /db_xref="GI:338529692"
                     /db_xref="GeneID:10874475"
                     /translation="MARLTHVQWSNSVQELLRLDAPPTTLAGTFRADPAQSGFLFDND
                     ARALSVDEALWGAYQRAAAELAGQVTTDATKLARLLPPSAATDEERARAFVESFGLRA
                     HRRPLTSEEVESYLALYRKGPQAYADMSDFEGGIRLVIEAFLQSPHFLYRVERSTEAV
                     QDRVPLDDYEVASRLSYGLWSAMPDDALFAAASEGTLRSREGVATQARRMLQDARSNK
                     VVEAFHRTLFDVPRYAAIRPSPTRYPQVSERLGEYAARETTLFVQDVVFSRKGGYSDL
                     LTSPNTFVNDELARVYGLSGAFTADFVPVTLDSRERKGVLTQVGFLASHATSVDPDPI
                     HRGVFVSERIICRKIGAPPANIPPLPAPQGRTNREVVASHTEAPGTPCASCHSTLINP
                     LGFPFENFDAIGGYRTTDNGHPVDASSTPNINGETVPVRDALDLADALAANEAVHACY
                     ARHWVEYLHGRPSANEDVPLVERLGKLSQAGNLSIVDLVVEVVTSEGFVNRHPEELP"
     misc_feature    12768..12980
                     /locus_tag="LILAB_00060"
                     /note="Protein of unknown function (DUF1587); Region:
                     PSD3; pfam07626"
                     /db_xref="CDD:254318"
     misc_feature    13026..13226
                     /locus_tag="LILAB_00060"
                     /note="Protein of unknown function (DUF1595); Region:
                     PSD5; pfam07637"
                     /db_xref="CDD:254322"
     misc_feature    13257..13643
                     /locus_tag="LILAB_00060"
                     /note="Protein of unknown function (DUF1592); Region:
                     PSD4; pfam07631"
                     /db_xref="CDD:148955"
     misc_feature    13692..13997
                     /locus_tag="LILAB_00060"
                     /note="Protein of unknown function (DUF1588); Region:
                     PSCyt3; pfam07627"
                     /db_xref="CDD:254319"
     misc_feature    <14106..14255
                     /locus_tag="LILAB_00060"
                     /note="Protein of unknown function (DUF1585); Region:
                     PSD2; pfam07624"
                     /db_xref="CDD:148952"
     gene            14282..15706
                     /locus_tag="LILAB_00065"
                     /db_xref="GeneID:10874476"
     CDS             14282..15706
                     /locus_tag="LILAB_00065"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide prediction"
                     /protein_id="YP_004663027.1"
                     /db_xref="GI:338529693"
                     /db_xref="GeneID:10874476"
                     /translation="MKLSRRMVLRGLGGTMLSLPFLEGLMPRTARAADSGVLPYAIFF
                     RQANGVASAQTTSELGAEPERFWPRTLGALTAESIAGRAVGVLDDHRAHLLVVRNVNM
                     RDFNYGDGHARGAMQGLTARGPVVEGAGGGSESGGESIDHRIGRELNPQQRDSLVFYA
                     GRRGGWLGGPCLSYRSSNVRRAALHDPWNAYQTMIGGPGGLTPEAREQLLVRQRSVND
                     LVKAQLQALQQRPELSASDHERLDLHLSNVRDLEVALSCRMRADQELILQQQAPGYDS
                     TDGTEVLATARLHMDIAVMAMACGTNRAAVIQVGNGNDGDTRYRHPDTGQLMENFHYV
                     SHRRSSHDSSGGIITGSDLLHHHVDVQFASAFKHLLDRLVAYQMPDGKRLIEHGVAVW
                     YNDLGNGPAHSARNVPFVLAGSCNGFLKQGVYVEASGGGNPNHNRMLNTIGSAVGLRN
                     AAGGYLDDFGDPALTKGVLSELIA"
     misc_feature    14456..15277
                     /locus_tag="LILAB_00065"
                     /note="Protein of unknown function (DUF1552); Region:
                     HXXSHH; pfam07586"
                     /db_xref="CDD:254303"
     gene            15894..17015
                     /locus_tag="LILAB_00070"
                     /db_xref="GeneID:10874477"
     CDS             15894..17015
                     /locus_tag="LILAB_00070"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="epoxide hydrolase domain-containing protein"
                     /protein_id="YP_004663028.1"
                     /db_xref="GI:338529694"
                     /db_xref="GeneID:10874477"
                     /translation="MRPFTLAIPDSELADLRARLKATRFPPTVEGVGWDDGTDAELLR
                     QLVTHWAERFDWRAAEQRLNAIPQFIEELDGERVHFVHASGQGETRIPIVLANGWPSN
                     FVEFLPLIPLLTAERGGVSFDVIIPSMQGYGFSGRPTKQGMNMSRMGHLWAELMTRLG
                     YEKFLMACSDLGSGVCFSMVRNHPGRLMGVHYLNVFSGYPRPAAPTPEEVDYFRRVDL
                     WNATQGAYVMLHGTKPQTLAVGLNDSPAGLASWIIEKFHSGSRLQDGRLESVYSLDDL
                     CTLLSVYWFTQTIGSSIRLYKEAFADQELLMPMPRHDVKQGVLVPADVDNPAPRAWGE
                     RHLQNLVHWTEARQAGHYPALEDPEHYAADIRAFHRTIR"
     misc_feature    15897..16223
                     /locus_tag="LILAB_00070"
                     /note="Epoxide hydrolase N terminus; Region: EHN;
                     pfam06441"
                     /db_xref="CDD:253733"
     misc_feature    16134..17009
                     /locus_tag="LILAB_00070"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            17029..17721
                     /locus_tag="LILAB_00075"
                     /db_xref="GeneID:10874478"
     CDS             17029..17721
                     /locus_tag="LILAB_00075"
                     /note="COG2378 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663029.1"
                     /db_xref="GI:338529695"
                     /db_xref="GeneID:10874478"
                     /translation="MDKTERLFAVMDALRRHRRPVTAAALAKEQGVSLRTLYRDVRTL
                     IGLGAPIVGEAGVGYVLKPGFFLPPLMFTAEELEALVLGSRWVEAQPDVGLAGAARNA
                     LSKIATASPDELRDRMKDTGLWPILMRGGPVSVPVLGLVRQAIREERALRIVYADGKG
                     PPSQRDIWPVQLAFHEGKQIVAAWCCLRQAFRNFRVDRITSAAATEARYGRQRSVLAR
                     EWRDEWKRLYPD"
     misc_feature    17029..>17709
                     /locus_tag="LILAB_00075"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    17050..17205
                     /locus_tag="LILAB_00075"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    17434..>17718
                     /locus_tag="LILAB_00075"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            18049..18270
                     /locus_tag="LILAB_00080"
                     /db_xref="GeneID:10874479"
     CDS             18049..18270
                     /locus_tag="LILAB_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663030.1"
                     /db_xref="GI:338529696"
                     /db_xref="GeneID:10874479"
                     /translation="MGDAGTFATQAGANLTHTFIPTPSYWVAAGVDQKVGTVLDIQTV
                     TQTAPVIYPDNVYSLTATLNDDNTWTVTQ"
     gene            complement(18582..19058)
                     /locus_tag="LILAB_00085"
                     /db_xref="GeneID:10874480"
     CDS             complement(18582..19058)
                     /locus_tag="LILAB_00085"
                     /note="COG0681 Signal peptidase I"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S24 and S26 domain-containing protein"
                     /protein_id="YP_004663031.1"
                     /db_xref="GI:338529697"
                     /db_xref="GeneID:10874480"
                     /translation="MLTAMGAGAALLVAGVAAAAWGRRRWVVVAVQGNSMSPTLHDGQ
                     RLVARRLGRAPAPGNGYSRSDVVVFVLSAKQRETLEAEALPYLVKRVAAVAGDPVPDW
                     ARAALGADDDSRVPPGKVVVSGDNARSQDSRQLGYIDAEAIIAIVRLRGPEPSGTG"
     misc_feature    complement(18618..18977)
                     /locus_tag="LILAB_00085"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cd06462"
                     /db_xref="CDD:119396"
     misc_feature    complement(order(18792..18794,18954..18956))
                     /locus_tag="LILAB_00085"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119396"
     gene            complement(19058..20914)
                     /locus_tag="LILAB_00090"
                     /db_xref="GeneID:10874481"
     CDS             complement(19058..20914)
                     /locus_tag="LILAB_00090"
                     /note="COG1132 ABC-type multidrug transport system, ATPase
                     and permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase/permease"
                     /protein_id="YP_004663032.1"
                     /db_xref="GI:338529698"
                     /db_xref="GeneID:10874481"
                     /translation="MSEARGGLRELTRTVGAAVALQWRAAPLASVFALLLTLCTGSVA
                     AAGGWLTKALLDELGRGALADSQRALTLAVGAAAVVGGSMAILNVSEYLTGVIRWGVT
                     LEVERRLFTKVAALEGLHHFEDPAFHGRLRLAEEAARDAPQQLIEFVKATLRMLVTVG
                     TLSAVVLLVSPPMALLLLLAGGVALLAQLVRSRWLVELAVALVPTYRWRDFYHALLVD
                     VRAAKESRLFGLGDLLLERMVASLRKAADRELAVTRKGLAVQAALSLLTAAVAAVGSF
                     IVARGALQGRLQLGDVSLFLAAVAGIQGAFNGLLAQVEFAGRSVQTFKHYLDIIALPV
                     HAPEASRPVAPLRHGVELRDVWFRYDAQGPWVLRGVSLFIPAAGSVGLVGVNGAGKST
                     LVKLLCRLYDAERGQILWDGVDVRELDARALRRRMTATFQDFMTYDFTAAENIGLGDL
                     DRLKDEARIRDVARLAEIDEKLASLPAGYHTLLSRVLEGEDEDMPAGVSLSGGQWQRL
                     ALARALMRQDVDLLVLDEPSSGLDAAAEFHIHRTLARHGEGRARLLISHRMSALRSAD
                     TLFVLSEGRIIEQGSHDALMTAGGEYARLFTLQASGYQDERVASRAGQKEVA"
     misc_feature    complement(19109..20824)
                     /locus_tag="LILAB_00090"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    complement(19127..19867)
                     /locus_tag="LILAB_00090"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(19742..19765)
                     /locus_tag="LILAB_00090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(19244..19246,19337..19342,19619..19621,
                     19739..19747,19751..19756))
                     /locus_tag="LILAB_00090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(19619..19630)
                     /locus_tag="LILAB_00090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(19388..19417)
                     /locus_tag="LILAB_00090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(19337..19354)
                     /locus_tag="LILAB_00090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(19319..19330)
                     /locus_tag="LILAB_00090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(19238..19258)
                     /locus_tag="LILAB_00090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(20911..21432)
                     /locus_tag="LILAB_00095"
                     /db_xref="GeneID:10874482"
     CDS             complement(20911..21432)
                     /locus_tag="LILAB_00095"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663033.1"
                     /db_xref="GI:338529699"
                     /db_xref="GeneID:10874482"
                     /translation="MIETLVVGGVILSVLVVGNLLLTLALVGRLRALQEMIANQVVLR
                     DPALPQKGEPVGSFEATTLEGEAFTDAVLREGKTLVGFFTTGCRPCSSLRKQLVDSPP
                     GMPLMAFVEGDPDDPQTLELGASLKQVARVAFLTEGDSVTRAIKQAGYPTLVLVERGV
                     VAASGHHLHEVLP"
     misc_feature    complement(20941..21261)
                     /locus_tag="LILAB_00095"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(21429..21962)
                     /locus_tag="LILAB_00100"
                     /db_xref="GeneID:10874483"
     CDS             complement(21429..21962)
                     /locus_tag="LILAB_00100"
                     /note="COG0226 ABC-type phosphate transport system,
                     periplasmic component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663034.1"
                     /db_xref="GI:338529700"
                     /db_xref="GeneID:10874483"
                     /translation="MLATVFALAALGKARGRRPFDEFIQTLESFGLPRALAGAPLAAM
                     LVLTEAASALLLGVGVAAGYALALALLVGFTLGIAWVMRRGEQVACRCFGASNAPVGA
                     AHLVRNGLLLAVTVAGAVSHPSASGGLAMGMGVIAGTVGVLAGLFVTRWDDLVFLLRG
                     PQPLAASPRTRRNRGSQ"
     misc_feature    complement(21564..21959)
                     /locus_tag="LILAB_00100"
                     /note="Methylamine utilisation protein MauE; Region: MauE;
                     pfam07291"
                     /db_xref="CDD:115916"
     gene            complement(22063..22221)
                     /locus_tag="LILAB_00105"
                     /db_xref="GeneID:10874484"
     CDS             complement(22063..22221)
                     /locus_tag="LILAB_00105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663035.1"
                     /db_xref="GI:338529701"
                     /db_xref="GeneID:10874484"
                     /translation="MKTLKALSDRFLKLFLSEIPAGACVPENGQCCSAKHRRFNCYGS
                     CIKTSVCG"
     gene            22783..23964
                     /locus_tag="LILAB_00110"
                     /db_xref="GeneID:10874485"
     CDS             22783..23964
                     /locus_tag="LILAB_00110"
                     /note="COG1819 Glycosyl transferases, related to
                     UDP-glucuronosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="sterol 3-beta-glucosyltransferase"
                     /protein_id="YP_004663036.1"
                     /db_xref="GI:338529702"
                     /db_xref="GeneID:10874485"
                     /translation="MRVLISTYGTRGDVQPFVALAKALRARGHVVALCTPAGFRGMVE
                     RHGIPYAHMDNAVLELTEAVLRAPTRAEQRRLFKGFGAIVRASMEDEWRAARELEPDV
                     LVYHSKALGSHHIAEKLRAAELLAMPLPLTPTRAFPAPMVPSFRLGGWLNALTYRVLA
                     LANAVWAGATNDFRVKTLGLAPRSRFADPMKTVEGSAVPALYAYSEHLLPRPPDWPLE
                     AQVTGCWFLDEGDPWTPPPALRAFLEAGPPPLYVGFGSMGAAHAESRAATVLKAVALT
                     GERAVLASGWGGMKARDLPPHVFMLESAPHDWLFPRMSAVVHHGGAGSTMAGLRAGKP
                     TVICPFLGDQPFWGHMVLRAGAGPGRGVDRRTRGAGLGLGRHEGARPPAPCLHAGVRA
                     T"
     misc_feature    22783..23880
                     /locus_tag="LILAB_00110"
                     /note="This family includes the Gtfs, a group of
                     homologous glycosyltransferases involved in the final
                     stages of the biosynthesis of antibiotics vancomycin and
                     related chloroeremomycin. Gtfs transfer sugar moieties
                     from an activated NDP-sugar donor to the...; Region:
                     GT1_Gtf_like; cd03784"
                     /db_xref="CDD:99960"
     misc_feature    order(22783..22785,22861..22863,23083..23085)
                     /locus_tag="LILAB_00110"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99960"
     misc_feature    order(22816..22821,22825..22827,23257..23259,23266..23271,
                     23281..23283,23377..23379,23548..23550,23737..23739,
                     23743..23745,23749..23754,23761..23763)
                     /locus_tag="LILAB_00110"
                     /note="active site"
                     /db_xref="CDD:99960"
     misc_feature    order(22816..22818,23548..23550,23737..23739,23743..23745,
                     23749..23754)
                     /locus_tag="LILAB_00110"
                     /note="TDP-binding site; other site"
                     /db_xref="CDD:99960"
     misc_feature    22819..22821
                     /locus_tag="LILAB_00110"
                     /note="acceptor substrate-binding pocket; other site"
                     /db_xref="CDD:99960"
     gene            24029..24310
                     /locus_tag="LILAB_00115"
                     /db_xref="GeneID:10874486"
     CDS             24029..24310
                     /locus_tag="LILAB_00115"
                     /note="COG1819 Glycosyl transferases, related to
                     UDP-glucuronosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 28"
                     /protein_id="YP_004663037.1"
                     /db_xref="GI:338529703"
                     /db_xref="GeneID:10874486"
                     /translation="MRAGKPTVICPFLGDQPFWGHMVLRAGAGPQPVPQKSLTAERLA
                     DAIRTALSPTMRAHATALGERIRAENGPARAVALIEQEHMRWNRRHAAN"
     misc_feature    <24029..24271
                     /locus_tag="LILAB_00115"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(24408..25895)
                     /locus_tag="LILAB_00120"
                     /db_xref="GeneID:10874487"
     CDS             complement(24408..25895)
                     /locus_tag="LILAB_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663038.1"
                     /db_xref="GI:338529704"
                     /db_xref="GeneID:10874487"
                     /translation="MTDAPAPVSPAPGDVTAQWEAPLPELGPATLLKDLYPPPDEPFP
                     GPFGGPAPTDLLAFRDRLYFSAIDFAAGRGALWRSNGTTASTVPVKRLDDAPGRLTVV
                     GNQLFFTGGFSEEHGNELWVSDGTTAGTRRVKDLTPASGTAFLENFIAVDDTLFFFRV
                     VRMPLIFSSELELWRSDGTAEGTVRVTELGQEGTFNGPLELASVGGLLFMSFGETDTG
                     TELWGSDGTAEGTHLVKDLFPGPGSSFPRSLTPAAGVLYFSADDGEHGRELWRSDGTE
                     QGTELVEDTRPGPEGSQAQPITVFKQRLYFATFTPRYAATELRKLNPDPSCHPRSQRV
                     ATIPNPYANIPREFFIFVSTFTATERKLYFTLYYDVGSPAPADVQLWRTDGTRKGTKL
                     LYQPLLESPDLLPPRPVPTDDGRVVFYAYDEAHGHELWVTNGQPSGTRLLQDINPGPA
                     SSYPQDLLRAGDFIYFTAVDGVHGREIWTLPVPDPEAVQQQSSRE"
     gene            26470..28734
                     /locus_tag="LILAB_00125"
                     /db_xref="GeneID:10874488"
     CDS             26470..28734
                     /locus_tag="LILAB_00125"
                     /note="COG2217 Cation transport ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="YP_004663039.1"
                     /db_xref="GI:338529705"
                     /db_xref="GeneID:10874488"
                     /translation="MTLLALALMGLAAGGVLHVAHASDAARWAWAATTAVVLLPTLVS
                     IIKGLLRRETGVDLIAVLAMVGALALGEYLAGAIISVMLTGGAALERFAVARARRELS
                     ALLKRAPRVAHRRVGADISDVDVAEVGLGDFLVIKPGEVVPADGILSSGSAVLDESAL
                     TGESKPVQLDAGTPVRSGGTNAGGPFELRVTASAAESTYAGIIRLVKAAEESKAPFIR
                     LADRYALGFFGLTLALSGFAWFAGGSPSRALAVLVVATPCPLILAAPAALLAGVSRAA
                     KHGIIVKGGGPLETLARAKVLLLDKTGTVTSARPQVVAVETFGPMSSDDVVRHAASVE
                     QLSVHPFAPAILAEARSRSVEPSFPADVREQMGTGIEGTVDGRRVAVGQLAFAAPDTP
                     RTPELRSIKMRTAVEGSSSVYVSINGSLAGVLLIQDPIRPEAPRALRSLRAAGVQRIH
                     MVTGDHPDVAELVGDAVGVDRVFTERTPEEKVEVIKVVRAEGITAMVGDGINDAPALA
                     LADIGVAMGARGATAASEAADVVLTADRLEGLLLATRIAQHTRRIALESIFVGMGLSL
                     VAMLFAAAGYITPVAGAILQEGIDVLVILNALRALGGGGLITPKRPEVKGLAQRLASA
                     HRSLRPHVSELAALAARLDSLEPSDARAQLERLHEMLETKLWPHEREEQQTAYPLLGK
                     MLKDEDPTGPLIQTHHEIHRLARLFGRLVSQLPPEGPRAEDLRDLRRALYGLHAILTL
                     HFAQEEELYSLFEA"
     misc_feature    26635..28269
                     /locus_tag="LILAB_00125"
                     /note="heavy metal translocating P-type ATPase; Region:
                     ATPase-IB_hvy; TIGR01525"
                     /db_xref="CDD:233447"
     misc_feature    26701..27339
                     /locus_tag="LILAB_00125"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    <27658..27990
                     /locus_tag="LILAB_00125"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     pfam12710"
                     /db_xref="CDD:257240"
     misc_feature    <27841..28065
                     /locus_tag="LILAB_00125"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     misc_feature    28330..28716
                     /locus_tag="LILAB_00125"
                     /note="Hemerythrin HHE cation binding domain; Region:
                     Hemerythrin; pfam01814"
                     /db_xref="CDD:250887"
     misc_feature    order(28342..28344,28471..28473,28483..28485,28558..28560,
                     28690..28692,28702..28704)
                     /locus_tag="LILAB_00125"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:213981"
     gene            28961..30397
                     /locus_tag="LILAB_00130"
                     /db_xref="GeneID:10874489"
     CDS             28961..30397
                     /locus_tag="LILAB_00130"
                     /note="COG0438 Glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_004663040.1"
                     /db_xref="GI:338529706"
                     /db_xref="GeneID:10874489"
                     /translation="MLKPFEVHVQAEPLARFEREMDAARWNTLQAQAVKARALMAGRA
                     FWNISSTAKGGGVAEIVPRLVAYARGASVDAHWLVLTGTPEFFHITKRLHHALHGSRG
                     DGSPLGAVEHERYDEVLRDNAEELLVLVQPGDVVLLHDPQTCGLAPALAAVGAHVVWR
                     CHIGRDTPNEEVTRAWEFLAPGLAAARLTIFTRAAYVPPQCADRALVIQPSIDIFAVK
                     NQPMTPEVARAILANTGLLRGTPGSPEPIFTRADGVTARVSRCADIMQLGTEPSPDVP
                     LVVQISRWDPQKDPAGVLSAFALLLRQSPNLRAELVLAGPAVTSVADDPDAAATLQDV
                     LALWRQQSHFVRQRVHLACLPMTDLEENAAIVNALQRHAAIVAQKSLQEGFGLTITEA
                     MWKARPVVASAVGGLQDQVVHGENGLLVRDPGDRAEFAGAVRSLLEAPERAALLGRRA
                     HEHVRAHFTVTRHLTDFVRLIDLLKARG"
     misc_feature    29096..30382
                     /locus_tag="LILAB_00130"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    <29684..30394
                     /locus_tag="LILAB_00130"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            30634..30792
                     /locus_tag="LILAB_00135"
                     /db_xref="GeneID:10874490"
     CDS             30634..30792
                     /locus_tag="LILAB_00135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663041.1"
                     /db_xref="GI:338529707"
                     /db_xref="GeneID:10874490"
                     /translation="MSLAGEELLHVEERLWILTAPTDKAFCDFAFGTARDCRRPAPLR
                     NCTPSTSE"
     gene            30789..31532
                     /locus_tag="LILAB_00140"
                     /db_xref="GeneID:10874491"
     CDS             30789..31532
                     /locus_tag="LILAB_00140"
                     /note="COG2453 Predicted protein-tyrosine phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663042.1"
                     /db_xref="GI:338529708"
                     /db_xref="GeneID:10874491"
                     /translation="MMTCGPLPSAPSMCEDIGHMAYASAFAIGAALLAFLATTLQGAG
                     LLLMWPAVSFILVALAYAGAGPKVLGKRPDGRMQPIAVLMLLPYLLLTWGTWHLVRLL
                     SRERPHAMVVPDVVVGRRLLPGELPKGVTVVLDLTAEFIEPDGIRGACQYVSLPILDA
                     STLPAEEVAPVLLGLATVPGPIYVHCAQGHGRTGMIAAALLVARGDAPDEREALAMIQ
                     RVRPAVRTSTAQRHALAELAGALRRASPA"
     misc_feature    <31173..31391
                     /locus_tag="LILAB_00140"
                     /note="Tyrosine phosphatase family; Region:
                     Y_phosphatase3; cl19170"
                     /db_xref="CDD:267523"
     gene            complement(32930..33265)
                     /locus_tag="LILAB_00145"
                     /db_xref="GeneID:10874492"
     CDS             complement(32930..33265)
                     /locus_tag="LILAB_00145"
                     /note="COG1733 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_004663043.1"
                     /db_xref="GI:338529709"
                     /db_xref="GeneID:10874492"
                     /translation="MTAASGIEDAIQMLEGRWKLVILFHLFGGKTRRFSELERAIPAI
                     SQKMLIQQLRQLEQDGIVARIVHAQVPPKVEYHLTEWGQSLCPALDELLTWAEKRPTP
                     KRRRRPARA"
     misc_feature    complement(32975..33250)
                     /locus_tag="LILAB_00145"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     gene            33442..33702
                     /locus_tag="LILAB_00150"
                     /db_xref="GeneID:10874493"
     CDS             33442..33702
                     /locus_tag="LILAB_00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663044.1"
                     /db_xref="GI:338529710"
                     /db_xref="GeneID:10874493"
                     /translation="MARCFTDDALVVDERHEHRGRAAIEAWNAAANGKFTFTTELLAA
                     EFDGPLITVRANVTGTFPGSPIQLHFRFTLAGGLISRLEIAP"
     misc_feature    33442..33684
                     /locus_tag="LILAB_00150"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cl09109"
                     /db_xref="CDD:263720"
     gene            33699..34478
                     /locus_tag="LILAB_00155"
                     /db_xref="GeneID:10874494"
     CDS             33699..34478
                     /locus_tag="LILAB_00155"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_004663045.1"
                     /db_xref="GI:338529711"
                     /db_xref="GeneID:10874494"
                     /translation="MSFNLELKNRRALVTGGTKGVGAAVVTALVEAGVKVVATARTAP
                     SDTQGVHYVAADVTTIEGCARVARDALEHLGGIDILVNVLGGSSAPGGGFAALGEDAW
                     QKELNLNLMPAVRLDRALLPSMLAQGAGVIVHVTSIQRELPLPESTTAYAAAKAALST
                     YSKALSKEVAPKGVRVVRVSPGWVETEASVHLAERLAEQAGTDYEGGKQLIMKSLGGI
                     PLGRPVKPREVADLIAFVVSPRAGSITGTEYVIDGGTVPTV"
     misc_feature    33699..34475
                     /locus_tag="LILAB_00155"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06523"
                     /db_xref="CDD:180604"
     misc_feature    33723..34469
                     /locus_tag="LILAB_00155"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(33744..33746,33750..33755,33759..33761,33816..33824,
                     33945..33953,34101..34109,34137..34139,34161..34163,
                     34239..34250)
                     /locus_tag="LILAB_00155"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(34023..34025,34107..34109,34137..34139,34161..34163)
                     /locus_tag="LILAB_00155"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(34753..35121)
                     /locus_tag="LILAB_00160"
                     /db_xref="GeneID:10874495"
     CDS             complement(34753..35121)
                     /locus_tag="LILAB_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663046.1"
                     /db_xref="GI:338529712"
                     /db_xref="GeneID:10874495"
                     /translation="MRNVSTPTLLLSICAIGLILAVGAAWWMGRTSILVVNASERELW
                     SLEVKFPGRTCRYEAVAPQAEVLCEGRADRDGDVEVSYRFDEGGELGVFSTEYVNPTL
                     GWQGSMVLRPDGTIDVTRAR"
     gene            complement(35460..35558)
                     /locus_tag="LILAB_00165"
                     /db_xref="GeneID:10874496"
     CDS             complement(35460..35558)
                     /locus_tag="LILAB_00165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663047.1"
                     /db_xref="GI:338529713"
                     /db_xref="GeneID:10874496"
                     /translation="MVDIASTTALWSWGLMPLGLMGRPTSAAMPMC"
     gene            complement(35659..36147)
                     /locus_tag="LILAB_00170"
                     /db_xref="GeneID:10874497"
     CDS             complement(35659..36147)
                     /locus_tag="LILAB_00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663048.1"
                     /db_xref="GI:338529714"
                     /db_xref="GeneID:10874497"
                     /translation="MARDGCIYSISAYPQPNVTPTVYDVRLFRQPIPTCGYGFGSVTL
                     GTSVVYEPTRSVAMNALGIAASYTKKSSLSGSAPITLSVHHVDPATLTVIRSSSLGVH
                     LGAGNIVSETVAIAADGTTVTVSGSKTGVIWGESGSGSHYTATFPDFFTSTTPPTVMA
                     FP"
     gene            complement(36559..37944)
                     /locus_tag="LILAB_00175"
                     /db_xref="GeneID:10874498"
     CDS             complement(36559..37944)
                     /locus_tag="LILAB_00175"
                     /note="COG3391 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663049.1"
                     /db_xref="GI:338529715"
                     /db_xref="GeneID:10874498"
                     /translation="MALAASTLGACRDNDPPPNAPPVARDVTVETVEDTPLELHLPAS
                     GSGALTFTIVEAPDHGTLSEVGANGSLTYTPGADYHGEDALIFRATNGQGQSAQATVT
                     ITIAPVNDAPTLSTVADQRIPAGSSTGDLAFTVGDVETHPDGLVVTATSSNTDLVPDD
                     PANLLFGGSGSGRTLSVVPTANASGSTTITLTVSDGSDTTSTTFTVDVTALASLYWMT
                     AAGSLWRIDVNGANAIELATGISGGSSVATDPVTRTLFYTRDSAIVRADSDGANPVDV
                     VANGGYPSGLAVDSTNRKLYWSDFNGSRVMRAELDGSSPTQVVGGINSPSAIAFDIPN
                     DKAYVITYNNTRLVRFSLDGSNLETVASNLGGLGVGLAVDSSGGKVYYSTRGNSIYVA
                     DLDGSNVTTLVTNQTTVHGIAIDVTAGRMYWADWLGTALRSANLDDGGDIQDVNSGSA
                     RNLGLAWMPAP"
     misc_feature    complement(37003..37119)
                     /locus_tag="LILAB_00175"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    complement(36625..36747)
                     /locus_tag="LILAB_00175"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     gene            38382..38618
                     /locus_tag="LILAB_00180"
                     /db_xref="GeneID:10874499"
     CDS             38382..38618
                     /locus_tag="LILAB_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663050.1"
                     /db_xref="GI:338529716"
                     /db_xref="GeneID:10874499"
                     /translation="MKEIHARRVSARVIYAKEVKARDGRVGRIVRGEPRRENWGGSEL
                     KVRNVSADVIRAKELHADWLEADGIHAKEVRFGR"
     gene            complement(38741..39781)
                     /locus_tag="LILAB_00185"
                     /db_xref="GeneID:10874500"
     CDS             complement(38741..39781)
                     /locus_tag="LILAB_00185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663051.1"
                     /db_xref="GI:338529717"
                     /db_xref="GeneID:10874500"
                     /translation="MNPGVSIVADDTRSWGLETPGPGLVLRVPSTGRWARRPWVHLEA
                     APDYRIRLRGGRQTLLWARIDSYWDSAVFVRGTATAPLVLPPLSAPEVRAVEAASGSE
                     AWWEAWSWRMARALVDAPLPVLHSGHWCLRPVHAIAAEKAERHPISPMEWSFGQPPPP
                     PHSLASVTRFLSGWSEDWWESLPEQRPGAVLGLRALSAPEDGRVKSWRKRARDGTLPP
                     VLLLFVDILAKWVVLDGHDRLHAALLEGVTPQLLGLWPFIIRPRPEKSTREEGALVSA
                     EFLFRGGATPETVDRVNRMLLFSFSADPRGTVSRAWPLPGGRETWREEVSARRREGPL
                     PLLDETDWDWLT"
     gene            complement(39778..40467)
                     /locus_tag="LILAB_00190"
                     /db_xref="GeneID:10874501"
     CDS             complement(39778..40467)
                     /locus_tag="LILAB_00190"
                     /note="COG2207 AraC-type DNA-binding domain-containing
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663052.1"
                     /db_xref="GI:338529718"
                     /db_xref="GeneID:10874501"
                     /translation="MHGFRFDAHQQMTGVVLDTFHVFLCLDGRASIRRSMNDSVELMD
                     LGPGDVLVNPMAMSLRWSSSGAFEVLNIAVHPGYLEEAVRESMRGLVRLRPRALPYAP
                     VPSLVQLGREPHREVSTPGLLGAQRGARAAGERIALHLLRNFVDVERAGHDRTFTPEE
                     RLDQPVRVEHLAALVRLGEHHFSRTFRVIFGSARLNGGVQAVRAAGGTGVSWGTLHGA
                     MDSGQIEERVA"
     gene            40596..41573
                     /locus_tag="LILAB_00195"
                     /db_xref="GeneID:10874502"
     CDS             40596..41573
                     /locus_tag="LILAB_00195"
                     /note="COG2203 FOG: GAF domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="YP_004663053.1"
                     /db_xref="GI:338529719"
                     /db_xref="GeneID:10874502"
                     /translation="MKFLGELDEVSLARTQRCNRRLTDPNRLQAIRDTGLMDTPQEEA
                     FDRLARLAAQLLDVPLTIMSLVDADRQFFKADFGLPSPFRETRQLPIDASLCRYTLEG
                     EPIISSNAPADPFLKFHPSTGPWGIVALIVLPLINPEGHVLGTFCCIQPSVREWTARD
                     HTVMRELTASIMTELNLRDQIRKLKVEQNLRDTFVAALTHDLRTPLAAAKVSVQLLGR
                     RHGELPGVQTSVARVNGSLDRAERMIQNLLDASRIKAGKYVALDLGECDLHALTTQAL
                     DELSAVYPGRFILKAEGAFKMKADPLGLRRIVENLASNAAKYGAPGNPD"
     misc_feature    40719..41150
                     /locus_tag="LILAB_00195"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    <41055..>41561
                     /locus_tag="LILAB_00195"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    41157..41351
                     /locus_tag="LILAB_00195"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(41175..41177,41187..41189,41199..41201,41208..41210,
                     41220..41222,41229..41231,41280..41282,41292..41294,
                     41301..41303,41313..41315,41322..41324,41334..41336)
                     /locus_tag="LILAB_00195"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    41193..41195
                     /locus_tag="LILAB_00195"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     gene            41602..41856
                     /locus_tag="LILAB_00200"
                     /db_xref="GeneID:10874503"
     CDS             41602..41856
                     /locus_tag="LILAB_00200"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="YP_004663054.1"
                     /db_xref="GI:338529720"
                     /db_xref="GeneID:10874503"
                     /translation="MVLQVRNQGAPIAADELQTIFEPFHRARSAAESAAKGWGLGLPL
                     VRGIAEAHGGKATVTSSADEGTCFTVTLPVDATGQQRLTA"
     misc_feature    <41605..41844
                     /locus_tag="LILAB_00200"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    <41605..41817
                     /locus_tag="LILAB_00200"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(41614..41616,41620..41622,41626..41628,41632..41637,
                     41716..41727,41773..41775,41779..41781,41794..41799,
                     41803..41805)
                     /locus_tag="LILAB_00200"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(41626..41628,41632..41634,41716..41718,41722..41724)
                     /locus_tag="LILAB_00200"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(41910..42719)
                     /locus_tag="LILAB_00205"
                     /db_xref="GeneID:10874504"
     CDS             complement(41910..42719)
                     /locus_tag="LILAB_00205"
                     /note="COG1595 DNA-directed RNA polymerase specialized
                     sigma subunit, sigma24 homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma factor"
                     /protein_id="YP_004663055.1"
                     /db_xref="GI:338529721"
                     /db_xref="GeneID:10874504"
                     /translation="MSKRTDEQLVKAARSGDGEALDEVLTRHEKQVYRFGLRMCGSEE
                     DAMEVLQETLLTAFRGIHAFRGDAALSTWLYQVARTHCFRLRRRRAGAPEDFQPLDMP
                     AATQVVAQEATPDMVSHARQMGEVLQAAILALPEAYREVLILRDVEGLTAEEAARVVG
                     VEVRALKSRLHRARLQMREHLATLMGEGAPGQHPGCPALARELAEFAEEAVDQAACSR
                     LEDHLSRCPRCSEACDALKRTVSLCRRIPGDEVPAPVRAAVRHALVQALPT"
     misc_feature    complement(42159..42692)
                     /locus_tag="LILAB_00205"
                     /note="RNA polymerase sigma factor RpoE; Provisional;
                     Region: PRK09652"
                     /db_xref="CDD:236608"
     misc_feature    complement(42450..42650)
                     /locus_tag="LILAB_00205"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(42186..42347)
                     /locus_tag="LILAB_00205"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(42198..42200,42204..42209,42213..42221,
                     42225..42230,42234..42236,42264..42269,42285..42287,
                     42315..42317))
                     /locus_tag="LILAB_00205"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     misc_feature    complement(41940..42137)
                     /locus_tag="LILAB_00205"
                     /note="mycothiol system anti-sigma-R factor; Region:
                     antisig_RsrA; cl15806"
                     /db_xref="CDD:247078"
     gene            complement(42727..43185)
                     /locus_tag="LILAB_00210"
                     /db_xref="GeneID:10874505"
     CDS             complement(42727..43185)
                     /locus_tag="LILAB_00210"
                     /note="COG2391 Predicted transporter component"
                     /codon_start=1
                     /transl_table=11
                     /product="YeeE/YedE family protein"
                     /protein_id="YP_004663056.1"
                     /db_xref="GI:338529722"
                     /db_xref="GeneID:10874505"
                     /translation="MRSSLSAFLSGVLFALGLGLAGMTDPANVLGFLDLAGDWDYRLA
                     FVMGGAIAVHAALRPLIHRRARPLFAATFAALPRGRPDAPLLMGSALFGVGWGLAGYC
                     PGPALTALASGAGQVLVFVAAMLVGFSLARVLQAPSRKAFGGAGVLPERR"
     misc_feature    complement(<42805..43167)
                     /locus_tag="LILAB_00210"
                     /note="Predicted transporter component [General function
                     prediction only]; Region: COG2391"
                     /db_xref="CDD:225264"
     misc_feature    complement(42814..42933)
                     /locus_tag="LILAB_00210"
                     /note="Sulphur transport; Region: Sulf_transp; pfam04143"
                     /db_xref="CDD:190881"
     gene            complement(43198..43626)
                     /locus_tag="LILAB_00215"
                     /db_xref="GeneID:10874506"
     CDS             complement(43198..43626)
                     /locus_tag="LILAB_00215"
                     /note="COG2391 Predicted transporter component"
                     /codon_start=1
                     /transl_table=11
                     /product="YeeE/YedE family protein"
                     /protein_id="YP_004663057.1"
                     /db_xref="GI:338529723"
                     /db_xref="GeneID:10874506"
                     /translation="MTSSILLPLLGGALIGLSASLLLLANGRVAGISGVVGSLLAPVR
                     GDIAWRVLFFAGLLAGGLLLSWLRPSAFPVPSSPSAGGVWLLVGAGLLVGVGSRLGNG
                     CTSGHGVCGISRGSARSIAATLTFMATGVLTVFVVRHVLA"
     misc_feature    complement(<43474..43617)
                     /locus_tag="LILAB_00215"
                     /note="Domain of unknown function (DUF4341); Region:
                     DUF4341; pfam14241"
                     /db_xref="CDD:258431"
     misc_feature    complement(43204..43614)
                     /locus_tag="LILAB_00215"
                     /note="Predicted transporter component [General function
                     prediction only]; Region: COG2391"
                     /db_xref="CDD:225264"
     gene            43721..44440
                     /locus_tag="LILAB_00220"
                     /db_xref="GeneID:10874507"
     CDS             43721..44440
                     /locus_tag="LILAB_00220"
                     /note="COG0491 Zn-dependent hydrolases, including
                     glyoxylases"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase family protein"
                     /protein_id="YP_004663058.1"
                     /db_xref="GI:338529724"
                     /db_xref="GeneID:10874507"
                     /translation="MIFRQLFDSESSTYTYLIGDEATRQAVLIDPVLEQAGRDLKLVA
                     ELDLTLTHVFDTHVHADHVTASGVLRERTQATVVGGVGGASCANLHVRHGDAVRVGQL
                     VFQVLATPGHTDDSVSYLLGDRVFTGDALLIRGNGRTDFQNGNAGQLYDSLTRVLFAL
                     PDSTLVYPGHDYQGRTVTSIAEEKRHNPRVANQSREAFIHIMEHLNLPKPRRLEVAVP
                     ANRGCGHPTPAPASLDSTAAS"
     misc_feature    43721..44413
                     /locus_tag="LILAB_00220"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; cl00446"
                     /db_xref="CDD:260426"
     gene            complement(44453..44638)
                     /locus_tag="LILAB_00225"
                     /db_xref="GeneID:10874508"
     CDS             complement(44453..44638)
                     /locus_tag="LILAB_00225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663059.1"
                     /db_xref="GI:338529725"
                     /db_xref="GeneID:10874508"
                     /translation="MRAALRGEVVTVYVLESAASLGDPSFYPLLLALRDSAAPADNDF
                     QHVLDDVIAQFEQSAQA"
     gene            complement(44608..45267)
                     /locus_tag="LILAB_00230"
                     /db_xref="GeneID:10874509"
     CDS             complement(44608..45267)
                     /locus_tag="LILAB_00230"
                     /note="COG1413 FOG: HEAT repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663060.1"
                     /db_xref="GI:338529726"
                     /db_xref="GeneID:10874509"
                     /translation="MGQLEAQSTEALIQIALEGDEDDARAWDAIRALHLRGTREVLDA
                     AIQLLGAPSAKARGRGADILGQLGGGEPAFPAECGEALVNLLHREQAPAVLLSVGVAL
                     GHLQAPRALSALVKLASHPSAEARYGAAHGLAVLNAPEAVEALIRLSADEDRDVRDWA
                     TFGLGSMMEDVDTPRCGMRSRRGLAKRTPRFSERPWWGSRTARTRALSSPCARRFGAR
                     W"
     misc_feature    complement(44959..45243)
                     /locus_tag="LILAB_00230"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(44773..45030)
                     /locus_tag="LILAB_00230"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            45468..45581
                     /locus_tag="LILAB_00235"
                     /db_xref="GeneID:10874510"
     CDS             45468..45581
                     /locus_tag="LILAB_00235"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_004663061.1"
                     /db_xref="GI:338529727"
                     /db_xref="GeneID:10874510"
                     /translation="MLMLAVGIGASTALFSVVEGVLLRPLPYPRPGAARAR"
     misc_feature    45468..>45563
                     /locus_tag="LILAB_00235"
                     /note="Acidobacterial duplicated orphan permease; Region:
                     ADOP; TIGR03434"
                     /db_xref="CDD:234207"
     gene            complement(45511..46482)
                     /locus_tag="LILAB_00240"
                     /db_xref="GeneID:10874511"
     CDS             complement(45511..46482)
                     /locus_tag="LILAB_00240"
                     /note="COG2819 Predicted hydrolase of the alpha/beta
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="YP_004663062.1"
                     /db_xref="GI:338529728"
                     /db_xref="GeneID:10874511"
                     /translation="MMRIHWLLAAALLTVSCASRPVPRDEPVTLQDTFQFDLGSAHTG
                     RTHRIYVAVPKGPAPAAGHPVIYLLDGDAHFPTLERLMRALPRLAKGFGVPAATPIIV
                     GLTYAGDAAASAQARGEDYTPPAPDVSNTGDRFSKKQGGADRFLDFVKQELEPALAAR
                     LPLDGSRTALMGHSYGGLLVLHALFTRPASFNTFVAGSPSIWWNGRYVLTEKTAFVER
                     AAATPVKARVLLTVGGLEQTPRKSAGPRGMFAAQRRMVDNTRELAAELSAMGGDDFQV
                     QYLEFPGDDHYSSWLPLLNRGLLYFTAPALLPGADRAGDAAARPPPR"
     misc_feature    complement(45583..46410)
                     /locus_tag="LILAB_00240"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2819"
                     /db_xref="CDD:225375"
     misc_feature    complement(45580..46365)
                     /locus_tag="LILAB_00240"
                     /note="Putative esterase; Region: Esterase; pfam00756"
                     /db_xref="CDD:250111"
     gene            complement(46569..47855)
                     /locus_tag="LILAB_00245"
                     /db_xref="GeneID:10874512"
     CDS             complement(46569..47855)
                     /locus_tag="LILAB_00245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663063.1"
                     /db_xref="GI:338529729"
                     /db_xref="GeneID:10874512"
                     /translation="MKLKTALLALAVFATACSDSEDPTPPDSGTPDPDAGTSQPLYAA
                     ITQVAIAGGNTQSYLVTLDDIEEAQTVGIDDAVELPSDSYIATGVPGTGRFFVSSSRV
                     PTMTPYTLNADGSIVAGDPLSFTGQGVAATNGYQSQHYFVSETKAYYFDHVNYKLVIW
                     NPQDLSIITSRDLTSELKDGDFTFRYSQSLAVTAGNDVIIAGGWHASDVRTIPAKTAL
                     VIVDTQTDEVTVKTDNRCGWARDGVKHTDGKVYYATESLGSGAHFVSPGTAGAPCMIR
                     FNPATGEFDSWFTTLDSFVNPGTEGDIAAMLLPGAPGKGYLRVMNKTAAQTAWDAAVA
                     AERPFNGQSAAVGAWWSLWEVTLGEAPTATAVVRDDLVPTNGRTIPQNPGELLVLPEF
                     INDNAQTRFRLMSPETGLGDAKTVVEGQVRGLLRIR"
     gene            complement(47914..50295)
                     /locus_tag="LILAB_00250"
                     /db_xref="GeneID:10874513"
     CDS             complement(47914..50295)
                     /locus_tag="LILAB_00250"
                     /note="COG0810 Periplasmic protein TonB, links inner and
                     outer membranes"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB family protein"
                     /protein_id="YP_004663064.1"
                     /db_xref="GI:338529730"
                     /db_xref="GeneID:10874513"
                     /translation="MLLAQPEAVYPPEAVASGIEGAVKLLLTLDAEGRVSRAEVVEGL
                     GHGLDEAAVRALENARFSPALQDGNPVPCQFEFIHHFVRGPSPDVAPPAEDAAQGTAD
                     APVAEEAAPSPEAAEPPAGFTSVVRGKSTEARALVRGSESVDVVELEKAHERAEDLAE
                     VLTRASAVQVQRTGGLGSRTQLSLGGLSGDQVRVLIDGVPIEYSPYVYGLGSVPVSLI
                     RQLEVFNGVVPVRLATDALGGAIHLRSDLASPETGASLSLQGGSFGSYRGTGRLTWRA
                     NEHVFMRAAGFHDRARNDYRITVPVDDPTTGRVSPRALRRNHDAYRGTGGDLKVGFES
                     LPGIDRLVLNAYLGRYDKEVPHDQFMVQPYGAVTSAQESWGLGLRYAVSPHERLKVLA
                     IAGYNERVGELLDVTECLYDWYGTCRATRARAGEIGATPLENTQMRTTLFGRVRLLGS
                     LFDVEDLEVSLGVDDSDRSGENAYLTRLQQEDPLRVPLALTSSFGGVSHRQVLWGGKL
                     ENTAFLKGYLQRFASGTRQEAAEVRWAGGFGDTVRFSLTRGLLLKASYERTTRMPRVD
                     ELFGDGGLLVESADLVPESSHNANLGVELLPIVTPVGRFGATAVAGVRDVENLIQLFP
                     GDATQAYENVDHARSYTAHAGLDWASPGDWVGLNGTVTWLNFRNLAQEGQFSRFHGDR
                     IPNMPWLQASATARLQVSRLLSSADALGLEWTTRFVESFYRSWESAGRGGDKERVPTQ
                     VLHFAALTYRTRFDRRAFSFSFNLQNLTDAPAYDIVGVQKPGRAFSARATVDL"
     misc_feature    complement(50053..50280)
                     /locus_tag="LILAB_00250"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     misc_feature    complement(50083..>50268)
                     /locus_tag="LILAB_00250"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    complement(47920..50052)
                     /locus_tag="LILAB_00250"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    complement(47920..49872)
                     /locus_tag="LILAB_00250"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            51004..52125
                     /locus_tag="LILAB_00255"
                     /db_xref="GeneID:10874514"
     CDS             51004..52125
                     /locus_tag="LILAB_00255"
                     /note="COG3000 Sterol desaturase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663065.1"
                     /db_xref="GI:338529731"
                     /db_xref="GeneID:10874514"
                     /translation="MELPLNPALRINLGKRAGVTAGLLGVLCVCAEFCFLFPHLLVSN
                     DSRAIYVEHLGLVRGILQAAIVATFALGAVSVLTLRSKAHGGIAMLLALVAMLLGGSE
                     AEPLTQQPRAMSAGLDYFALELFVLGLVFIPMERLWGLHPQRIFREGWQTDLKHFFIS
                     HVGVQLISFAVMIPVQVFLAWAVRMDFQAHVAAQPVWLQFFEILVVVDLVSYWVHRAF
                     HQVPWMWKFHAIHHSSQQMDWLASSRSHLLDVLVNRFAGFVPVFLLGFSPSAIYGYLV
                     FVSFHAVYIHANVNHRWPYLRWVFATPEFHHWHHTSDEEGIDKNFAVFLSFIDAIFGT
                     AHLPAHWPSRYGTTKFQPPETYLGQLAYPFQRHEETAYG"
     misc_feature    51337..52101
                     /locus_tag="LILAB_00255"
                     /note="Sterol desaturase [Lipid metabolism]; Region: ERG3;
                     COG3000"
                     /db_xref="CDD:225546"
     misc_feature    51601..51936
                     /locus_tag="LILAB_00255"
                     /note="Fatty acid hydroxylase superfamily; Region:
                     FA_hydroxylase; pfam04116"
                     /db_xref="CDD:252387"
     gene            52204..52845
                     /locus_tag="LILAB_00260"
                     /db_xref="GeneID:10874515"
     CDS             52204..52845
                     /locus_tag="LILAB_00260"
                     /note="COG1309 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004663066.1"
                     /db_xref="GI:338529732"
                     /db_xref="GeneID:10874515"
                     /translation="MPRPPKHAPERGDARTRLLEAAREVIRTKGFTATSVDELCQRAE
                     VTKGSFFHHFKSKEALGVAAAEHWAETTSAFFAGAPYHAPSDPLERVLAYVAFRKSMM
                     AGDLAEFTCLVGTMAQEVHASSPDIRDACGASILGHAATLEADLDAAMTERRIAGGWT
                     AQSLARHTQAVIQGAFVLAKAGNDPALAHESLDHLDRYIRLLFGRPLQEKALP"
     misc_feature    52204..52803
                     /locus_tag="LILAB_00260"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    52255..52395
                     /locus_tag="LILAB_00260"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            52842..53381
                     /locus_tag="LILAB_00265"
                     /db_xref="GeneID:10874516"
     CDS             52842..53381
                     /locus_tag="LILAB_00265"
                     /note="COG3791 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663067.1"
                     /db_xref="GI:338529733"
                     /db_xref="GeneID:10874516"
                     /translation="MNPPPQLRCACGQVQLQVTGAPIVSAECCCTSCRTAGATLQALP
                     SAPRILGPHGTTRFELYRKDRVHFLEGAHHLKEHRLTPEAKTRRVVATCCNTPVFLEF
                     ESGHWLSLYGCLWSDGTLPRLELRTMASDLPPGVVLPDDVPNSRTQSFSFFVKLLGAW
                     IKMGFRSPKLAFVQGTLQR"
     misc_feature    52866..>52985
                     /locus_tag="LILAB_00265"
                     /note="Glutathione-dependent formaldehyde-activating
                     enzyme; Region: GFA; cl01553"
                     /db_xref="CDD:260996"
     gene            complement(53541..54512)
                     /locus_tag="LILAB_00270"
                     /db_xref="GeneID:10874517"
     CDS             complement(53541..54512)
                     /locus_tag="LILAB_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663068.1"
                     /db_xref="GI:338529734"
                     /db_xref="GeneID:10874517"
                     /translation="MRRIIVLLAALNLVACAHGGGTPEALAPEAATVAKPKPVATPEA
                     KQAASEANGLSMKGDNAGALPLYRTAWEGGVRGRNLAYNAACAASLLEEREEALVWLE
                     RAVEEGFNDAKHLQKDSDLDNVRSLPGYAALEQRVVAAEAEQYVAADPALRDELLKRM
                     EEDQAVRNALAASNFQDEAARAKLREVDARNTTWLKGVIAKQGWPGSALVGPRASFAA
                     WLLVQHADQDVAFQSEVLPMLEQAVARGEGSAKELAYLTDRVLVNTGKPQRYATQLEE
                     VDGKTVPRTLEDPAKVNERRASVGLDSLEEYIAAFERMKAAATQQKP"
     gene            54655..55053
                     /locus_tag="LILAB_00275"
                     /db_xref="GeneID:10874518"
     CDS             54655..55053
                     /locus_tag="LILAB_00275"
                     /note="COG5649 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663069.1"
                     /db_xref="GI:338529735"
                     /db_xref="GeneID:10874518"
                     /translation="MTDGESASKVISEKIAELGDWRGETLARMRALIKEAAPDVVEEV
                     KWRGTPVWSQDGGICTGETYKTAVKLTFFKGASLEDPAGLFNSSLDGNVRRAIDIHQG
                     EEVDAKAFKALIRAAVALNTAGGKKSTKRK"
     misc_feature    54670..55023
                     /locus_tag="LILAB_00275"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5649"
                     /db_xref="CDD:227936"
     gene            complement(55274..56296)
                     /locus_tag="LILAB_00280"
                     /db_xref="GeneID:10874519"
     CDS             complement(55274..56296)
                     /locus_tag="LILAB_00280"
                     /note="COG1899 Deoxyhypusine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyhypusine synthase"
                     /protein_id="YP_004663070.1"
                     /db_xref="GI:338529736"
                     /db_xref="GeneID:10874519"
                     /translation="MSASELPVLEFVLTNYKNFNARATRDALLSYWEHVSSGGRMFWS
                     VAGAMSSAQLGITLAPAIRAGLIHGLSVTGANLEESLFRLVAHSAYKDFPEYRYFTKQ
                     DDTKILEQRMRRVTDTSIPEDEAFRAVEKYVVPMWKTATEKGQRRFWHEYFYEVIQML
                     EPSSYEGDPEACWLLEAARRKLPIVVPGYEDSTFGNIFASYVKTGECNASIVKSGIEY
                     MADFYDRYEELSAGKGVGFFQIGGGIAGDFPICVVPSIKYDLQKPVKPWAYFCQISDS
                     TTSYGSYSGATPNEKITWDKLTETTPMFVIESDATIVAPLMLRALLEAQSKPEAAKAL
                     IAKHQR"
     misc_feature    complement(55313..56242)
                     /locus_tag="LILAB_00280"
                     /note="Deoxyhypusine synthase; Region: DS; cl00826"
                     /db_xref="CDD:260647"
     gene            complement(56452..56946)
                     /locus_tag="LILAB_00285"
                     /db_xref="GeneID:10874520"
     CDS             complement(56452..56946)
                     /locus_tag="LILAB_00285"
                     /note="COG1309 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004663071.1"
                     /db_xref="GI:338529737"
                     /db_xref="GeneID:10874520"
                     /translation="MRLAILRAAQELVLEKGYSAVTTADVAKRAAAGKQTLYRWWPGK
                     GALVLDAFSEWVSQAPRMSRRKPSLSSTLVEFCRGASEAAPVLRALMAEAQFDEDLHR
                     RLIAQLVRPRGDELRACLADRRPADRELVVNVLSGLVWQRLMLNEPLDARFVRFALRV
                     VQRI"
     misc_feature    complement(56455..56943)
                     /locus_tag="LILAB_00285"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(56800..56934)
                     /locus_tag="LILAB_00285"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            57158..59014
                     /locus_tag="LILAB_00290"
                     /db_xref="GeneID:10874521"
     CDS             57158..59014
                     /locus_tag="LILAB_00290"
                     /note="COG0277 FAD/FMN-containing dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidase, FAD binding protein"
                     /protein_id="YP_004663072.1"
                     /db_xref="GI:338529738"
                     /db_xref="GeneID:10874521"
                     /translation="MALTEVSERFGGSPSTPASGDTRFTPPAAPASKDEESLEGWGFA
                     DTRFVVKPDGNTVLTGTRYNISNVELPELMPWFAGKLASPLGYDNRNEPHYPPEIPAA
                     KQDAKLVAALREFLKEEQLTDDPKQRLRRGHGHTGGEIWAIRYRKLDRVPDLVVFPRG
                     HDEVVRLVEVATKHGACVIPFGGGTNVTEALRIPLAEERFVIAVDMRQMNRILWVDPV
                     NRMACIEAGATGRHLMEALAKFGFTMGHEPDSLEFSTLGGWIATNASGMKKNRYGNIE
                     DLVLDMQVVTAQGIVERPRQAPRESVGVNPRQYMFGSEGNFGIVTTAVVKLFPLPEVQ
                     RYGSVIFPDLETGLSFLYALQQSGAVPASVRVMDNTQFHFGQALKPAKHGLAAKLKSE
                     VEKAVVTKLKGFDPYKLAVATLVFEGSSEEVAFQEKTVYRIAAEHGGMKGGGANGERG
                     YQLTFGIAYIRDLTFEHWAIAESFETSVPWSRAMDLYERVQRRVEKEHAAMGLPGKVF
                     FTGRFTQVYQTGVVIYFYLGFYAKGVADPVAAYAALEHAAREEILAAGGSLSHHHGIG
                     KIRRGFLPEVYSEGALALNRKVKAAIDPDNVFGASNSGINGPVALTPDEEAH"
     misc_feature    57488..58981
                     /locus_tag="LILAB_00290"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    57611..58036
                     /locus_tag="LILAB_00290"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    58145..58951
                     /locus_tag="LILAB_00290"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            59014..61620
                     /locus_tag="LILAB_00295"
                     /db_xref="GeneID:10874522"
     CDS             59014..61620
                     /locus_tag="LILAB_00295"
                     /note="COG3320 Putative dehydrogenase domain of
                     multifunctional non-ribosomal peptide synthetases and
                     related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663073.1"
                     /db_xref="GI:338529739"
                     /db_xref="GeneID:10874522"
                     /translation="MSRHVFLTGVTGFVGKVVLEALLSQGVERVTVLVRESKDRQGRV
                     HSAAERFAKVAQAECFSRLPAGWTERVAVVSGDLEQPACGLAPADSEAVRQHVTHVVH
                     CAASVEFDLPLAQATSANIRSALSVLELARACPRLVGMVDVSTAYVNVWRPGPIEEKL
                     AHLPKPAAELYAAFQVAEGEGREWLELTGHPNTYTLTKSVAEHLICEQRGHVPVVIVR
                     PSIVSAAYRTPFPAWLDSPAALAGCLLYSGLGVVRAFNADPSVRLDVVPVDVVASEVV
                     RSVFGPMPKPGQAVPIVHATMGVQRALRIDMAAASTIEWFKHRPGVVKAPDMFVGRKD
                     HGFDTVDLVRRELPVQLQKAALALLGQSKAHRRLVRADEKVQYLNEGFSYFTHHTFDF
                     VRGAPLEVPGFDPFDYVRVVNEGMYRHLLSRDETQVSFAGPKHDDARGDRAWVQERGV
                     GNATHKVFGYALRKTFRHCTSDVTFDRPSFERAMAQVPPGTLVVLAPTHRSYFDFLLT
                     SYLCFQHPELGISMPHIAAAEEFGRIPVVGPILKESQAFFIKRGVGREVPELGEELRR
                     LTEKNASLMFFVEGQRSRARLMLPPKRGLLRALQNTQRKFVVLPIAISYDRLPEEASL
                     SEELSGRPRPKMTLTGVLSWLSKLARGQVQLGRVHVACGAPQALNPDTDVRALSHTLM
                     AELQRHTTVSSFHLRTFLAEHPIPGVDEAWLRDAIERRGGRVVDSDLPVPTPLSPALA
                     HSLRNQWQHWFAGDVLARQPGNPALEDHLSRYRWCATPLAELSDARVDAVVKALFEPV
                     VRDYQEATKVRAPDELKAVAVTHRPHLDGVVQALVSRDIVKPSGDNFEWGPNAAELSQ
                     FHEACAWRGVQP"
     misc_feature    59020..59973
                     /locus_tag="LILAB_00295"
                     /note="fatty acyl CoA reductases (FARs), extended (e)
                     SDRs; Region: FAR-N_SDR_e; cd05236"
                     /db_xref="CDD:187547"
     misc_feature    59032..59829
                     /locus_tag="LILAB_00295"
                     /note="Male sterility protein; Region: NAD_binding_4;
                     pfam07993"
                     /db_xref="CDD:254569"
     misc_feature    order(59038..59040,59044..59055,59113..59121,59320..59328,
                     59377..59379,59440..59448,59593..59595,59605..59607,
                     59668..59679)
                     /locus_tag="LILAB_00295"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187547"
     misc_feature    order(59380..59382,59446..59448,59593..59595,59605..59607)
                     /locus_tag="LILAB_00295"
                     /note="active site"
                     /db_xref="CDD:187547"
     misc_feature    order(59446..59448,59593..59595,59674..59676,59710..59712,
                     59758..59760,59776..59778)
                     /locus_tag="LILAB_00295"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187547"
     misc_feature    60040..>60189
                     /locus_tag="LILAB_00295"
                     /note="C-terminal domain of fatty acyl CoA reductases;
                     Region: FAR_C; cl03838"
                     /db_xref="CDD:176932"
     misc_feature    60421..61017
                     /locus_tag="LILAB_00295"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: GPAT-like; Region:
                     LPLAT_DHAPAT-like; cd07993"
                     /db_xref="CDD:153255"
     misc_feature    order(60508..60510,60517..60519,60523..60525,60595..60606,
                     60751..60759)
                     /locus_tag="LILAB_00295"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153255"
     gene            61593..62582
                     /locus_tag="LILAB_00300"
                     /db_xref="GeneID:10874523"
     CDS             61593..62582
                     /locus_tag="LILAB_00300"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD dependent epimerase/dehydratase family
                     protein"
                     /protein_id="YP_004663074.1"
                     /db_xref="GI:338529740"
                     /db_xref="GeneID:10874523"
                     /translation="MRLARGAAVKTLVTGASGFLGRNLLEALGDDAVALVRSPLPGAV
                     AQVSGTPLDPDAWLPRAQGVKVVIHAAGMVHHSRQHAEEMVRFNIDSALAMVRAAKAL
                     DARLVLVSTSGTVGCFAHPTIEADEHSLYAEGLVGRWPYYLSKIRAEEQSRKLAKQLG
                     VALTVVRPPVLLGPGDTLGRSTTNVARVLNGRLPFIPTGGIAFTDVRDVAHALAVLAK
                     KADWRDTYHLPGTALPLRTFFERVGEVAGIRVNRPGVPTLVVDGLAKLGSHVPLKKLP
                     DPVVLEMSTCHWGFKTLWSHEELDYRPRSHRQTLSDTVAWLREAQARQTPLAG"
     misc_feature    61626..62561
                     /locus_tag="LILAB_00300"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    61626..62543
                     /locus_tag="LILAB_00300"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(61635..61637,61641..61646,61650..61652,61698..61706,
                     61800..61808,61917..61925,62013..62015,62025..62027,
                     62094..62105)
                     /locus_tag="LILAB_00300"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(61854..61856,61923..61925,62013..62015,62025..62027)
                     /locus_tag="LILAB_00300"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            62750..63706
                     /locus_tag="LILAB_00305"
                     /db_xref="GeneID:10874524"
     CDS             62750..63706
                     /locus_tag="LILAB_00305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663075.1"
                     /db_xref="GI:338529741"
                     /db_xref="GeneID:10874524"
                     /translation="MHTSLRFASLLLASSLTAGCLGPETDADTAEVQSIEQQATDPSF
                     RVYNVVEAVLPAGNYDGVAGNECVALINPEHRLRKIIIVETAGANGACALNAYSAGSA
                     FSFTWGDTSVYQGPAGIASIRAALSDDDGAVHRLTGTLTSEATTLAHLQAFPTQTHAQ
                     QATQLKSFEAVRVHSIYDFEGQEQVYAEAAYQSVRVTQPCENPGYPSLNARVHNGFVY
                     GYTATNTGTRHSGATPPPTRGPATAAGSPGATSTTATGSSWRATSTRSSPPLLRCALR
                     PAARPDEGPGRAGEDLAVPARRVSSAARAVPTPVVPPACSNG"
     misc_feature    <63443..>63691
                     /locus_tag="LILAB_00305"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK12323"
                     /db_xref="CDD:237057"
     gene            63756..64061
                     /locus_tag="LILAB_00310"
                     /db_xref="GeneID:10874525"
     CDS             63756..64061
                     /locus_tag="LILAB_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663076.1"
                     /db_xref="GI:338529742"
                     /db_xref="GeneID:10874525"
                     /translation="MKLTAALLGLVSLLAMPEARASGDTASPVQDWNCDGAINSFDLL
                     LYETYYWSPGLPPWPLDPDGNPIYDQVEACVRCHEGNLTAPQELPTNKGGLMKSGCS"
     gene            64660..66690
                     /gene="hppA"
                     /locus_tag="LILAB_00315"
                     /db_xref="GeneID:10874526"
     CDS             64660..66690
                     /gene="hppA"
                     /locus_tag="LILAB_00315"
                     /EC_number="3.6.1.1"
                     /note="COG3808 Inorganic pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound proton-translocating
                     pyrophosphatase"
                     /protein_id="YP_004663077.1"
                     /db_xref="GI:338529743"
                     /db_xref="GeneID:10874526"
                     /translation="MVGAVGLLFAAVFYFRVKSLPEGDATMNRIAGYIREGAMAFLVR
                     EYKVLAAYCAVIAVLIGLALGPLASGSFVLGAFLSLLAGYIGMKAATYANVRTAQAAR
                     GGSKPNALLVALDGGAVMGLAVAGLGLLGMGGVYYAFQGHAQLSPILHSFAVGASSIA
                     LFARVGGGIYTKAADVGSDIAGKVIENIPEDDPRNPGVIADNVGDNVGDVAGMGADIY
                     ESMVAAIVAAMAIALTANATELSRLVVDPAATGTAKVAGVVLPLVLSAVGLVVSLLSI
                     FIARALKNMNPAQVLRSALILPPVILVGLSFVMMQVFGLSQAITAALAAGAFGGAIIG
                     LVTDYYTSARPVQRIAEASITGAGTNLIRGLAVGMESVGISMATIAVVAYIADQALGL
                     YGIALSAVGMLGGTAVVMTVDAYGPISDNAGGISEMSGLGPEVRAITDELDAVGNTTA
                     AIGKGFAIGSATLTVIALFSAFNLEVNHTRVAGGLPEMSLMLTDPRVIVGLLLGSILP
                     FMVGASTMLAVGRAAGAIVEEIGRQFREIPGLMELKADPDPKKIVDIATKSALREMIF
                     PGIVAVVAPPLVGFLLGPSALAGLLAGALVVGATMALYMANAGGAWDNAKKYIEKGKL
                     PGHAKGSAVHKAAVVGDMVGDPFKDTSGPGVAILIKVMSVVSLLVASLIALR"
     misc_feature    64708..66681
                     /gene="hppA"
                     /locus_tag="LILAB_00315"
                     /note="membrane-bound proton-translocating
                     pyrophosphatase; Validated; Region: hppA; PRK00733"
                     /db_xref="CDD:234827"
     misc_feature    64738..66669
                     /gene="hppA"
                     /locus_tag="LILAB_00315"
                     /note="Inorganic H+ pyrophosphatase; Region: H_PPase;
                     pfam03030"
                     /db_xref="CDD:251683"
     gene            66901..67104
                     /locus_tag="LILAB_00320"
                     /db_xref="GeneID:10874527"
     CDS             66901..67104
                     /locus_tag="LILAB_00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663078.1"
                     /db_xref="GI:338529744"
                     /db_xref="GeneID:10874527"
                     /translation="MVLELSQQQLHLLHACLAESAEQLRDEVLHTDERDLREALKLKL
                     DRLQKLQRQVEATMRAQEGTPAY"
     gene            complement(67153..68391)
                     /locus_tag="LILAB_00325"
                     /db_xref="GeneID:10874528"
     CDS             complement(67153..68391)
                     /locus_tag="LILAB_00325"
                     /note="COG0477 Permeases of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_004663079.1"
                     /db_xref="GI:338529745"
                     /db_xref="GeneID:10874528"
                     /translation="MSFIRAVHGNAGASISHGGSAPMSGALRLLLAVSAGVPVAALYY
                     SQPMLGVIGASTRASDAVVGFLPTLTQLGYALGILLLTPLGDRFDRRRIILVKAALLS
                     VALLLGGLAPGMSLLLVMSFAVGLTATVAQDIVPAAATLAPERERGKVVGTVMTGLLL
                     GILLSRVVAGVVAEQLGWRAMFLIAAGSVALIGVAAWRGLPRFQPTSTLSYGALLGSL
                     AVLWRRYGPLRRAALAQGLLSVGFSAFWSTLAVMLHGAPFHLGSAAAGAFGLAGAAGA
                     LGAPVAGRFADRFGPEVVTRLGAGLTALSFATMFAAPWLEPHARLWLIAGSAIGFDLG
                     VQMSLVAHQTIVFGIDPEARSRLNAVLFVGIFIGMSVGAASGSLVLARWGWAAVTVLA
                     TGAALAALLVRLAPAGRVAR"
     misc_feature    complement(67225..68334)
                     /locus_tag="LILAB_00325"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(67228..68253)
                     /locus_tag="LILAB_00325"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(67285..67287,67294..67299,67306..67311,
                     67318..67323,67354..67356,67372..67377,67387..67389,
                     67396..67401,67408..67410,67555..67557,67567..67569,
                     67576..67578,67588..67590,67600..67602,67642..67644,
                     67651..67656,67663..67668,67675..67677,67906..67908,
                     67924..67929,67936..67941,67975..67977,67981..67986,
                     67993..67998,68005..68010,68146..68151,68155..68160,
                     68170..68172,68179..68184,68191..68193,68242..68247,
                     68251..68253))
                     /locus_tag="LILAB_00325"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            68613..69509
                     /locus_tag="LILAB_00330"
                     /db_xref="GeneID:10874529"
     CDS             68613..69509
                     /locus_tag="LILAB_00330"
                     /note="COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004663080.1"
                     /db_xref="GI:338529746"
                     /db_xref="GeneID:10874529"
                     /translation="MQTFIRIVDAGSLSSAAAQLGTTQPTVSRRLQALERSLGLRLLQ
                     RSTHAMKLTEDGARCYGRAKELLASWELLEADLRGASNEPEGTLRVVVPHAFGQQLLV
                     EPLTEYLNRHARVSVEWLLHDRAVDFITDGIDCAIHVGEVHDPSVVAIRVAEVPRIVV
                     AAPSVLGGSSPPTHPDALARLPWLSLRTFYRNELSLTHVDTGEVQPITFQPRLSTDSL
                     YAIRSAALKGLGVCVASAWLLQEDLAQGRLVHLVPQWRAASLPMYLLYPHARFHPARL
                     RKFVELMRATIPAALAVATRAR"
     misc_feature    68613..69488
                     /locus_tag="LILAB_00330"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    68613..68780
                     /locus_tag="LILAB_00330"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    68868..69461
                     /locus_tag="LILAB_00330"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(68898..68900,68910..68912,69027..69029,69069..69071,
                     69075..69077,69264..69266,69315..69317,69396..69398)
                     /locus_tag="LILAB_00330"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(68901..68906,68916..68921,68925..68930,68937..68939,
                     68949..68951,68955..68975,69156..69158,69246..69260,
                     69279..69284,69291..69293)
                     /locus_tag="LILAB_00330"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     misc_feature    69590..74438
                     /note="potential frameshift: common BLAST hit:
                     gi|108756955|ref|YP_631380.1| ATP-dependent helicase HrpA"
     gene            complement(74543..75445)
                     /locus_tag="LILAB_00345"
                     /db_xref="GeneID:10874530"
     CDS             complement(74543..75445)
                     /locus_tag="LILAB_00345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663081.1"
                     /db_xref="GI:338529747"
                     /db_xref="GeneID:10874530"
                     /translation="MRQGTSRAAGTNAPPLAGLKESAMSISLLNRSCSSLPQVGVPYV
                     PSAASPAPDVKGTQASPPRSDAWQKLMTDAFEPAARGQGVNLSGVSSAPRAASASHVS
                     DAGPGFGAPSSGAVYNASQPWLSVNNVGSPYNSNMQLISPEQKSQFKFTNTFTNTTGQ
                     PQTITLWNKVGEKGGPNDGQNFDKSTPKTFTLQPGQSQMVAFDNNSSVAWCMSKDGSA
                     KPGANSGQTWGEATFGNAATGWSGYNTSQITPAGHTGSMSITNEATGKTVTEANAWQT
                     PSDDPAGRDVGVPAGPMHLRTVLS"
     gene            complement(75599..76303)
                     /locus_tag="LILAB_00350"
                     /db_xref="GeneID:10874531"
     CDS             complement(75599..76303)
                     /locus_tag="LILAB_00350"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="YP_004663082.1"
                     /db_xref="GI:338529748"
                     /db_xref="GeneID:10874531"
                     /translation="MLQGGLSRNHRLVALDLRGHGDSDKPEGEAPYVDGANFAGDLAA
                     VIRQLGLERPVVVAWSYGGVVVGDYLRHHGDEALGGLFLVAASLKTGKPARALFGPGM
                     MSNARGLLSEDAGTYAAAARAFVEACPARSFPPALVDASVQLMQRVPVNVRRALLSRA
                     EDYSAELARCRCPVVTLHGELDQVVLPAMSSEVVLASVRQGQSAWLAGVGHAPFIEAT
                     ADFEAVLETFVVAAWG"
     misc_feature    complement(75632..76288)
                     /locus_tag="LILAB_00350"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<76106..76288)
                     /locus_tag="LILAB_00350"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(76471..77510)
                     /note="potential frameshift: common BLAST hit:
                     gi|311106301|ref|YP_003979154.1| GntR family
                     transcriptional regulator"
     gene            77696..78565
                     /locus_tag="LILAB_00365"
                     /db_xref="GeneID:10874532"
     CDS             77696..78565
                     /locus_tag="LILAB_00365"
                     /note="COG0179 2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway)"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="YP_004663083.1"
                     /db_xref="GI:338529749"
                     /db_xref="GeneID:10874532"
                     /translation="MRIASILVRDTPALGVKTDRGMVDVTALDATVGSSLRALLERGP
                     EALASLARRAAEAPERFLLAPSAFRYRTLLPEPGKFLCLGLNYVAHASEATYETPRHP
                     VVFTRLPSSLLAHEEPLVVPTCSEQLDYEAELAVVVGRAGRNIPKARALEWVAGYTLF
                     NDGSIRDYQKRTHQWTIGKNFDGTGPLGPELVTPDELPEGARDLRIQMRVNGELLQDA
                     TTSDMIFDVATVLADLSEAMTLQPGDVIAMGTPSGVGAARKPPRFLRAGDVCEVSVER
                     IGVLRNPVVSAAK"
     misc_feature    77882..78556
                     /locus_tag="LILAB_00365"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    77930..78550
                     /locus_tag="LILAB_00365"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            78602..79144
                     /locus_tag="LILAB_00370"
                     /db_xref="GeneID:10874533"
     CDS             78602..79144
                     /locus_tag="LILAB_00370"
                     /note="COG0346 Lactoylglutathione lyase and related
                     lyases"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004663084.1"
                     /db_xref="GI:338529750"
                     /db_xref="GeneID:10874533"
                     /translation="MSTQAKLPGRLHHTAYVTQDLEATRKFYEELIGLPLVATWCESD
                     ELFGAVRTYCHTFFELADGSALAFFQFEKPEDQALFGPKMPDSPFHHIALDVTLEAQQ
                     GIEQRLRAAGYTEPGMYVLEHGYCRSLYVKDPNGMIVEFTYDSPDAVKPELVQARRAR
                     AHKELARWLAGDRTSNNVFR"
     misc_feature    78629..79027
                     /locus_tag="LILAB_00370"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(78638..78640,78650..78652,78761..78763,78800..78802,
                     78806..78808,78872..78874,78989..78991,79013..79015,
                     79019..79021)
                     /locus_tag="LILAB_00370"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(78638..78640,78872..78874,79019..79021)
                     /locus_tag="LILAB_00370"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            79141..79791
                     /locus_tag="LILAB_00375"
                     /db_xref="GeneID:10874534"
     CDS             79141..79791
                     /locus_tag="LILAB_00375"
                     /note="COG0726 Predicted xylanase/chitin deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oligosaccharide deacetylase"
                     /protein_id="YP_004663085.1"
                     /db_xref="GI:338529751"
                     /db_xref="GeneID:10874534"
                     /translation="MSLLTLSFDNGPDPDVTPRVLDTLASHALTAQFFVLGKHLVTEE
                     GRRLVARARDEGHVIGNHSFTHAVPLGEDPRPDAVEAEIVATDALLAPLVPAPKWFRP
                     FGGGGKLGPHLLSQRAVGHLRAHGYSCVLWNSVPGDWLDPKGWPEKALADCAARAHTL
                     MVLHDIPNACLEALDGFLHRAKDLGLRFTTECPSDCVPIVEGRIVRDISGMVAAGG"
     misc_feature    79156..79686
                     /locus_tag="LILAB_00375"
                     /note="Catalytic NodB homology domain of rhizobial
                     NodB-like proteins; Region: CE4_NodB_like_6s_7s; cd10917"
                     /db_xref="CDD:213022"
     misc_feature    order(79159..79170,79324..79341,79441..79443,79447..79449,
                     79456..79458,79534..79536,79552..79557,79624..79626,
                     79630..79632)
                     /locus_tag="LILAB_00375"
                     /note="NodB motif; other site"
                     /db_xref="CDD:213022"
     misc_feature    order(79165..79170,79324..79326,79336..79338,79447..79449,
                     79456..79461,79534..79536,79624..79626,79630..79632)
                     /locus_tag="LILAB_00375"
                     /note="active site"
                     /db_xref="CDD:213022"
     misc_feature    order(79165..79167,79441..79443,79552..79554,79630..79632)
                     /locus_tag="LILAB_00375"
                     /note="catalytic site [active]"
                     /db_xref="CDD:213022"
     misc_feature    order(79168..79170,79324..79326,79336..79338)
                     /locus_tag="LILAB_00375"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213022"
     gene            complement(79821..80189)
                     /locus_tag="LILAB_00380"
                     /db_xref="GeneID:10874535"
     CDS             complement(79821..80189)
                     /locus_tag="LILAB_00380"
                     /note="COG2337 Growth inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="PemK family protein"
                     /protein_id="YP_004663086.1"
                     /db_xref="GI:338529752"
                     /db_xref="GeneID:10874535"
                     /translation="MPPDRINRGDVFWVAPDDSRGPAPSYSHPHVVVQDDVFNHSRIT
                     TVVVCALTSNLHRASEPGNVLLEAGEANLPKQSVVVVSQISSVDKERLGERIGALSDA
                     RVEQILAGLRFQQVSFFRRP"
     misc_feature    complement(79848..80171)
                     /locus_tag="LILAB_00380"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:251304"
     gene            complement(80361..80681)
                     /locus_tag="LILAB_00385"
                     /db_xref="GeneID:10874536"
     CDS             complement(80361..80681)
                     /locus_tag="LILAB_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663087.1"
                     /db_xref="GI:338529753"
                     /db_xref="GeneID:10874536"
                     /translation="MENQMKSTLSLLVGALLFMGCGGPSPEEAQGSQGAIAIPEQYLS
                     PEDSSAEGGEVNALMACCYFRCSDNLLRGPFPNVVEGNCRNYAKYQCARRGLGFVGAS
                     WRDC"
     gene            complement(80719..81033)
                     /locus_tag="LILAB_00390"
                     /db_xref="GeneID:10874537"
     CDS             complement(80719..81033)
                     /locus_tag="LILAB_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663088.1"
                     /db_xref="GI:338529754"
                     /db_xref="GeneID:10874537"
                     /translation="MKNGHAEWFALFAGVVLLTGCGPANDETMPAVGPAEEGVSTPGI
                     PSEYLEEGGVESAAICCNVRCSGKWYGPFRSVNYDLCAKFGRYHCPQRGLVYQGYDWR
                     TC"
     gene            complement(81291..82253)
                     /locus_tag="LILAB_00395"
                     /db_xref="GeneID:10874538"
     CDS             complement(81291..82253)
                     /locus_tag="LILAB_00395"
                     /note="COG2207 AraC-type DNA-binding domain-containing
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004663089.1"
                     /db_xref="GI:338529755"
                     /db_xref="GeneID:10874538"
                     /translation="MSWLRGDPIDDVIQLLRPRTVVSAELRAAGRWGIRFQGYPHVKF
                     GTVVAGHCVILLEGQRRVVRCEAGDVYLLGNPPPYVMASDATAPRLEAHALFSRVTDG
                     VVTLGAAGTAPATHIVGGHFVFDASNAHLLMRALPPILRVPAASAGPLRELAGLLVRE
                     LAEPRPGRGLVLDRLSQLMLVHAMRSADLAGMRRRASWLQALADPRIGLALRRIHADA
                     RARVSLGELASAAGMSRSAFAARFKQLVGRPPLDYAIGWRMDLARDALRTTERTVGEL
                     AFAFGYESESAFSTAFRRVVGMSPRAYRQRARTSAVPPGKALAE"
     misc_feature    complement(81696..82235)
                     /locus_tag="LILAB_00395"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    complement(81495..81614)
                     /locus_tag="LILAB_00395"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(81342..81593)
                     /locus_tag="LILAB_00395"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(81339..81452)
                     /locus_tag="LILAB_00395"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            82323..83057
                     /locus_tag="LILAB_00400"
                     /db_xref="GeneID:10874539"
     CDS             82323..83057
                     /locus_tag="LILAB_00400"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_004663090.1"
                     /db_xref="GI:338529756"
                     /db_xref="GeneID:10874539"
                     /translation="MDSTGKTALVTGGNKGIGFAVVRQLAAHGYTTWLGSRDEARGRA
                     AVAALEEAGAGDVRFIALDVTDEASGAAAAARIASLTPSLDVLINNAGIYVKEGDGAP
                     STVRLDAMRATYDVNVFGPLRVTAAFLPLLRAARGAHVVMVGAGLGSLTLQLDPSQGL
                     SRWPAFAYSSSKTALNALTVGFANELREEGIVVTVVNPGFVATDLNGHAGTLTTDEGA
                     ERVLRAVQLPLSATGSFVTDHGTCPW"
     misc_feature    82338..83054
                     /locus_tag="LILAB_00400"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    82338..82883
                     /locus_tag="LILAB_00400"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    order(82356..82358,82362..82367,82371..82373,82428..82436,
                     82590..82598,82749..82757,82824..82826,82836..82838,
                     82914..82925)
                     /locus_tag="LILAB_00400"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(82671..82673,82755..82757,82824..82826,82836..82838)
                     /locus_tag="LILAB_00400"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            83333..84082
                     /locus_tag="LILAB_00405"
                     /db_xref="GeneID:10874540"
     CDS             83333..84082
                     /locus_tag="LILAB_00405"
                     /note="COG1309 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004663091.1"
                     /db_xref="GI:338529757"
                     /db_xref="GeneID:10874540"
                     /translation="MGTREKAGATQGRKRGRPRGRTEQGHETRQRLYAIALESLSTRG
                     YEATHLRDIAKEAGVSVGLLYRYFPSKRAILLALYDELSSAYAARAAALPAGPWRERF
                     SFALRTSLEVLGPHHAVLKALAPVLVSGEEDGVLAPQTAFSRLRVQAAFGEAVAGATD
                     APGSAPVTKALGRLLYVAHLAVLMWWLLDKSPGQRATAGLVALLSRVLLPASLALRLP
                     GAGSVVLRADVLCRQGLFGEAEPSDADEVPR"
     misc_feature    83396..83980
                     /locus_tag="LILAB_00405"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    83438..83566
                     /locus_tag="LILAB_00405"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            84079..84981
                     /locus_tag="LILAB_00410"
                     /db_xref="GeneID:10874541"
     CDS             84079..84981
                     /locus_tag="LILAB_00410"
                     /note="COG1398 Fatty-acid desaturase"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase family protein"
                     /protein_id="YP_004663092.1"
                     /db_xref="GI:338529758"
                     /db_xref="GeneID:10874541"
                     /translation="MSATRLEHPAPLPVEGRAHGPEARKAHLVPPEVGTLRFDPARTL
                     WLWAMLIPGVTVGLPAATPTTVAVSLLLTVATLCLGHSVGLHRGVIHRTYEAGPLTRG
                     VLAYLFVLSGLGGPLSWARLHAVRDYWQSRPDCPRYFAYGHSMVRDFGWNLHLRFEAA
                     DGRALARLPSDVLTDPWLRFLERTWPLHVLGLSGVVLAALGPEAVALCVCARTAASII
                     GHWAVGYAAHVWGERRYTLPGAAESGTNSWVLGVLSFGEGFHNNHHAFPCSARMGQKP
                     HELDLGWWAIRALRRLGLVRDVRT"
     misc_feature    84262..84975
                     /locus_tag="LILAB_00410"
                     /note="The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like
                     CD includes the delta-9 and delta-11 acyl CoA desaturases
                     found in various eukaryotes including vertebrates,
                     insects, higher plants, and fungi. The delta-9 acyl-lipid
                     desaturases are found in a wide...; Region:
                     Delta9-FADS-like; cd03505"
                     /db_xref="CDD:239582"
     misc_feature    order(84334..84336,84349..84351,84445..84447,84454..84459,
                     84856..84858,84865..84870)
                     /locus_tag="LILAB_00410"
                     /note="Di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239582"
     gene            85151..85882
                     /locus_tag="LILAB_00415"
                     /db_xref="GeneID:10874542"
     CDS             85151..85882
                     /locus_tag="LILAB_00415"
                     /note="COG2746 Aminoglycoside N3'-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside n3'-acetyltransferase-like
                     protein"
                     /protein_id="YP_004663093.1"
                     /db_xref="GI:338529759"
                     /db_xref="GeneID:10874542"
                     /translation="MREGGVLVVHTSFKAVRPVEGGPLGLIQALRAALGDAGTLVMPT
                     MTDGEGVFDPKRTPTEGMGITAELFWRQPGVLRSTHPGGSFAAVGPRARDICRPQPLS
                     PPHGPESPVGWAHESGGQVLLLGVTQGENTTLHLAEALAPVPYSVTHPCVVEVDGVAR
                     TVDIAETDHCCQGFQRADGWLRARGLLREGKVGHADAKLAEARDIVNVVVEHLRADPL
                     VFLCPADAGCEECDRARASVDDPAR"
     misc_feature    85172..85798
                     /locus_tag="LILAB_00415"
                     /note="Aminoglycoside 3-N-acetyltransferase; Region:
                     Antibiotic_NAT; pfam02522"
                     /db_xref="CDD:251351"
     gene            86107..87096
                     /locus_tag="LILAB_00420"
                     /db_xref="GeneID:10874543"
     CDS             86107..87096
                     /locus_tag="LILAB_00420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663094.1"
                     /db_xref="GI:338529760"
                     /db_xref="GeneID:10874543"
                     /translation="MVGCGPTSAESESPAPSTERQEAPLTTTDVDVAPECQGLLTFVN
                     TEPLSTLSTYLPSDVAQSLVSQRATAPFSTLVEVSAVRGISQARLARIEDGARTLGYV
                     GSTCAGVLDELALSTDDAAALVNLVNTIDSSALYAVLPYAWNGATNLLNLRPFTSAQA
                     ISEVSGVGTVSLRNLRNAATQGYALTALIAAINAQEESLWTSRLSQDFDIQDVIDGAH
                     GNGEFQSASCFGIDPSLFPAGQNWTVRPNLATGTEVYQEIEGTVGYADRNEPLPDTLM
                     ADGLAELQARTAGRTFNGCFISYGKGPWGGIQVKFYVDTVTGYRILSEQHWVE"
     gene            complement(87172..88308)
                     /locus_tag="LILAB_00425"
                     /db_xref="GeneID:10874544"
     CDS             complement(87172..88308)
                     /locus_tag="LILAB_00425"
                     /note="COG5640 Secreted trypsin-like serine protease"
                     /codon_start=1
                     /transl_table=11
                     /product="S1A family peptidase"
                     /protein_id="YP_004663095.1"
                     /db_xref="GI:338529761"
                     /db_xref="GeneID:10874544"
                     /translation="MMSVKFMRRWSTVGAMSLLVGCGPELVDEQAEAVTPATIEQDIV
                     GGTTTTINANPWQVSLRRGGHWCGGSILNKDWILTAAHCVDGYTVSSIVAGSTSSTST
                     SSGQTRNVAQVIIHEDYGSAGNDVALLRLATSLSLNGTTVAAIPRVSAADAASGATNP
                     GVVARVTGWGATSSGGSGSSTLRTVDVNVISNTEAQQSYPNEYIGPDQIGAKAPGKDS
                     CQGDSGGPLTVMHNGVRKLAGVVSWGYGCADSRYPGMYARVSHFEAWVDAKLSGTNPP
                     PTGTTLLSQTNLSGSSSTWRHFSISVPAGTTSLKVVQAGGSGDADLYVRRGSQPTTSA
                     YDCRPYSAGNNENCDFTNPASGTWYVSVRGYSSYSGVSVTATIP"
     misc_feature    complement(87508..88182)
                     /locus_tag="LILAB_00425"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    complement(87511..88182)
                     /locus_tag="LILAB_00425"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    complement(88180..88182)
                     /locus_tag="LILAB_00425"
                     /note="cleavage site"
                     /db_xref="CDD:238113"
     misc_feature    complement(order(87640..87642,87934..87936,88063..88065))
                     /locus_tag="LILAB_00425"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    complement(order(87577..87579,87583..87585,87658..87660))
                     /locus_tag="LILAB_00425"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     misc_feature    complement(87217..87417)
                     /locus_tag="LILAB_00425"
                     /note="Bacterial pre-peptidase C-terminal domain; Region:
                     PPC; pfam04151"
                     /db_xref="CDD:252413"
     gene            complement(88605..90017)
                     /locus_tag="LILAB_00430"
                     /db_xref="GeneID:10874545"
     CDS             complement(88605..90017)
                     /locus_tag="LILAB_00430"
                     /note="COG2272 Carboxylesterase type B"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carboxylesterase"
                     /protein_id="YP_004663096.1"
                     /db_xref="GI:338529762"
                     /db_xref="GeneID:10874545"
                     /translation="MREAYEFGYSALQSRQACIEGGGGDPGEMREDCLYLNVWTPRVD
                     ACAKLPVVFWIHGGAFVIGSGRVPPYDGFHLAARDVVLVTFNYRLGHLGFFVHPALEK
                     EHPGGPANFGLLDQMLALEWVRDNIAQFGGDPSNVTVMGQSAGAKSVLSLFTSPLVRE
                     KNLFRQGVAMSAYVLQEKSLSDAKLAGMAFAWRNGLDRLLATAEELRALSPEKFWMLP
                     TDTVNAPSPIYGDSVLPEPIRESFERGSQLPLPLILGSTSDDSSVVSSFGIDPGTILE
                     RLGAFAPAIRQLYPDVDDDREIGRRMCRDFVFTVLPRMLASRHAASGAAAWRYYFDYN
                     ARLLVPRQRLGVPHGGEVPYFLETAADVPPSGEFFTDEDRTFLHQLVASLVQFARTGT
                     PGPVAQVTWEGHTETQDRLLRLEVSPRMEADFERAILQAAESLIPILDSFARPPPPKL
                     PRAASPSTSASGNARPELRP"
     misc_feature    complement(88725..90014)
                     /locus_tag="LILAB_00430"
                     /note="Carboxylesterase type B [Lipid metabolism]; Region:
                     PnbA; COG2272"
                     /db_xref="CDD:225181"
     misc_feature    complement(<89580..>89906)
                     /locus_tag="LILAB_00430"
                     /note="Esterase/lipase [Lipid metabolism]; Region: Aes;
                     COG0657"
                     /db_xref="CDD:223730"
     misc_feature    complement(order(88962..88964,88971..88973,89109..89111,
                     89187..89189,89577..89579,89586..89594,89841..89849))
                     /locus_tag="LILAB_00430"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238191"
     misc_feature    complement(order(88974..88976,89589..89591))
                     /locus_tag="LILAB_00430"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238191"
     gene            90220..91377
                     /locus_tag="LILAB_00435"
                     /db_xref="GeneID:10874546"
     CDS             90220..91377
                     /locus_tag="LILAB_00435"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004663097.1"
                     /db_xref="GI:338529763"
                     /db_xref="GeneID:10874546"
                     /translation="MLVRKVAINEEQVRAFLENLFEEDLHAKRVLSLSHATLGVVHAA
                     SLSVHAIGQALAWARGGVQKHGIKQVDRLLSNEAVDVWKLAASWVPYVLAERTEAVVA
                     LDWTDFEADDHTTLVASLVTSHGRTTPLLWLTLKKSAMAGNRAQAEDELLLRLKECVP
                     EGVQVTILADRGFADQRLYALLAQAGFEYVVRFRKDVRVEVEGGHQRPAAEWIPASGH
                     AKKLTEVHVTADRTPVPAVVLVHQKGMKEPWCLATSLGAASARQVVDLYARRFSCEET
                     FRDVKDLRFGMGLSTVRVKSPERRDRLLLVSALAQVLLTLLGAAGESLGMEKGLKANT
                     VKTRTYSLFRQGCMYYQAIPMMKEERLRPLVERFAELLRHHPVFKEALGFI"
     misc_feature    <90712..91158
                     /locus_tag="LILAB_00435"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            91855..92580
                     /locus_tag="LILAB_00440"
                     /db_xref="GeneID:10874547"
     CDS             91855..92580
                     /locus_tag="LILAB_00440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663098.1"
                     /db_xref="GI:338529764"
                     /db_xref="GeneID:10874547"
                     /translation="MAIEKALLLIADIGGYTRFMSHHRFSLAHAQETVAQLLEAVIDA
                     SGPLKLAKLEGDAAFFYAVGDDFPTFARQVADIRRAFLARREQFVVDRMCKCDGCMQV
                     SALTLKFVAHAGEVAFQRVKHLTELAGVDVILVHRMLKNDVPVTEYVLMTDTVHQRLE
                     PELRQHTLGLEHDFEGMGRTATHYIDLNVFAIAAPEPVAPSLPRKLWAKVKMEWKSMK
                     YVLGLKQPCEDFRNVEVVDERSP"
     misc_feature    91954..92298
                     /locus_tag="LILAB_00440"
                     /note="Protein of unknown function (DUF2652); Region:
                     DUF2652; pfam10851"
                     /db_xref="CDD:151300"
     gene            92914..93438
                     /locus_tag="LILAB_00445"
                     /db_xref="GeneID:10874548"
     CDS             92914..93438
                     /locus_tag="LILAB_00445"
                     /note="COG2110 Predicted phosphatase homologous to the
                     C-terminal domain of histone macroH2A1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663099.1"
                     /db_xref="GI:338529765"
                     /db_xref="GeneID:10874548"
                     /translation="MSDERLVLMRGDITQVQADAIVNAANSALCGGGGVDGAIHRAAG
                     PGLLAECRTLGRCPPGEARITGGHGLPARHVIHAVGPVWQGGGSGEETLLARCYWRAF
                     SLMEQHGLGTIAFPSISTGAYGYPIERASRVALREILSALERMPTLQRVTVVLFSDRD
                     LDVYQRARQALGDG"
     misc_feature    92926..93414
                     /locus_tag="LILAB_00445"
                     /note="Macro domain, Appr-1'-pase_like family. The macro
                     domain is a high-affinity ADP-ribose binding module found
                     in a variety of proteins as a stand-alone domain or in
                     combination with other domains like in histone macroH2A
                     and some PARPs (poly...; Region: Macro_Appr_pase_like;
                     cd02908"
                     /db_xref="CDD:239236"
     misc_feature    order(92947..92952,92989..92991,93010..93012,93016..93021,
                     93268..93270,93274..93282)
                     /locus_tag="LILAB_00445"
                     /note="putative ADP-ribose binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239236"
     misc_feature    order(92980..92982,92989..92991,93007..93009,93019..93021,
                     93142..93144)
                     /locus_tag="LILAB_00445"
                     /note="putative active site [active]"
                     /db_xref="CDD:239236"
     gene            complement(93530..93877)
                     /locus_tag="LILAB_00450"
                     /db_xref="GeneID:10874549"
     CDS             complement(93530..93877)
                     /locus_tag="LILAB_00450"
                     /note="COG0501 Zn-dependent protease with chaperone
                     function"
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family peptidase"
                     /protein_id="YP_004663100.1"
                     /db_xref="GI:338529766"
                     /db_xref="GeneID:10874549"
                     /translation="MALLFALDRLLRLSAARGWFGATRFADIRNLPLISLLFFLLMLT
                     ARPVSGAFSREREYEADRYALRLTGDVASFRRMLVKAARVNKMDPAPPRWLVLKGMSH
                     PPIGERIASLPPS"
     misc_feature    complement(93542..>93877)
                     /locus_tag="LILAB_00450"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     gene            complement(93997..94461)
                     /locus_tag="LILAB_00455"
                     /db_xref="GeneID:10874550"
     CDS             complement(93997..94461)
                     /locus_tag="LILAB_00455"
                     /note="COG3791 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663101.1"
                     /db_xref="GI:338529767"
                     /db_xref="GeneID:10874550"
                     /translation="MSADSTEVALMVISGSCHCGNLSFTLVWEPSPDEIPARACGCSF
                     CTRHGGVWTSHPGGTLNVTVQEPSQVSRYVFGTRTAEFHTCCRCGVVPVVTSLIDGRL
                     YAVVNVNAFEGIDPARIRRATGSFDNEDTETRLARRKRNWISNVEILQAPRP"
     misc_feature    complement(<94108..94425)
                     /locus_tag="LILAB_00455"
                     /note="Glutathione-dependent formaldehyde-activating
                     enzyme; Region: GFA; cl01553"
                     /db_xref="CDD:260996"
     gene            complement(94557..95321)
                     /locus_tag="LILAB_00460"
                     /db_xref="GeneID:10874551"
     CDS             complement(94557..95321)
                     /locus_tag="LILAB_00460"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative epoxide hydrolase"
                     /protein_id="YP_004663102.1"
                     /db_xref="GI:338529768"
                     /db_xref="GeneID:10874551"
                     /translation="MTNLEAIEAYSMKNLVADAVGLLDALGERTAIVVGHDWGSAVAW
                     TCAALHPDRFRAVVGMSVPHLGRAPMPPMQLFQRMFGEKWFYILYFQEPGVAEAELEA
                     DVPKSVRTILAGTPGFDVTNPAVLAKKKGDGFLDGLDVPETLPGWLTEADVAYFAKEL
                     AGSGFRGGLNRYRNMDRDWHELPELATATIQQPALYLVGEKDPVRAFSPVDPMKALVP
                     NLADIQVIPGAGHWVQQERAEEVNAALVAFLRTLPA"
     misc_feature    complement(94581..95303)
                     /locus_tag="LILAB_00460"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_1;
                     pfam00561"
                     /db_xref="CDD:249959"
     misc_feature    complement(<95145..>95255)
                     /locus_tag="LILAB_00460"
                     /note="Novel bacterial esterase that cleaves esters on
                     halogenated cyclic compounds; Region: Esterase_713_like;
                     cl17303"
                     /db_xref="CDD:247857"
     misc_feature    complement(94572..>94778)
                     /locus_tag="LILAB_00460"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(95318..95545)
                     /locus_tag="LILAB_00465"
                     /db_xref="GeneID:10874552"
     CDS             complement(95318..95545)
                     /locus_tag="LILAB_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663103.1"
                     /db_xref="GI:338529769"
                     /db_xref="GeneID:10874552"
                     /translation="MTATNTAAKLRHGRVAKFPQEQRGRLIQRRFQRRIDGLLHETTR
                     AFIPGADAEERGCPQRFIHVPQRHRIQRACQ"
     gene            complement(95542..95970)
                     /locus_tag="LILAB_00470"
                     /db_xref="GeneID:10874553"
     CDS             complement(95542..95970)
                     /locus_tag="LILAB_00470"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative epoxide hydrolase"
                     /protein_id="YP_004663104.1"
                     /db_xref="GI:338529770"
                     /db_xref="GeneID:10874553"
                     /translation="MAGITHRTVTANGINLHLAEAGTGPLVLLVHGWPESWYSWRHQL
                     PALAAAGFHAVAPDVRGYGGSAGRRQRRKLVAPRVPGLRPAMHEQHERPRARLREVQV
                     DAIRRDGSMRDACHGTLRGEGGGARQRQARGLTRCFAARA"
     misc_feature    complement(<95764..>95895)
                     /locus_tag="LILAB_00470"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            95623..96051
                     /locus_tag="LILAB_00475"
                     /db_xref="GeneID:10874554"
     CDS             95623..96051
                     /locus_tag="LILAB_00475"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative epoxide hydrolase"
                     /protein_id="YP_004663105.1"
                     /db_xref="GI:338529771"
                     /db_xref="GeneID:10874554"
                     /translation="MAGITHRTVTANGINLHLAEAGTGPLVLLVHGWPESWYSWRHQL
                     PALAAAGAAAIAPDVRGHGVEAGRRQRRKLVAPRVPGLRPAMHEQHERPRARLREVQV
                     DAIRRDGSMRDACHGTLRGEGGGARQRQARGLTRCFAARA"
     misc_feature    95641..>95757
                     /locus_tag="LILAB_00475"
                     /note="haloalkane dehalogenase; Provisional; Region:
                     PRK03592"
                     /db_xref="CDD:235135"
     gene            complement(96009..96464)
                     /locus_tag="LILAB_00480"
                     /db_xref="GeneID:10874555"
     CDS             complement(96009..96464)
                     /locus_tag="LILAB_00480"
                     /note="COG1959 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663106.1"
                     /db_xref="GI:338529772"
                     /db_xref="GeneID:10874555"
                     /translation="MRRDSRLSVALHVLLHMEDMGPVVTSEAMGRLMKANPVVVRRTM
                     AGLREAGILTSVKGHGGGWSLARPLDAVTLGDVYEALGTPALFSIGPRDESPGCLVEQ
                     AVNTALEAALDEAAALLLRKLRNTSVAELGRGVRRRHARAAKQRVRPRA"
     misc_feature    complement(96012..96464)
                     /locus_tag="LILAB_00480"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG1959"
                     /db_xref="CDD:224870"
     gene            complement(96541..97089)
                     /locus_tag="LILAB_00485"
                     /db_xref="GeneID:10874556"
     CDS             complement(96541..97089)
                     /locus_tag="LILAB_00485"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663107.1"
                     /db_xref="GI:338529773"
                     /db_xref="GeneID:10874556"
                     /translation="MKKIMLSTCVCAALALTACGGDSDRLDSVQDEQPPAPSGPVQTE
                     DGKRFELRLRGSSMEGYDKLELPIGAVRVTVDGKPLKVELAKDRVDVAAADHAPLVAY
                     FYVPEGVERVRVSLQLDGLGGYTKAGAPGYIDAAVAPMTFEAPVHELALRGRAVVQLD
                     VARSLVDLGSHHLLLPNGVVNY"
     misc_feature    complement(<96985..97089)
                     /locus_tag="LILAB_00485"
                     /note="extracellular lipase, Pla-1/cef family; Region:
                     lipase_Pla1_cef; TIGR03502"
                     /db_xref="CDD:234234"
     gene            complement(97143..98078)
                     /locus_tag="LILAB_00490"
                     /db_xref="GeneID:10874557"
     CDS             complement(97143..98078)
                     /locus_tag="LILAB_00490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663108.1"
                     /db_xref="GI:338529774"
                     /db_xref="GeneID:10874557"
                     /translation="MRMKLKQQWMGAACAVVVGGSGVANAHDLICEKRVNGESVVVAD
                     EYPFTANYSFEVINVHPTLPSVLLTATDDVLSSEGFTFSPPPPVAIPVNGSLTDDFAL
                     QIGSYEECVAIAAEDGLADTHIDNTFRVTFDLGSAMCSARLTCEREEPPPVECTSATR
                     TLGFFSTRILTVTQCLALGPIDLGAIGTISTLPAAEGILWGSPAMYPQGGMRSQLDRL
                     RFLLARQTLVGICNQRLFGSTPTPPSLLTDAVAALDTTDCTLISSLIDPVDNFNNQCD
                     SYPLPEGFIPGPSTPQTAQAIAVDPTSNSGQSCSP"
     gene            complement(98431..100503)
                     /locus_tag="LILAB_00495"
                     /db_xref="GeneID:10874558"
     CDS             complement(98431..100503)
                     /locus_tag="LILAB_00495"
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase family protein"
                     /protein_id="YP_004663109.1"
                     /db_xref="GI:338529775"
                     /db_xref="GeneID:10874558"
                     /translation="MRADSQTVPAPPDAFQKRLDGLLIAALVVWGLTQLAPHLAHPAI
                     YIWDESMHQAATRGTHDTFFTPHLYKDPLYPTDPRHWWAAHVWMHKPTGPFWFGALMM
                     HVVGVTPLALRLASLLGHLAAAVSIYLIARRPAGRPWAVLGAAGFLAMPFGWQLVQGR
                     FFGDVTDCTLTGCNAVAVALLFHATRQGSWRWGVAAGAAVGLGFLCKTGLALTPLGIA
                     GTLWALGRLRFCPGPSFGTVVAMVGAAVLLAAPWSLYSAWRWPELHELEARVTRAHLF
                     HDPTVDVGPWHRPVDALFNEVNTQSLAPLPPVVPVLAFGWLLVRALRRRELEVVGLAL
                     WVGATWFVLTLGVVKVPAIAWGAVPAVLAALAISGADARRHPALAAALLAGLFTPWFI
                     QHLPALGRVRAALPPVLAQTRERPGLAEGLVVVAVAALLVGLVCRLLPRKLSWAPLGV
                     GLLASAVLAWHLAVTLPVARARYLSDHLDDLYVTYSREVGRALEQQTPARSVLFLAQD
                     FDVPHAMEYLSLMFWSNRMAYRRPPDVPTARRRRYHPYLVSPLAERYAPVPGVPPDAA
                     LRAYDLLAPRPAPAALPDGVTPLSFREKNMEVLGVAVGHAGGGRDRYAFFVRAHGAPH
                     SLRVVFQGPGGRLERSLDPGAARRRDAALRNASWFIVPVLGPPGADVTHLELGSDGQQ
                     VTLALPGA"
     misc_feature    complement(99760..100236)
                     /locus_tag="LILAB_00495"
                     /note="Dolichyl-phosphate-mannose-protein
                     mannosyltransferase; Region: PMT_2; pfam13231"
                     /db_xref="CDD:257589"
     gene            complement(100560..101858)
                     /locus_tag="LILAB_00500"
                     /db_xref="GeneID:10874559"
     CDS             complement(100560..101858)
                     /locus_tag="LILAB_00500"
                     /note="COG1004 Predicted UDP-glucose 6-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="YP_004663110.1"
                     /db_xref="GI:338529776"
                     /db_xref="GeneID:10874559"
                     /translation="MRIAIIGTGYVGLVAGTCFAESGHDVTCVDLDARKVEALRRGEL
                     PLYEPGLEELVRRNVAARRLRFTGHLPEAVSAAQVVFIAVGTPQSERGSADLQYVLAA
                     AEQIGRALRHYTVIVNKSTVPVGTSDQVRAVVARSTDVVFDVVSNPEFLKEGAALDDF
                     LKPDRVVIGATSERARRLMADLYAPFVRTENPILFMDPHSAELTKYAANAMLATRISF
                     MNDMALLCERVGANVDLVRKGMGADRRIGYAFLYPGIGYGGSCFPKDVRALMSTARDA
                     GLELDLLRAVESTNTRQKRCLLGKALKHYGSLADHTFAVWGLAFKPKTDDMREAPSVE
                     LIEGLLGKGARVQCHDPVAGAVARQYFGDRVAYAPTCYEAAEGADGIFLVTEWNEFRR
                     PDLKRLRALMRRPIIFDGRNVLDPRLARSEGFTYIGVGRD"
     misc_feature    complement(100611..101858)
                     /locus_tag="LILAB_00500"
                     /note="Predicted UDP-glucose 6-dehydrogenase [Cell
                     envelope biogenesis, outer membrane]; Region: Ugd;
                     COG1004"
                     /db_xref="CDD:223936"
     misc_feature    complement(101313..101858)
                     /locus_tag="LILAB_00500"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    complement(100980..101261)
                     /locus_tag="LILAB_00500"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    complement(100614..100919)
                     /locus_tag="LILAB_00500"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            complement(101882..102949)
                     /locus_tag="LILAB_00505"
                     /db_xref="GeneID:10874560"
     CDS             complement(101882..102949)
                     /locus_tag="LILAB_00505"
                     /note="COG0438 Glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663111.1"
                     /db_xref="GI:338529777"
                     /db_xref="GeneID:10874560"
                     /translation="MKVVILGLSITSSWGNGHATTYRGLVRELARRGHDVLFLERDVP
                     WYAANRDLPRPPYGRTELYASLEDLAGRFTEDVRRADLAMVGSYVPRGAAVGEWVQRT
                     ARGVTAFYDIDTPVTLALLERGACDYLRPELVPGYRLYLSFTGGPTLARIERALGAPA
                     ARPLYCSCDPELYAPAACEPRWALGYLGTYSEDRQPVLERLMLEAARAWPEGRFAVAG
                     PQYPEHLQWPRNVTRVEHLAPPEHPAFYNAQRFTLNVTRADMVRAGYSPSVRLFEAAA
                     CGVPIISDAWPGLETFFAPGRELFVSRSGEETLRYLQEVSAPERRAMGARARQRVLAE
                     HTAEHRARTLEAYVLDAARGG"
     misc_feature    complement(101903..102940)
                     /locus_tag="LILAB_00505"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4641"
                     /db_xref="CDD:226988"
     misc_feature    complement(101894..102877)
                     /locus_tag="LILAB_00505"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    complement(101912..102199)
                     /locus_tag="LILAB_00505"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_2; pfam13524"
                     /db_xref="CDD:257844"
     gene            complement(102946..104061)
                     /locus_tag="LILAB_00510"
                     /db_xref="GeneID:10874561"
     CDS             complement(102946..104061)
                     /locus_tag="LILAB_00510"
                     /note="COG4641 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663112.1"
                     /db_xref="GI:338529778"
                     /db_xref="GeneID:10874561"
                     /translation="MSRGLRIAFFGSSLVSAYWNGAATYYRGLIRALHARGHQVTFYE
                     PDAFERQQHRDMADPDWARVVVYTEQGTEAVERCLEEAGRADVVVKASGVGVFDALLE
                     ARVLDLKRPGVQVVFWDVDAPATLERLERQPDDPLRALVPRYDHVFTYGGGAPVVTAY
                     RALGARRCVPIYNALDPTTHHPAPAEARFRGDLAFLGNRLPDREARVEDFFLRAAALL
                     PASRFLLGGSGWEARPLPANVTNLGHVYTHEHNALNCSARAVLNIHRDSMARFGFSPA
                     TRVFEAAGAGACLITDAFEGVELFLEPGREVLVARSGEEVAEHVRRLTAPEARRIGQA
                     ALRRVLAGHTYLHRVSQVEAALGLRAAPATAARECVA"
     misc_feature    complement(102994..104046)
                     /locus_tag="LILAB_00510"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    complement(102994..104043)
                     /locus_tag="LILAB_00510"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4641"
                     /db_xref="CDD:226988"
     misc_feature    complement(103000..103284)
                     /locus_tag="LILAB_00510"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_2; pfam13524"
                     /db_xref="CDD:257844"
     gene            complement(104058..105197)
                     /locus_tag="LILAB_00515"
                     /db_xref="GeneID:10874562"
     CDS             complement(104058..105197)
                     /locus_tag="LILAB_00515"
                     /note="COG0438 Glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663113.1"
                     /db_xref="GI:338529779"
                     /db_xref="GeneID:10874562"
                     /translation="MRIVFFCHSLLSDWNHGNAHFLRGVVAELCARGHDVRVFEPADA
                     WSLRNLLAEPEGPAVLSEVASVYPHARPERYDLETLDLDRALEGARLVIVHEWSAPEL
                     VRRLGERRKGSEAFRLLFHDTHHRGVSAREEMARYELAHYDGVLAFGEVLRRLYLEQG
                     WARRAWTWHEAADTRVFGPRGDVVPEDDLVWIGNWGDEERTAELREFLLGPVRALGVK
                     ARVHGVRYPDAARAALARAGITYAGWLPNHRVPEAFARARVTLHVPRRPYATSLPGIP
                     TIRPFEALACGIPLVSAPWRDVEGLFTPGRDYLVADTGARMRDHLRALLADADLRRAL
                     AEQGRRTVLARHTCAHRVDELLRIHASLEPPATRAGASSRGRVTA"
     misc_feature    complement(104124..105194)
                     /locus_tag="LILAB_00515"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    complement(104094..105191)
                     /locus_tag="LILAB_00515"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4641"
                     /db_xref="CDD:226988"
     misc_feature    complement(104127..104423)
                     /locus_tag="LILAB_00515"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_2; pfam13524"
                     /db_xref="CDD:257844"
     gene            complement(105218..106315)
                     /locus_tag="LILAB_00520"
                     /db_xref="GeneID:10874563"
     CDS             complement(105218..106315)
                     /locus_tag="LILAB_00520"
                     /note="COG0438 Glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_004663114.1"
                     /db_xref="GI:338529780"
                     /db_xref="GeneID:10874563"
                     /translation="MTTDTVGGVWTYVLELCRALAEAEVQVELATLGAPVTPMQAEAA
                     RRVPGLRLHESTYRLEWMDSPWADVRASGEWLLALEDRLDPDVIHLNGYAHGALPWRA
                     PSVVVAHSCVLSWWESVLREPAPARYARYQREARRGLRAVDRVVAPSAAMLAAIERHY
                     GPLPTACVIPNARRAEDFAAAPKEPFVLAAGRLWDEAKNLAALEAVAPRLAYPVRVAG
                     ETRHPGGGKAAQARNTEPLGQLSPEALAAWMGRAAIYALPVRYEPFGLSALEAALAGC
                     ALVLGDLPSLREVWADTAVFVHPEDLEGLTAALRRLLEDAAHRKHMAARARARALTLN
                     PRRMAEDYLRLYATLWARRVQPLAGVALGAP"
     misc_feature    complement(105269..106300)
                     /locus_tag="LILAB_00520"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(105278..106300)
                     /locus_tag="LILAB_00520"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(106341..107438)
                     /locus_tag="LILAB_00525"
                     /db_xref="GeneID:10874564"
     CDS             complement(106341..107438)
                     /locus_tag="LILAB_00525"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-tyvelose-2-epimerase"
                     /protein_id="YP_004663115.1"
                     /db_xref="GI:338529781"
                     /db_xref="GeneID:10874564"
                     /translation="MSAAEPWTGEGGRTVIFGGAGFIGSNLADHYLSAGRTVRIVDNL
                     TRPGVVHNLRWLQARHGARLEVMTADVRDAQAVKQAVAGATQVFHFAAQVAVTTSLEV
                     PVTDFEVNAGGTLNVLEALRAMERPAPLVFTSTNKVYGGMPGVELVQGQRRYEPRDTR
                     LRSQGVDEACPLDFESPYGCSKGAADQYVLDYARAYGLRTVVFRMSCIYGPRQFGTED
                     QGWVAHFLLRTLEGQPLTLYGDGKQVRDILDVRDLVDALSLAQQHMGRLKGQAFNMGG
                     GPTRAVSLLELLGLISQRTGLRPAIHFEDWRTGDQRYYVSDTRKFQAATGWAPRVGVR
                     EGVDRLHDWLRTLVRERSATGLGAEREVHAG"
     misc_feature    complement(106407..107402)
                     /locus_tag="LILAB_00525"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(106401..107396)
                     /locus_tag="LILAB_00525"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(order(106815..106826,106893..106895,
                     106905..106907,107034..107042,107163..107171,
                     107307..107315,107370..107372,107376..107381,
                     107385..107387))
                     /locus_tag="LILAB_00525"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(106893..106895,106905..106907,
                     107034..107036,107109..107111))
                     /locus_tag="LILAB_00525"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(107435..108604)
                     /locus_tag="LILAB_00530"
                     /db_xref="GeneID:10874565"
     CDS             complement(107435..108604)
                     /locus_tag="LILAB_00530"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="NDP-sugar oxidoreductase UDP-glucose
                     4-epimerase"
                     /protein_id="YP_004663116.1"
                     /db_xref="GI:338529782"
                     /db_xref="GeneID:10874565"
                     /translation="MEVVTPIHCLREPGGHMKQRQILITGGAGFIGSHLADALLARGH
                     RVRALDALVPQVHGEARQRPEYLSPDVELVVGDVCDGDKVRQALDGVDAVFHFAAAVG
                     VGQSMYEVAHYTAVNNLGTSVLMEALIEHPVERLVVASSMSVYGEGLSRAPDGRRVPG
                     GQRPLEQLSAGKWELEGPAGEPLTPVATPESKPPELSSVYALSKFDQERLCLILGRAY
                     DIPTVALRFFNVYGPRQALSNPYTGVLAIFGARLLNGSPPLVFEDGLQQRDFVNVRDV
                     ARACALALDAEGAVSRVINVGSGRAITVREVARALAEVMGRPGLRPAVTGRYRMGDIR
                     HCFADISLARDLLGYAPEVTFHDGLTELSSWLEDQVATDRVAEARAELDARGLTV"
     misc_feature    complement(107507..108541)
                     /locus_tag="LILAB_00530"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(107510..108541)
                     /locus_tag="LILAB_00530"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(107915..107926,107993..107995,
                     108005..108007,108182..108190,108308..108316,
                     108449..108457,108512..108514,108518..108523,
                     108527..108529))
                     /locus_tag="LILAB_00530"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(107993..107995,108005..108007,
                     108182..108184,108254..108256))
                     /locus_tag="LILAB_00530"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(108761..110560)
                     /locus_tag="LILAB_00535"
                     /db_xref="GeneID:10874566"
     CDS             complement(108761..110560)
                     /locus_tag="LILAB_00535"
                     /note="COG1132 ABC-type multidrug transport system, ATPase
                     and permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004663117.1"
                     /db_xref="GI:338529783"
                     /db_xref="GeneID:10874566"
                     /translation="MQTPPVSRGSMWRALGYLRPYRRTIAFILLLVLTSASLSALEPL
                     VLKGIFDQLGSEDATKPVLLGVGLLVLMGLLREALGAASNWLTWRTRIQVHFALNEAT
                     VSRLHRLPLSFHRQEGVGALMTRMDRGLQGFVGAITELTFNVIPAAVYLCIAVAVMLR
                     LDWRLALLALAFAPLPVLIARRAAPVQARREETLLERWTQIYARFNEVLSGILTVKSF
                     AMEDREKQRFLHGVRDANAVVTRGVAFDSAVTAGQNTTVLVARVASICMGGLLVMKGQ
                     LTVGTLVAFLGYIGGLFGPVQGLSGVYKTLRTASVAIRQVFSILDAQDSLGDAPDAHE
                     VTHMRGDVTFEDVHFAYPSGAGRPLINGISLNVRRGETVALVGPSGAGKTTLMSLLCR
                     FYDPDQGVVRVDGRDIRTLKQLSLRRNIGVVLQDALLFNESVKGNIAYGRPHATDAEI
                     EAAARAAHAHEFILGLPQGYDTLVGERGSRLSAGERQRIAIARSLLTDPPILILDEPT
                     SALDAESEALVQDALGELMKGRTTFAIAHRLSTVVSADRILVLKDGRLIEEGTHAELL
                     RRDGYYASLVRKQTRGLLPELPAPPLPATPVAA"
     misc_feature    complement(108821..110539)
                     /locus_tag="LILAB_00535"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    complement(109673..>110317)
                     /locus_tag="LILAB_00535"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(108836..109537)
                     /locus_tag="LILAB_00535"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(109409..109432)
                     /locus_tag="LILAB_00535"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(108950..108952,109043..109048,
                     109286..109288,109406..109414,109418..109423))
                     /locus_tag="LILAB_00535"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109286..109297)
                     /locus_tag="LILAB_00535"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109091..109120)
                     /locus_tag="LILAB_00535"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109043..109060)
                     /locus_tag="LILAB_00535"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109025..109036)
                     /locus_tag="LILAB_00535"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(108944..108964)
                     /locus_tag="LILAB_00535"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(110655..111638)
                     /locus_tag="LILAB_00540"
                     /db_xref="GeneID:10874567"
     CDS             complement(110655..111638)
                     /locus_tag="LILAB_00540"
                     /note="COG0673 Predicted dehydrogenases and related
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_004663118.1"
                     /db_xref="GI:338529784"
                     /db_xref="GeneID:10874567"
                     /translation="MRRPRLGFLGVGWIGRHRMEALVREAPVEVVGVADPSEAAAEAA
                     RALAPGCERVDSLDALLALGLDGVVIATPSAVHAEQSIQALERGVAVFCQKPLGRTAR
                     EVARVVDAARKADVLLGVDFSYRYAQGLRALRAHHQSGALGQVHAVNLVFHNAYGPDK
                     PWFYDPALAGGGCVMDLGIHLVDLALWVLDFPAVRRVSSQRFAQGRPLRGREEAVEDY
                     AAALLELEGGAAVQLACSWKLSAGCDAVIEASFYGTGGGVSFRNVNGSFYDFTTDAFR
                     GTERVRLAGPPDGWGGRAAVDWAHRLARGERFTPDNTRLIQVADTLDRLYA"
     misc_feature    complement(110658..111638)
                     /locus_tag="LILAB_00540"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(111273..111626)
                     /locus_tag="LILAB_00540"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    complement(110895..111224)
                     /locus_tag="LILAB_00540"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            complement(111650..112618)
                     /locus_tag="LILAB_00545"
                     /db_xref="GeneID:10874568"
     CDS             complement(111650..112618)
                     /locus_tag="LILAB_00545"
                     /note="COG1063 Threonine dehydrogenase and related
                     Zn-dependent dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydrogenase"
                     /protein_id="YP_004663119.1"
                     /db_xref="GI:338529785"
                     /db_xref="GeneID:10874568"
                     /translation="MSDGMMRAAVVTGPGGTRVDRVARPEPGPGAVRVRMEGCGVCGS
                     NLPTWEGRDWFRYPLKPGTPGHEGWGVVDAVGSGVTELRVGDRVATLSSAAFAEYDVV
                     DAASAVVLPPALAGKPFPGEPLGCGVNIFRRADLQAGQTVAIIGIGFLGAVVTRLAAN
                     AGARVLAISRRPFALELARAHGATECIPLDDHGRVIERVKALTGGALCDRVIEAVGAQ
                     WPLDLAGELTRERGRLVIAGYHQDGPRQVDMQLWNWRGLDVINAHERDPRVYVEGIRL
                     AVEAVASGALDPYPLFTHHFRLEELGRAFEALRSRPDGFLKALVTP"
     misc_feature    complement(111653..112603)
                     /locus_tag="LILAB_00545"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(111656..112588)
                     /locus_tag="LILAB_00545"
                     /note="Alcohol dehydrogenases of the MDR family; Region:
                     Zn_ADH9; cd08269"
                     /db_xref="CDD:176230"
     misc_feature    complement(order(111827..111835,111905..111910,
                     111968..111970,111974..111979,112016..112018,
                     112097..112099,112109..112114,112166..112183,
                     112241..112243,112253..112255,112478..112480,
                     112487..112495))
                     /locus_tag="LILAB_00545"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176230"
     misc_feature    complement(order(112253..112255,112418..112423,
                     112493..112495))
                     /locus_tag="LILAB_00545"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176230"
     gene            112940..113473
                     /locus_tag="LILAB_00550"
                     /db_xref="GeneID:10874569"
     CDS             112940..113473
                     /locus_tag="LILAB_00550"
                     /note="COG2453 Predicted protein-tyrosine phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663120.1"
                     /db_xref="GI:338529786"
                     /db_xref="GeneID:10874569"
                     /translation="MTQTWELNLDAMTPSLAVGGRYPMEAAAYLAGQLGIRSVVDVRV
                     EHCDDEQVLRQHGITLLHLPTQDMCAIRLPMIHDGVAWVRARLAQREKVLIHCEHGIG
                     RSALLALCVLVEEGLSPLEALSLAKDRRGRVSPSPEQLSAFIAYTQALRASREVPWDV
                     PDFDALAAIAYRHLRQD"
     misc_feature    112973..113368
                     /locus_tag="LILAB_00550"
                     /note="Dual specificity phosphatases (DSP); Ser/Thr and
                     Tyr protein phosphatases. Structurally similar to
                     tyrosine-specific phosphatases but with a shallower active
                     site cleft and a distinctive active site signature motif,
                     HCxxGxxR. Characterized as VHR- or...; Region: DSPc;
                     cl00053"
                     /db_xref="CDD:260159"
     misc_feature    order(113123..113125,113225..113230,113237..113239,
                     113246..113251)
                     /locus_tag="LILAB_00550"
                     /note="active site"
                     /db_xref="CDD:238073"
     misc_feature    order(113123..113125,113228..113230)
                     /locus_tag="LILAB_00550"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238073"
     gene            complement(113521..114408)
                     /locus_tag="LILAB_00555"
                     /db_xref="GeneID:10874570"
     CDS             complement(113521..114408)
                     /locus_tag="LILAB_00555"
                     /note="COG3664 Beta-xylosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663121.1"
                     /db_xref="GI:338529787"
                     /db_xref="GeneID:10874570"
                     /translation="MIEAVKLWNEPNNLSHWDFGLDADWSIFSRMVRLAGAAVRSENA
                     RLPRVLGGMAPIDVSFLRRMEAQGALDEVDVVAVHGFPLDWNHWQLDEWPQRLEEIRA
                     VSRHRVWVTEVGVSTFGAEEVQEFGLRRTAELLLGRVERVHWYSLYDLPKAWPATTRH
                     REAEGSSYYRHFYMGLLREDGSPKRAMRHFADYTPQLGICQWFHFEDHRLEDAVAWLR
                     KMGVRKLRTGLSWADSHRPGAEAWFDQQMRALDGFDVTLTYCFTPGSCGLTDHHTSPP
                     RQVEEFADFCARMTRRYAR"
     misc_feature    complement(113527..114408)
                     /locus_tag="LILAB_00555"
                     /note="Beta-xylosidase [Carbohydrate transport and
                     metabolism]; Region: XynB; COG3664"
                     /db_xref="CDD:226190"
     gene            complement(114405..115127)
                     /locus_tag="LILAB_00560"
                     /db_xref="GeneID:10874571"
     CDS             complement(114405..115127)
                     /locus_tag="LILAB_00560"
                     /note="COG0500 SAM-dependent methyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663122.1"
                     /db_xref="GI:338529788"
                     /db_xref="GeneID:10874571"
                     /translation="MTAEQLQQQVHSLGEWFHNLDLHGVQTAPRHPLGDFPAVFWRTF
                     QRAFPTDLRGRSVLDIGCNGGFYSIEMKRRGAARVVGIDSDARYLAQARLATQVLGVD
                     VELHQLDVYDAGALGERFDVVLFMGVLYHLRHPLLALDLLHEHVVKDLLIFQTMERGG
                     TQAGPVAEDYAITERSAFERPDFPKLHFIERRYAGDPTNWWVPNAACTEAMLRSAGFS
                     VLDRPAREIYLCQRSTRPEVLQ"
     misc_feature    complement(<114711..114959)
                     /locus_tag="LILAB_00560"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(114750..114752,114798..114806,
                     114876..114881,114930..114950))
                     /locus_tag="LILAB_00560"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(115487..116413)
                     /locus_tag="LILAB_00565"
                     /db_xref="GeneID:10874572"
     CDS             complement(115487..116413)
                     /locus_tag="LILAB_00565"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663123.1"
                     /db_xref="GI:338529789"
                     /db_xref="GeneID:10874572"
                     /translation="MPRQSTMGAGAQQQPLRQLFQSDGFDGPSGAAKGQGAEALVQNL
                     SRLAQMLTEASRLLGAEGAQGGLAPASGLKSAGATPASRGGDHFAPAPAAPAVPAAAP
                     SAPTAPSAPSGTQAKAVAGPTGAPGVSKDGNTITFTNDGTSPMTIKFTPNAGEKELDA
                     ITVPPGKTQTVQFPENWSGNFRSASGDGSAATLGEVKFDGGFGKTYYDVSYIEGHNAS
                     MTMQPEEGGRVSGTHDDLLSAAPDAIKARNADGSVYGIKKSTTSNVQDGGVVDFYRKH
                     VGADEGYVIPTDDASTLGTSDTNLVVRMKNLA"
     misc_feature    complement(<115643..116014)
                     /locus_tag="LILAB_00565"
                     /note="glycoside hydrolase family 64 (beta-1,3-glucanases
                     which produce specific pentasaccharide oligomers) and
                     thaumatin-like proteins; Region: GH64-TLP-SF; cl02511"
                     /db_xref="CDD:261317"
     gene            complement(116707..117339)
                     /locus_tag="LILAB_00570"
                     /db_xref="GeneID:10874573"
     CDS             complement(116707..117339)
                     /locus_tag="LILAB_00570"
                     /note="COG1670 Acetyltransferases, including N-acetylases
                     of ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_004663124.1"
                     /db_xref="GI:338529790"
                     /db_xref="GeneID:10874573"
                     /translation="MTSTSSGPAYTIQTARTLLRCWSPADAARALRAIHASLEHLRPW
                     LDWAREAYPMSVSQQAAVLRRFRGRFDLGEDFTYAVFDRGGTEVLGGCGLHPRVGEGG
                     REIGYWIASEHIGQGLATEVAAALTRVAFELEGLRRVEIHCDPLNVRSVAVPRKLGFT
                     HEGTLRQRLRSPDGGWRDTMLWTLLAEDHAARPAAASNLEAFDVLGQRLL"
     misc_feature    complement(116764..117309)
                     /locus_tag="LILAB_00570"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    complement(116860..117081)
                     /locus_tag="LILAB_00570"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     gene            complement(117519..120122)
                     /locus_tag="LILAB_00575"
                     /db_xref="GeneID:10874574"
     CDS             complement(117519..120122)
                     /locus_tag="LILAB_00575"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663125.1"
                     /db_xref="GI:338529791"
                     /db_xref="GeneID:10874574"
                     /translation="MRLVHSQNVWHLAGVLWLLVAAGCHLEDSPPIQLEPSASARVMV
                     VLPRTLPAEPGMQVRVTLTPTAGDAVGGALTGGGGLWQGVMRGITSGEGAAVSATVQD
                     ERGALLARIDVPEVSLAAHRTALLVLVPRVTGEAPEARGAPFIDAVLGSVVEVRPTGQ
                     VPLRAVAEAASGGGALTYAWRASDGRFDDAHAAAPVWTAPETPGLVSLSLEVTSAEGQ
                     VATLEFPMRVSRDQGFGADGAGDFNRWPRVMAPGSQPAGEVPHGDTLQLQAEAWDEDG
                     DALTYAWTANCAGTFDDASLPSPRFTPSTPPEGACGACQFVVAVRDGRGGERVGSVDV
                     CVVQRLPPIIVSTAQSRTEALGAEPVLLQAVAEDPRGEALTFQWTANTGLLEPAVRDG
                     TRGEVRWSALSCVPADVEPTVRLTVTNASGLSATHVYRIRWDDRRCGAFPPCSVQWED
                     GRLVLTADCTTEGTLYIPDGVTFDGAGHVVTAVDPEGGRFQGAVLRNRGGTAHVRDVT
                     VEARGLSEQACDAGEAGLAGIRFIGASGSIQDSEVRALHQGAGRGACQEGVAIEVRHA
                     LDASGSVTVEMLRNHVTGYQKAGIVASGRVVVAVEDNVVEGGGPSDLIARNGIQVSFG
                     ATGRVVGNRITGHIYSRPAYVAAGILVAGGGYYDAPVCEGLLIQGNTLEANDVGIDLS
                     QAEADGGPLARSSNLVVVENTLSHDRVENGFPYQAAIADLGGGNVISRNRISGAGYAR
                     DTLPGATFDVDVVADEAAQVAFLTPSQDVAAGTCSGALVVQSQDAMGNLSALASSELV
                     VEADGTGAVSFFRDSACTQVLLPLNGSGAMALEGPQQEAVFYFLAATAGALEVTVRGD
                     GVSASQTHVVR"
     misc_feature    complement(117906..118424)
                     /locus_tag="LILAB_00575"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     gene            120574..122010
                     /locus_tag="LILAB_00580"
                     /db_xref="GeneID:10874575"
     CDS             120574..122010
                     /locus_tag="LILAB_00580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663126.1"
                     /db_xref="GI:338529792"
                     /db_xref="GeneID:10874575"
                     /translation="MGTLALPIVGCLGEEPTHEEALGGTGGAGHAAALSTASSQEGLQ
                     EPTCGYIPCPVIENGNVLTLAGNCATYSTLRIPDGYVLDGAGHFVIALDPPGDHFKGP
                     IARNCGSSAFYMNLRLMLMGLSDVCDTGDDALAGIRFDDATGSVINTQVFNIRQGDGT
                     GGCQEGTGILIRNQDPSSPTRFVGVYGNVLLGYQKAGVVATGNVVVDITNNRLVGSGP
                     IGNVAQSGIQVGLGATGSIVNNLISGHSFTGEGVASGILVYGGPLYGGPLSSDVLIQG
                     NHLFNNDIGVYLSQGNEDQSPPAVLTNNQVVDNVLHSDGVTNGYVYQAGISDLGTGNV
                     IHSNVITGAGYDPATLPGSTFAVDVLAGPVASLAFLNPPRQAFQGLCSGPLIVQTQDA
                     NGNLAVPTTTGFNITAAGPASPGIQFHTDPACAGPAVTTLDLANPQAQGRFYFRATTP
                     GSVTVFVWNDALSQAQPQLVLPGLAPLP"
     misc_feature    121159..121599
                     /locus_tag="LILAB_00580"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     STS             122346..123422
                     /standard_name="D1S3688"
                     /db_xref="UniSTS:474266"
     gene            122493..124373
                     /locus_tag="LILAB_00585"
                     /db_xref="GeneID:10874576"
     CDS             122493..124373
                     /locus_tag="LILAB_00585"
                     /note="COG3325 Chitinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chitinase"
                     /protein_id="YP_004663127.1"
                     /db_xref="GI:338529793"
                     /db_xref="GeneID:10874576"
                     /translation="MVLATGGSAAWAAQAEARPPAAAVDTAEGAAPEFVPTTTSWIYR
                     EAMEAPWQDYSWAPHSLTNTSPVAAGRHSISVTMRAWEALYFNTSPLTVAPGMTLTLS
                     VHGGASGNNAVVQTRAVVNGAFTPGTELGPYCTGGRIRANTWSTCTIPISVLAPQGAR
                     FTGLALQEGRGLSLPTLYFDELGVRGIPAPAPQVEVAINPTSATVPAGGTQAFTATVT
                     GSANTAVTWSVQEGASGGSVTAAGLYTAPSSAGTYHVVATSQAAPTKSAVATVTVTST
                     PPPPGGKWVSGYYTGWNADLYPPEKVDFTALTHILVGRVTPNPDGTVNTQFDNSNGPA
                     IARTLSTRAHAAGRKAIIMVGGAGEHDGWVGAASSANRARFVQNLVNAMETFGYDGLD
                     IDWEPVEQADKPALLALIQELRAARPQMLLTMPIGWVNSNFPEDADPWFTHLVPYLDQ
                     MNVMSYEMTGPWGGWLSWYTSALRGESGYHPTSVSSSLNAWVGAGIPRSKLGMGIPFY
                     GMAWRNITGPYQPYTDWSDYVGSDNSFTYEKILELSATGVYRWDEAAQASYVTFDVPV
                     EDGTVRWISYDSPQAIAAKGAFAHDNGFGGTIIWTINQGCTDPATGANPLLDAVKDAF
                     LE"
     misc_feature    123066..123299
                     /locus_tag="LILAB_00585"
                     /note="Bacterial Ig-like domain 2; Region: BID_2;
                     smart00635"
                     /db_xref="CDD:214752"
     misc_feature    123345..124304
                     /locus_tag="LILAB_00585"
                     /note="The GH18 (glycosyl hydrolase, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
                     major component of the cell wall of fungi and the
                     exoskeleton of arthropods.  Chitinases have...; Region:
                     GH18_chitinase-like; cl10447"
                     /db_xref="CDD:263970"
     misc_feature    123345..124304
                     /locus_tag="LILAB_00585"
                     /note="Glyco_18 domain; Region: Glyco_18; smart00636"
                     /db_xref="CDD:214753"
     misc_feature    order(123351..123353,123432..123434,123666..123668,
                     123672..123674,123678..123680,123858..123863,
                     124014..124016,124290..124292)
                     /locus_tag="LILAB_00585"
                     /note="active site"
                     /db_xref="CDD:119349"
     gene            124806..126683
                     /locus_tag="LILAB_00590"
                     /db_xref="GeneID:10874577"
     CDS             124806..126683
                     /locus_tag="LILAB_00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663128.1"
                     /db_xref="GI:338529794"
                     /db_xref="GeneID:10874577"
                     /translation="MASQAEPLEADLPRVPTEQDVAWELDMYPTVGVSALPTLNLVKF
                     WTYERFLINGDKGIWTRPELERNLLAKAEVDECFSSMGGPISQPPCDPGTTPKRNQAY
                     VWGLALADRSLWFGTVANTLCLVEQGFLGATTPQENPYWVCEFGQSQSGTGDFRPPDL
                     QRYQLNTGVLSSLNGSLPGWAELLRRTTVGLRSAGAQDGVVFLAGPSLIAGINLFAFH
                     SETGAFLGATNLPQYNNIREWVNVRGALYTGVAYSQVVGNAPGGAVLRWRGQRSTNPA
                     VLFNFEVVGQTDAEVANLVEHAGRIYVTTWPTFLSGGAPSPLTARFMGVWRSPRLEQD
                     GLDDDDASQWRKVWDIRDYEPDLVAAATTGGGAVASFDGRLYWGTMHVPFLATSVALG
                     AHAAGLLNLDADGSGSLDWLELLNTALGTHRSTSVFQSDELGNQDESVRVIYGEKYLP
                     RYSPLARGYDIAFNDFYRNRLENPEPRWGSSGLGNFFNAYTWALEVYGNDLYLGTFDW
                     SQVARVGLQEAIGGVTLPPMAPPAIASSLHSVEDARRAHHHFLRVLNIAIPKEGADLF
                     RFEGRNKSAVAESLRGLGNDTNYGVRTLVSGRKALYVGTANPMNLHPDGGWELLQLKK
                     D"
     gene            126838..127332
                     /locus_tag="LILAB_00595"
                     /db_xref="GeneID:10874578"
     CDS             126838..127332
                     /locus_tag="LILAB_00595"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663129.1"
                     /db_xref="GI:338529795"
                     /db_xref="GeneID:10874578"
                     /translation="MTLPSKLSIAALSLSFLSPVSALAVEKTVTSQYVDTSAYLTSEA
                     DIEAWYQLTRSLNQNFDAICGDTFCEGEYSNIESLRFRCSVNDQTGQLGQCVWVFAAS
                     NEEVDPATGAVTVDAQTWSCQVPLAPSTTIQQLLTALAGTSPLYATLPNTQTTIYEGL
                     GDCL"
     gene            complement(127393..127914)
                     /locus_tag="LILAB_00600"
                     /db_xref="GeneID:10874579"
     CDS             complement(127393..127914)
                     /locus_tag="LILAB_00600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663130.1"
                     /db_xref="GI:338529796"
                     /db_xref="GeneID:10874579"
                     /translation="MAEAVERLKSLAEEVEDLTVEFSKPVTAAEVAKLEKKFKLKLPP
                     SYVHFIRTYGTFKVLHGGRELIGMEEPGFLRAAAPDASDAVNGDDPDVEEAINEALFF
                     QRADDDAVDNFWCFNPRDVTPEGEMGVVGYYHDETFELPQLLGTKNARHFRAFPAHIV
                     EIIDELIENFAEA"
     misc_feature    complement(127498..127788)
                     /locus_tag="LILAB_00600"
                     /note="SMI1 / KNR4 family; Region: SMI1_KNR4; smart00860"
                     /db_xref="CDD:214864"
     gene            complement(127983..128114)
                     /locus_tag="LILAB_00605"
                     /db_xref="GeneID:10874580"
     CDS             complement(127983..128114)
                     /locus_tag="LILAB_00605"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663131.1"
                     /db_xref="GI:338529797"
                     /db_xref="GeneID:10874580"
                     /translation="MVTGNLVLDEQSRLLRADVVNGDGGWSYKDVAKYLLRRQSLLR"
     gene            complement(128203..129624)
                     /locus_tag="LILAB_00610"
                     /db_xref="GeneID:10874581"
     CDS             complement(128203..129624)
                     /locus_tag="LILAB_00610"
                     /note="COG0612 Predicted Zn-dependent peptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="M16 family peptidase"
                     /protein_id="YP_004663132.1"
                     /db_xref="GI:338529798"
                     /db_xref="GeneID:10874581"
                     /translation="MTTHSIRTRLVAPALMVLGMLSAPALAAAPAPARTREAPPAPQA
                     PKPFKVPVRTEFKLDNGLEVSLLPYGDMPKVAIQLAIDTGNIHEKATETWLADLTGRL
                     LSEGTTTRSAEQLAQAAAQLGGSLNIGTTMDQTYVGLEVLSESAPDAVALIADVIQNP
                     AFPPAEVERVKGDLVREMAIYKSQPGTLADERLLQALYGDHPYGRYFPPEAQLKGYTA
                     QAVRAHYDANIGAARSRLYVVGRFEPAAVEKAIRGAFTGWKAGPARLQNLPKQQVAKA
                     VQFIDRPGSVQSTVRVAVKALPPSSPDFVKQTVLNTLLGGYFSSRITANIREAKGYTY
                     SPHSTVSAHLGDAYWVQNADVTTAVTGESLKEIFKEVATLRKTPPPAEELSAVQSYLA
                     GTFLLQNSSRSGIIGQLRFVDLHGLPDSYLQNYVQSVMAVTPEQVQQLAAKMLTREAM
                     TVIVVGDQKAVAPQLKVVSPALK"
     misc_feature    complement(128236..129465)
                     /locus_tag="LILAB_00610"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    complement(129010..129408)
                     /locus_tag="LILAB_00610"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    complement(128452..128976)
                     /locus_tag="LILAB_00610"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(129637..130986)
                     /locus_tag="LILAB_00615"
                     /db_xref="GeneID:10874582"
     CDS             complement(129637..130986)
                     /locus_tag="LILAB_00615"
                     /note="COG0612 Predicted Zn-dependent peptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="M16 family peptidase"
                     /protein_id="YP_004663133.1"
                     /db_xref="GI:338529799"
                     /db_xref="GeneID:10874582"
                     /translation="MEAAKVEAPAEPPSKLQVPVDYYKLDNGLKVVLSRDSSAPKAVV
                     AVYYNIGFRIEPKDRTGFAHLFEHMMFQGSTNLGKMEFIRLIQKNGGVLNGSTRFDFT
                     NYFEVVPSNTLETILWAEADRMRGLDVTEENLKNQQGVVTNEVKVNVLNQPYGGFPWL
                     DMPQVANSNWYNAHNFYGDLKDLEAASLADVRAFFKTYYAPSNAALVVVGDFEPEQVK
                     GWIQQYFGPLPTVAQPSKPDISEPRQTKEKRHDKVDKLAQRPALAVGYHMPDVGTPEY
                     YAMALVDEVLLNGNDSALYQQLVQKKGLTGEVSGGVNQLGNHWNYNGPMQWTAYLFHD
                     ADTTTETILTEFDGVVARLQEQPIDEATLERARVKARSRLYGQLEGFLGFGRADLLAS
                     FALFFDDPARINRLEAELMKVTPELIQKTAKEYLRRENRTVLTVTPAAATATQTKAP"
     misc_feature    complement(129688..130950)
                     /locus_tag="LILAB_00615"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    complement(<130546..130899)
                     /locus_tag="LILAB_00615"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    complement(129886..130428)
                     /locus_tag="LILAB_00615"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            131569..131784
                     /locus_tag="LILAB_00620"
                     /db_xref="GeneID:10874583"
     CDS             131569..131784
                     /locus_tag="LILAB_00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663134.1"
                     /db_xref="GI:338529800"
                     /db_xref="GeneID:10874583"
                     /translation="MRHLEPLLGGFTAKMAIQTAALRTLKRPPEQLKREDLPQLLEGL
                     KPMLNTFIGALHAKVVLAEISASLEKL"
     gene            131784..132677
                     /locus_tag="LILAB_00625"
                     /db_xref="GeneID:10874584"
     CDS             131784..132677
                     /locus_tag="LILAB_00625"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663135.1"
                     /db_xref="GI:338529801"
                     /db_xref="GeneID:10874584"
                     /translation="MSTHSTGRAAGSIVPWFGAVLVLQLAHAFAAASALDAPHSLQLV
                     HDVAGWGSGVLAVAGTFAAARSFAQGDYLRKVWGGLAAGAFLSLVSTALRSYWLHAVP
                     DVPFTQSPLLPLRMGVVVLANVCTTYALILLAMTYRQSGLQPPSSFRSNALWAGTAIA
                     ALAVGLPVLATEVRHLGADSAATMSAVISLASTLADMTTILLVAPILSVAYMLRGGRL
                     AWVWWAMGVSGAMWLFYDARVWLAPLLPGDAAQSAELLRTLRTSGLVLLGLAGWLQRT
                     ALAPRQAPAAGPEVQTHAGMS"
     gene            complement(132713..135127)
                     /locus_tag="LILAB_00630"
                     /db_xref="GeneID:10874585"
     CDS             complement(132713..135127)
                     /locus_tag="LILAB_00630"
                     /note="COG0417 DNA polymerase elongation subunit (family
                     B)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA polymerase II"
                     /protein_id="YP_004663136.1"
                     /db_xref="GI:338529802"
                     /db_xref="GeneID:10874585"
                     /translation="MEDEWLWGWDPTPGIVSVWAEPDGRAFVWRRVPRTGALVREDVR
                     FRPWLLLSSLEDLAHLGPRLRPESEGPARHRVTWQELEGPGALRYLVRAEDGRALTSA
                     VLEGASRRLGRPVAHLRDLGANAALALPPEEQYLTASGRTYFRDLDFDELRRMQFDLE
                     TTGLDPAHHRVFLVALRRPDGETETLEAQGEDDSAEADLLYHLAERVRTYDPDVIENH
                     NLHGFDLPFLARRARHLGVSLALGRAGAPGLRHRPSARGAALGRPVPGAPPDAMRRAR
                     YTVPGRELIDTLDAVLRHDFSTRDLPGHGLKAVARHLGLAGPEREHIPGARVYEVFRT
                     DPARVRRYARDDVTEAGGLARLLGGAAFALARMAPRRYERLADAGPATGVLDPLLVRA
                     YLREGAALPAHEDGDGTSHSGAALHLFATGVARRIVKADVASLYPSLMRQYRIGPRRD
                     RLGVLLALVDRLVDQRLAAKGRARAAAPGSQERFTNEALSAAMKIVVNSAYGYLGAVG
                     LTRFSDVHAANEVTRQGRQVLGLLCRELARRGVTLLEADTDGVYFAVPEAWREADERR
                     VVAEVAALLPPRVQLEFDGRYAAMLSHEPKNYALQPYDGPLVLRGVAFRSSRAEPFGE
                     AFLRRALRCLLAGDVPGVREVYVETVMALRRRKLPTLEVCAHVRLTKSAAQYLAIRPR
                     RRELPYEAMLASGRAEWPLGEQVRIYRAVGGRAGLLPVPEADDPGAARPLTREEDPRD
                     YDVEYYVRLLRETFAARLVRALEPEDFRTVFDDPGQPSLFAPSLAEARPILTVLAEPP
                     DAPEPV"
     misc_feature    complement(134063..134698)
                     /locus_tag="LILAB_00630"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:263941"
     misc_feature    complement(132785..134683)
                     /locus_tag="LILAB_00630"
                     /note="DNA polymerase elongation subunit (family B) [DNA
                     replication, recombination, and repair]; Region: PolB;
                     COG0417"
                     /db_xref="CDD:223494"
     misc_feature    complement(order(134090..134092,134456..134464,
                     134471..134476,134645..134656))
                     /locus_tag="LILAB_00630"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(134090..134092,134456..134458,
                     134648..134650,134654..134656))
                     /locus_tag="LILAB_00630"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(134090..134092,134459..134464,
                     134471..134476,134645..134653))
                     /locus_tag="LILAB_00630"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    complement(132848..133903)
                     /locus_tag="LILAB_00630"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both...; Region: POLBc; cl10023"
                     /db_xref="CDD:245235"
     misc_feature    complement(order(133481..133483,133634..133636,
                     133646..133648,133727..133729,133820..133828,
                     133835..133837))
                     /locus_tag="LILAB_00630"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(133478..133483,133487..133489))
                     /locus_tag="LILAB_00630"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            135266..135910
                     /locus_tag="LILAB_00635"
                     /db_xref="GeneID:10874586"
     CDS             135266..135910
                     /locus_tag="LILAB_00635"
                     /note="COG2378 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663137.1"
                     /db_xref="GI:338529803"
                     /db_xref="GeneID:10874586"
                     /translation="MQRTERLFALAEYLRGRRTGVTAEVLAERFGVTVRTIYRDLDSL
                     RASSMPVSAERGRGGGYALDRSYSLPPVNFTAREAALIVALGRFAIDMRLLPFAGTLE
                     SALDKVRAALSTSAQRELLTRLRELSFIGVPSLPSRKGVREALERAWFEQQPLRITYV
                     DSNYLETVRDVRVMSVIMNRHETRIDGEDLSTGERRPFRLDRITRAEVLRAAGP"
     misc_feature    135287..135439
                     /locus_tag="LILAB_00635"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    135692..>135892
                     /locus_tag="LILAB_00635"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(136039..136221)
                     /locus_tag="LILAB_00640"
                     /db_xref="GeneID:10874587"
     CDS             complement(136039..136221)
                     /locus_tag="LILAB_00640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663138.1"
                     /db_xref="GI:338529804"
                     /db_xref="GeneID:10874587"
                     /translation="MQGRSTKRQKEQARKQHQQEKNAKREERKKVKSERGPRQPGEVD
                     PDIADIIPGPQPPLEI"
     gene            complement(136297..136503)
                     /locus_tag="LILAB_00645"
                     /db_xref="GeneID:10874588"
     CDS             complement(136297..136503)
                     /locus_tag="LILAB_00645"
                     /note="COG1278 Cold shock proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein CspA"
                     /protein_id="YP_004663139.1"
                     /db_xref="GI:338529805"
                     /db_xref="GeneID:10874588"
                     /translation="MATGTVKWFNDAKGFGFIAQDDGGADVFCHHTAIQSDGFRTLAE
                     GQKVEFETRKGPKGLQAENVRVVG"
     misc_feature    complement(136306..136497)
                     /locus_tag="LILAB_00645"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(136333..136335,136420..136422,
                     136453..136455,136480..136482))
                     /locus_tag="LILAB_00645"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(136414..136425,136444..136464))
                     /locus_tag="LILAB_00645"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            complement(136838..137482)
                     /locus_tag="LILAB_00650"
                     /db_xref="GeneID:10874589"
     CDS             complement(136838..137482)
                     /locus_tag="LILAB_00650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663140.1"
                     /db_xref="GI:338529806"
                     /db_xref="GeneID:10874589"
                     /translation="MSGQSLTGKMLEGARKWAKRLPNALSDDMAVDVSRGRVRLSHSR
                     VEAVARQLLTRLKHFELREWSAREDVYDVRFSVRGWRLRVETTPERVELAAGRYRLWL
                     RTPGVVALEESQTASSLVMGVLRAGAGRAAMRALAERMLPPGIRWDGQVLQVEGPLPE
                     EGVLPARLFDTAALAMTAEHQAEGLWLSAEAWPGLMDLLQVVFGTELPRTPPGV"
     gene            complement(137628..138998)
                     /locus_tag="LILAB_00655"
                     /db_xref="GeneID:10874590"
     CDS             complement(137628..138998)
                     /locus_tag="LILAB_00655"
                     /note="COG0312 Predicted Zn-dependent proteases and their
                     inactivated homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="YP_004663141.1"
                     /db_xref="GI:338529807"
                     /db_xref="GeneID:10874590"
                     /translation="MQGGSEEDSGVASCAGLELRALLTSATEALASFSRRHAPSHAEL
                     FLAAERKLSLEYDAGTGRSTLNQGESLDATARVAWDARQGLWTAPVGDASALPLLLER
                     AEQVAAPGRAGPLPGLPAMSPAAPASPPALQPDRAARWMKRFIQTAVPPGSVVQAAVL
                     SQSAAWRALVREHGAPRVRTEWREALFVRCETPRGALVDAVALPPDANEDAFAPLRQR
                     LADAVDALTGPAHRVDRSLPLVLRPAVAAPLAAGLLWLLRGDVAAATPALARAVGRKL
                     FPSALSVVDDPHHPAGTRRVPLDDEGLPTEALTLVDAGVLRAFLHAADTATRLGAPPN
                     GRGFRPALAPPAPEAVNPWVVPGAAPALPAHYTELVARVETFTTMPRPGTVTVVAGGW
                     EVRDGHRVRRVAPVELELPVLETFRALRGVGNDLTFFPTAEGCGTPTLVFPPLLADAP
                     GGHAAR"
     misc_feature    complement(138042..138881)
                     /locus_tag="LILAB_00655"
                     /note="Putative modulator of DNA gyrase; Region:
                     PmbA_TldD; pfam01523"
                     /db_xref="CDD:250684"
     misc_feature    complement(137673..>138272)
                     /locus_tag="LILAB_00655"
                     /note="Putative modulator of DNA gyrase; Region:
                     PmbA_TldD; cl19356"
                     /db_xref="CDD:267709"
     gene            139191..140468
                     /locus_tag="LILAB_00660"
                     /db_xref="GeneID:10874591"
     CDS             139191..140468
                     /locus_tag="LILAB_00660"
                     /note="COG0312 Predicted Zn-dependent proteases and their
                     inactivated homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="YP_004663142.1"
                     /db_xref="GI:338529808"
                     /db_xref="GeneID:10874591"
                     /translation="MDWFVERREVTEVLHQRAGARVVAPMLDRGWSRGHATPEGTTWQ
                     WAQVGGTHAKKGLFPGELEHRARPLLDAEPRLGGDTEATLALVHRLAETARAAGALHL
                     DVLLRQVERHTLSASDAHLREDTQRHALLEVKAFHDSGAGIAELWRCAAWPDGAGARA
                     ALPSLEALVEGLVRELRDTTPRVPCPRGVLPVVFPPGAASGCFFHEVCGHPLEGDVVA
                     RGGSYLARRLGQQVAGAHLTVSDDPTDGHGALGFAWDDEGHAALPVTLLREGRVDAPL
                     LDARSATALGRAPNGHGRRVSYRHPPLPRMAHTRVDAHQGHLEALMADLPHGLLVQHL
                     TPRQMDLLSGDFSFYIVEAREIRDGRPGRRVGPGILRGNGLEALAAIDAVGADAKNLF
                     ATRGCRKLDHGPLPVSFGQPTVRFRGLAVEPSR"
     misc_feature    139323..140453
                     /locus_tag="LILAB_00660"
                     /note="Predicted Zn-dependent proteases and their
                     inactivated homologs [General function prediction only];
                     Region: TldD; COG0312"
                     /db_xref="CDD:223389"
     gene            complement(140491..141588)
                     /locus_tag="LILAB_00665"
                     /db_xref="GeneID:10874592"
     CDS             complement(140491..141588)
                     /locus_tag="LILAB_00665"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663143.1"
                     /db_xref="GI:338529809"
                     /db_xref="GeneID:10874592"
                     /translation="MQVRSLLASTLSAAVLSACGGSSAPPPPVLDADAPFTDLPARRV
                     PVSGVIFDPEAMFYSFVMWPPDPNDPEAGPPLPALLYGMPTVMRASAWGAQVSMVGPT
                     GEVVDTSGPAMPPWGNFQTEGIPADPTVPYLMRAEPAPGMSVGGNDMFPVEEGYAPIP
                     EVPYHATTTLRPIAATGTQCLIQSPAIVGEAGALGALAQVISEETGTSVSPASLADAA
                     SGRSVALLWVYSPSPVLDAFLFPSGDIAAETTAGALYAIDWAPPGSFPGQTEMGYFAI
                     PNGMSSLGYYAVVVPPGAASALTVSFVDTLEDAEQGRPWEVPPFFVQGLPPGVSFTRL
                     FAMAPMPPMEENPYEEPAPPPDFGFLCYPEG"
     misc_feature    complement(140524..>141528)
                     /locus_tag="LILAB_00665"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(141606..143453)
                     /locus_tag="LILAB_00670"
                     /db_xref="GeneID:10874593"
     CDS             complement(141606..143453)
                     /locus_tag="LILAB_00670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663144.1"
                     /db_xref="GI:338529810"
                     /db_xref="GeneID:10874593"
                     /translation="MVFSAGCDVFNIGDAEGTRGRGARAFDPYSSSASGAIALSLLYY
                     NGCAILPTGEPVSPGSLNLPDYPAACEAMNMMGQPVPPSARFEVTPGVNYFIREFTAV
                     DAITGVHTDFNDHHAPSFWMRKQSRFKDLDWSGVTVGRDEWTNDYDSTFQRETYYENA
                     AWMRSLDDTFLIEVLDADGAVRTSVTYSRRDFMGESATTGRTRASWMVADLARPRFPG
                     DPEVSLLPDGTEPTYNTMVKASFSGATDPFKTLAMPQLTGEGLIRVTWSLLPLQPFVF
                     PIVFTPEAERPATCYRLDETGLATDEQVPCGFGLTQAVRVNRPANGSFFMPGDSVDFM
                     VSLRDGDGNGLHPRNRMPSYNEYMGESSNGLAYFNEQMLLTYREASSSESGFKVVGPL
                     QDLQVSRGSYDLPYFSFPTFSEPHFYLPPGSNLLAGGGDAQPPTHYSVQLPPNAKSGT
                     YAIILKGHRSYMGERLNRLDPFFFQVGQAQPTTYPGRVGNCQVCHNGVNSLSNVHHGM
                     SVDHVEACKTCHIEEGYGYLPDVIHRIHNSSRKYNQNKGDCTMCHLTRESTLWPSLMS
                     CNGCHVSSHGTEYFDLRFEPMQNTPNGYGNCAESCHVTTPPAEHILPPR"
     misc_feature    complement(141738..141989)
                     /locus_tag="LILAB_00670"
                     /note="Heme-binding domain of the class III cytochrome C
                     family and related proteins; Region: Cytochrom_C3;
                     cd08168"
                     /db_xref="CDD:173979"
     misc_feature    complement(order(141741..141746,141753..141755,
                     141795..141800,141807..141809,141846..141848,
                     141906..141908,141966..141974,141981..141983))
                     /locus_tag="LILAB_00670"
                     /note="heme-binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:173979"
     gene            complement(143595..144566)
                     /locus_tag="LILAB_00675"
                     /db_xref="GeneID:10874594"
     CDS             complement(143595..144566)
                     /locus_tag="LILAB_00675"
                     /note="COG2010 Cytochrome c, mono- and diheme variants"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c family protein"
                     /protein_id="YP_004663145.1"
                     /db_xref="GI:338529811"
                     /db_xref="GeneID:10874594"
                     /translation="MRSSLLFLLLALSACQRNESPPPAKAPAAAAPAPSTPKAPPAAV
                     AVDTAKLERGRYLVENVLACGSCHTPRDWSRYGGPVSGPALSGACWEDASWELPGRVC
                     APNITPDPEHGIGRWTDAELLRALRDGTGRDGKTLFPLMPFLLYRELSDADAHAVIAW
                     LRQAPASPRDGGRSAIPDEVYAQYKDLAAPVKAVVPEPAADDVSRGRYLATVAQCAAC
                     HAGMDEAGTPFAGGRPLPTPHGPEVVANLTPHARGLGALDEAAFVARFTAFKDLTPAP
                     AKAGQVNKLTMPWVFFAGLAEADLRALYRYLRTVPAMAPPAPSASGK"
     gene            complement(144581..145579)
                     /locus_tag="LILAB_00680"
                     /db_xref="GeneID:10874595"
     CDS             complement(144581..145579)
                     /locus_tag="LILAB_00680"
                     /note="COG4638 Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske family iron-sulfur cluster-binding
                     protein"
                     /protein_id="YP_004663146.1"
                     /db_xref="GI:338529812"
                     /db_xref="GeneID:10874595"
                     /translation="MRSYVDAFSAYWHPVAFSNALTAAPLAVQLLETELVLWRTGSGV
                     AVSHRRCSHRGADLSLGVVTPEGLRCGFHGWTYGADGRCVRVPSQPSAPIPARARVSA
                     FQATERYGLVWVCLAPEPAAPLPEWPELEDGTLATVPLPVLDWDVAAGRMIEIVLDVA
                     HLSFVHEGTFGNPEQPEVAPYEVERRPTGVSARIVYPALAPSTDGLPPRVDRTTLTYD
                     VTLPFAAKLAFKPTLFYVHTVYAIAAPLSEEKMRCFYFASYHPRLRNHFPDMFVKSEL
                     AILEQDRRTLEGVRPRAQPLDFAGEVHSPADRLPIEYRRGVIALRLGRPVDGPAPE"
     misc_feature    complement(145196..145549)
                     /locus_tag="LILAB_00680"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(144587..145546)
                     /locus_tag="LILAB_00680"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    complement(order(145349..145351,145355..145357,
                     145361..145366,145370..145372,145418..145423,
                     145427..145429))
                     /locus_tag="LILAB_00680"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    complement(order(145355..145357,145361..145363,
                     145370..145372,145418..145423,145427..145429))
                     /locus_tag="LILAB_00680"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     misc_feature    complement(144635..145129)
                     /locus_tag="LILAB_00680"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(144722..144724,144731..144739,
                     144746..144751,144767..144781,144806..144808,
                     144812..144814,144818..144820,144827..144829,
                     144845..144847,144851..144853,144857..144862,
                     144905..144907,144911..144913,144917..144919,
                     144923..144925,144929..144931,144989..144991,
                     144995..144997,145001..145003,145007..145009,
                     145034..145036,145109..145114,145118..145126))
                     /locus_tag="LILAB_00680"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(145585..145755)
                     /locus_tag="LILAB_00685"
                     /db_xref="GeneID:10874596"
     CDS             complement(145585..145755)
                     /locus_tag="LILAB_00685"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663147.1"
                     /db_xref="GI:338529813"
                     /db_xref="GeneID:10874596"
                     /translation="MASEETLSAAPAQNASATVDAAPTEASAAPEKLDEIEEIDFLLE
                     EIESKIAPLALA"
     gene            145897..147852
                     /locus_tag="LILAB_00690"
                     /db_xref="GeneID:10874597"
     CDS             145897..147852
                     /locus_tag="LILAB_00690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663148.1"
                     /db_xref="GI:338529814"
                     /db_xref="GeneID:10874597"
                     /translation="MMPLLSVRALAAAVLLWSLAASAEPWNGTEPGVTTLQQVLLSFG
                     APTRQVHKDGEVVLTYQRKAAPGGTRSTSFHFDARQGVLRRIEVIPTRPPTPAGLTAL
                     YGPACDAAKPPDAGLDCREEEAAPARQRWWHYRERGLSVRLDARQRVKSMRYIEPLAP
                     VRGSPARGPLPQAGSEGTTVPAAATPDDAPRAAPASGERPPDAGSAAGLATAAVDPGE
                     AGAPAGFEDLLDAPAPTAAPAGAGPSGTLVEGWQGPGGEAADPWHENPQERQPDVLAV
                     GGIYFQRAEVTGLRSRGKTSYAPVLPALADIYLDATPSKHVRGFMMGRLAYDPLSTEA
                     NGPAAALGQMWLKFDVAQRLFVTAGRQEIRWGSSQIWNPTDFLQAPNPDPLNIFDLRT
                     GVDMVRVTVPWESMAANLSLLGTANVEDAGEDLRRVRYGGGVRAEMAVGTGEIAATAM
                     FDQSRRPRYGLDATMALGLLDFNAELAWVGDGNTRLWARQGDGFVERTLESRKLLVSA
                     GVSATFNFAELYRAVVRVEGFHNPLGYDDRAFLPWLSEQGDFRPLFHGRYYALGQVNI
                     GRRGMSQLSLIFTTIANVQDASYLSRLAFNSSPFDIRDIFVQTFVEVPYGERGSEFRF
                     ESLPADPTVPGSGLGVFRAGVSLYVRI"
     misc_feature    146209..>146562
                     /locus_tag="LILAB_00690"
                     /note="ORF080 virion core protein; Provisional; Region:
                     PHA02682"
                     /db_xref="CDD:177464"
     gene            147881..151498
                     /locus_tag="LILAB_00695"
                     /db_xref="GeneID:10874598"
     CDS             147881..151498
                     /locus_tag="LILAB_00695"
                     /note="COG1020 Non-ribosomal peptide synthetase modules
                     and related proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="non-ribosomal peptide synthetase"
                     /protein_id="YP_004663149.1"
                     /db_xref="GI:338529815"
                     /db_xref="GeneID:10874598"
                     /translation="MTSRSESDSLAAAAKREQLRKLLEQRKAPTPDSAPVTAPHRNLV
                     GPSRRPEGAADVLSPAQERMWFLHQLRPDTATYVVPWAAMLESPVDEGALDGALRALL
                     ARHPLLRARFPAEAGRPQLRYLDIPERVLDVEDATGASEAALSRRLREEASRPFDLEQ
                     GPLYRFRLLKLAGQRQVLTLVFHHLVTDGASINVLMRELGVLHAAHARGEAPALAPLP
                     LEYADAAAWQHTPDATAQEPELLAWWKRQLEGAVQGLELPTDKPRPARRSDRGALTER
                     VTLPPALTRALRAFCRERQVSPFMTLYAAFAALLYRYSRQDDFCVGTPVSGRTHPSLE
                     ELVGLFVNTVVLRTRVNAADAFTALLDQVRATTLGALGHQALPFERLVQALGVERSLS
                     HSPLFQVMFDLYRVEHSLAGAFPEAQARDLPMDTGACEFDLHVTLFESASGFELFARY
                     STDLFEASTARRMLGHYLQLLTHALRAPDTRVDALSLLPEAERARVLADSNPPRRPFP
                     LDAPFPEHFSAQAARTPDHVALASASARWTYAELEAHTNRAARRLVAQDVGLESVVAV
                     LGRRSEATVRALMSIHKAGGAYLPLDAQLPAARLARLLAESRAPFVLPLGPVESLLAE
                     VLAELPAELRPRVLSLEGLDAERSERLAPRATPDSLAYVLFTSGSTGTPKGVMVDHRG
                     MLNHLLGMREALGLDGYDVVAQIAALSFDISIWQMLGALPGGGTTYLIEDDVMRDPPR
                     LADALEQGRATVMEMVPSVLQAILEGARPEQDFPDMRWVVLGGEPVPPALCRTWLERC
                     PGCRMADAYGPTESSDVASLHFINEAPEGTFTPIGTPKANMEVYVLDDALQPVPAGVV
                     GELYLGGLGVARGYVGRADLTAERFVPHPFSTTPGARLYRSGDLGRWLPDGVLQFVSR
                     ADLQVKVRGMRIELGEVEAALASLPGVRSAAVTVQRRGPSDSWLAAWVVPSSPDTDVH
                     SLQAALARLLPAFMLPSRWVLRPQLPLTSTGKLDRKALAALPLDEAPSLSEGGPPRGP
                     LEELLAQLFCQVLGVERIEREASFFHLGGHSLSATRLVARVRHSLGVQLPLSSLFTSP
                     SVASPSRLKSPRSSARPLPPLPSRALRVTQRPFSTRRPRSCLPPRASRMKPGPFSART
                     RRPPRLPSRAPRVTPGCFSPRPPRFRLPPPRLRSPRRRSASGSSTNSSRTPAPTTSPR
                     R"
     misc_feature    148049..148933
                     /locus_tag="LILAB_00695"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    148715..150697
                     /locus_tag="LILAB_00695"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    148997..149269
                     /locus_tag="LILAB_00695"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    149453..150910
                     /locus_tag="LILAB_00695"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(149867..149869,149876..149893,149897..149902)
                     /locus_tag="LILAB_00695"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(149876..149881,150227..150232,150293..150310,
                     150374..150376,150575..150577,150611..150613,
                     150620..150622,150890..150892)
                     /locus_tag="LILAB_00695"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    150977..151156
                     /locus_tag="LILAB_00695"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            151366..164964
                     /locus_tag="LILAB_00700"
                     /db_xref="GeneID:10874599"
     CDS             151366..164964
                     /locus_tag="LILAB_00700"
                     /note="COG1020 Non-ribosomal peptide synthetase modules
                     and related proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="non-ribosomal peptide synthetase"
                     /protein_id="YP_004663150.1"
                     /db_xref="GI:338529816"
                     /db_xref="GeneID:10874599"
                     /translation="MLQPASSSLPPSASAPSLSQAQERLWFIHQLQPDSGAYHIPQAV
                     ELRGAVSAEALDSAVRWLLERHPVLRTTVVSQQGQARVEVSSVPARVLQTEALRSAPE
                     ALDLRLQQESWRPFSLEQGPLYRFLLLDIGDDRHVLLAVFHHLVVDGLSLDILLRELG
                     EAYAAFQRGQAPSLASVTLHYSDVAAWQRSEPVQARDAVQLDYWKQRLSGAPALLQLP
                     TDKPRPAVLTHQGASTGTQALPAALTDAVQRASREHDATPFMVLYAAFAALLYRYSQQ
                     DDFCVGTPVSGRTHPSLEGVVGLLANTVPLRTQVEPSTSFASLLAQVRSTTLDALGHQ
                     DVPFERLVQALGVERSLSHSPLYQVMFDLHRVQGSLADAFTGLEARPVPVDIRASPFD
                     LALSVIEQGGHVELFLRYSGELFEAETARRMLEHYQRLLAQALTEPHLPLSRLSLLSS
                     DEQAVVLRHARPTPLAFGLDTCLPERISAHARNTPDQVALASADAQWTYAQLETQGLR
                     AARTLRAQGVGHESVVAVLGRRSEATVRALLSLHKAGAAYLPLDAQLPASRLARLLRE
                     SRAPFVLPLGPVESLLAEVLEELPAELRPRVVSLQPMAAESDAPLTSFVTPDSLAYVL
                     FTSGSTGTPKGVMVDHRGMLNHLLGMQHSLQLGASDVLAQTAPLSFDISIWQMLGALA
                     AGGTAYVVDDDVVREPARLIAALQQAGATTVELVPSLLQALLEEPGDAPLPALRQMLT
                     IGEALPPSTCRAWFERYPSVPLVNAYGPAECADTATLWRMLAPPASASTPIGTPKANM
                     EVYVLDDALQPLPPGVPGELYIGGTGVGRGYVGRADLTAERFVPHPFSTTPGARLYRT
                     GDRGLWNTNGTLSFLGRVDFQVKVRGMRIELGEVEAALASLPGVRSAAVTVQRRGPSD
                     SWLAAWVVPSSPDTDVHSLQAALARLLPAFMLPSRWVLRPQLPLTSTGKLDRKALAAL
                     PLDEAPSLSEGGPPRGPLEELLAQLFCQVLGVERIEREASFFHLGGHSLSATRLVARV
                     RHSLGVQLPLSSLFTSPSVASLALEVASLQRSASSAPSVAGPTRDAGALQHAASSAPS
                     VAGLTNEAGALQRAASASTAPSLSQAQERLWFIHQLQPDSGAHVVGQAAEWTGTVDVP
                     ALDAAARWLLERHPVLRTTVSSRQGQPQASVAPVPASVLQVEPLPPGADAPARQARRL
                     TEEGNRPFDVEHGPLYRFLLLEAEQARHVLVVVFHHLVSDALSAGLLMHELGEAYAAF
                     QQGHAPSLAPVALHYSDVAAWQRSEPVQARDAAQLDYWKQRLSGAPELLQLPADKPRP
                     AVLSHRGGNTGYHPLPPSLSESLRALCRQQQVTPFMVLYAAFAALLYRYSQQDDFCVG
                     TPVSGRTHPSLEGVVGLLANTVPLRTQVEPSTSFASLLAQVRSSTLDALGHQDVPFEQ
                     LVRALGVERSPGHAPLVQVMFDLHRTELSAASGFHTLGARRVPIETWTCEVDLFLTAI
                     EVGEGFEVYFQYSTDLFEPGTVERLRNHYVQLLAHAVASPRTAVGELALLSAAERAQV
                     LQSFNATERPFDSEGTIVSLIEAQVARTPDAPAVVAPEGTLTFRELHTRASRLAAHLT
                     AAGAGPEAVVGLCLERSLDAVVSLVAIFISGAGCLPLEATHPPARRAALLRQARARLV
                     VSRPGLFAGVEPGVPLVSPDVRGDVVAVPRPPRAEHLAYLLYTSGSTGEPKGVELTHR
                     NVVHCFAAFDTYYATQPGDCWASSGSLSFDIHLEELLFSITRGARTVLREVGPLGLGR
                     DILRHGITHVVITPSSLATALEEPGAPEAFRALKVLVTGGEVLPDPLVRQLALTQTRL
                     VNTYGPTETSINVAAEITLPDRPVRLGRPLDRCRLYVLDASGAPVPPGVPGELYIGGT
                     CLGRGYRDRPDLTADRFIPDAFSGTEGARLYRTGDRVRWNGDGSLGFLGRTDFQVKVR
                     GVRVELEEVEAALLRQPGVRQASVVVRGSQRDARLESFLVLDDTAPGVEARLREGLSR
                     ALPEALVPSRFTVLNALPMTTSGKVDRKALAALPVQDMEPEAAPGARPRGAVEELLAL
                     LFCQVLGVPQVRREDDFFHIGGHSLAATRLVARVRQAFDVEFPLQAFFTEPTIAGLAR
                     ELEARRDGAALLPAPVPRPVDAALTLSPTQERLWFVQQLHPGTSAYHLAEAVELAGPL
                     DVAAMEDALRWLVTRHPVLRLAVPARDGLPAPVQAPVPARVLDVEASDAPEQWARDAV
                     HAPFDLARGPLYRFRLLRTAPEQHVLLLAFHHLVVDGLSLDVLVHELGEAYAAFHHRR
                     VPTLAPPRLEHADIAAWLRTPPARERDEAQLTYWKQKLEGVPGLLRLTPDKPRPEAPL
                     LTGAITGGHALSADTVRALQAFCREQQATPYMVLLAAFSALLHRYSGQEDFCVGTPVA
                     GRTHPALEGVVGLMLNTVALRTPVAPDAPFSTLVARVRATTLEALAHQDVPLDRVVQA
                     LGVERSATHSPLFQVMFDLVRTDRTLADAFPDLRARPLQPELLTSPFDLSLWVAESAT
                     GYTLALRYGTELFEVTTAQRFLGHYLRLLQHALEAPGTAVSALEVLPAAEREHLLQTW
                     NGADADFPREHTVHALFEAQAARAPDAPAVLHGADVLTYGQLNARANQLARHLRRLGV
                     RSQTLVGLCLRRSVDMVVAVLGVLKAGGAYVPMDASHPPARLNFLLEDTGAPVLITED
                     AVADTLPVSQALVLCLDSEWERTAGREPDAPLEAVSSAEDLAYLIYTSGSTGRPKGVM
                     VEHRGVVNYLHWARTAYAVDDGAGAPVHSSLAFDLTVTSLLLPLTAGRPVTLVPEEEG
                     VDGLAAALRTGADFSLVKLTPAHLQMLAAQLAPEAREGRTRAFVIGGEALTSAVVEPW
                     RRHAPGTRLINEYGPTETVVGCCVHTVDADTAVEGAVPIGRPIANTRLYVLDASLRPV
                     PAGVPGELYIGGEGVARGYWRRPELTAERFVPDPFSSVPGARLYRTGDRVRLRPSDVL
                     EYLGRVDFQVKVRGHRVEPGEVEAALMELPGIAAATVVLREDGVTGPRLVGYVTGHDA
                     VPDTEPLRAALTQRLPAHMVPAALVALPQLPLTPNGKVDREALPAPEAQAAPGEDFVP
                     PSTPTERALAQLWEALLGVPRVGARDDFFELGGHSLLSVQLASRVRERLGVELPVATL
                     FATPTLAELAARVDASPRVVEVVDAAPRARPERVPASLVQERLWYAMQLPEAPPFVVV
                     AALVLEGDLDVARLETALEAVLEHNATLRTTFHLEHGAVVTHAHPITRPVLVQTDLSH
                     LPAAEALDAARAIATRHDREPFAVDQGPLYRFELARLDATGTRHVLVASMSHLVNDGI
                     GMGAFLEELAQAWAAATPLLPPAPRTYADFALWQRSPEHLREVDAAVASWKDALAHAP
                     SVLDLPLDFPRRAPALNANMRPEPLSLGAEAMTALQALARREGVSPFTAVLALMQLWL
                     HRLSAQPHVVVASPFSGRVLPRSERQVGYFANVLPLCTEVAGAPSFRALLRRAWEVVG
                     HATANQEVPFKRIADTAQPDAPRTAPPLAQALLLLDSPASLSFGELRTTYLDGESIFP
                     AYDVVLHLIERPEGGTLGFLATDSALFTAATAQRMARAFEQLLTEAVRAPDAPLARLS
                     LLSSQQRAQVLATLDGGPQAIPEGACIHTLFEAQVRRSPQAPAVAHGESTWSYAELNA
                     RANALAARLLSQGMQPEERVGVVMEPSNQGMAALLGILKAGGAYVPLDAGWPEPRKRS
                     VLARAGVRRLWVDAEALEAHAGLVPDVEVPPQPAHIAEDLEPGPRHVPASQVAYIVFT
                     SGSTGEPKGVMVEHRSVVNHNVALAARFGLRPGDRMLQFAPLSFDAAAEDLYPPLVVG
                     ATVVMRSGLVPAHVMTPYLEETGITLISLPPTYIEEWIRQMESHGQRVPARLRLLAPG
                     GDVLKRETYEAWVRVGGGHAPWLNVYGPTECTITSATCDIPGAEGLGTEATFPIGRPI
                     PRVRIHLLDEHLEPVLPGLPGRVYIGGAAPARGYLGAPDLTAERFIPDPFSPEPGARM
                     YHTGDLARMLPDGRLRFLGRADHQIKIRGFRVELAEIEACLRQFPGVEEAVVLARTGG
                     SGQTQLQAFIQAPPAQVRVEALREHVASRLPSYMVPTALVVMEALPINANGKVDRQAL
                     PDASTQPAAPAVQETPGEHHETPFRTTLEMALERLWREVLGRTDIGASDDFFQTGGDS
                     ILAMRLLSRMEEELGVPVPLATLFQYPVFRETADAVQELLAEGPPRSSVVSLSGKQTP
                     KSAPPFFVFHPADGELHYYRNLTPLLEPGLRCYGVQAPETQSKHGHATFDARIDAYVR
                     DIREVQPHGPYRFAGYSFGGYPALGVAAALEAQGETVELLALVDALPATEGPQTPEDP
                     VRSMADEFGILDAALEAELASLDDAARWERVTALGRELGMLAPHSRAADLRRIWHVLG
                     EVLVPQVLGWKVPSVRARVQLFTSAPSRALHGETLGWERHLSREQLDVVPLTSSHFGT
                     LQPPCVQELANHLLEVLKRQGR"
     misc_feature    151426..152298
                     /locus_tag="LILAB_00700"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    152080..154059
                     /locus_tag="LILAB_00700"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    152362..152634
                     /locus_tag="LILAB_00700"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    152818..154272
                     /locus_tag="LILAB_00700"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(153232..153234,153241..153258,153262..153267)
                     /locus_tag="LILAB_00700"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(153241..153246,153589..153594,153655..153672,
                     153736..153738,153937..153939,153973..153975,
                     153982..153984,154252..154254)
                     /locus_tag="LILAB_00700"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    154339..154524
                     /locus_tag="LILAB_00700"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    154696..155586
                     /locus_tag="LILAB_00700"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    155368..157290
                     /locus_tag="LILAB_00700"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    155650..155922
                     /locus_tag="LILAB_00700"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    156106..157503
                     /locus_tag="LILAB_00700"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(156487..156489,156496..156513,156517..156522)
                     /locus_tag="LILAB_00700"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(156496..156501,156835..156840,156895..156912,
                     156967..156969,157168..157170,157204..157206,
                     157213..157215,157483..157485)
                     /locus_tag="LILAB_00700"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    157573..157767
                     /locus_tag="LILAB_00700"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    157837..158703
                     /locus_tag="LILAB_00700"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    158488..160461
                     /locus_tag="LILAB_00700"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    158767..159042
                     /locus_tag="LILAB_00700"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    159226..160674
                     /locus_tag="LILAB_00700"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(159631..159633,159640..159657,159661..159666)
                     /locus_tag="LILAB_00700"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(159640..159645,159988..159993,160054..160071,
                     160138..160140,160339..160341,160375..160377,
                     160384..160386,160654..160656)
                     /locus_tag="LILAB_00700"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    160738..160932
                     /locus_tag="LILAB_00700"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    160987..161871
                     /locus_tag="LILAB_00700"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    161947..162216
                     /locus_tag="LILAB_00700"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    162400..163851
                     /locus_tag="LILAB_00700"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    162496..163659
                     /locus_tag="LILAB_00700"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    order(162796..162798,162805..162822,162826..162831)
                     /locus_tag="LILAB_00700"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(162805..162810,163156..163161,163225..163242,
                     163315..163317,163516..163518,163552..163554,
                     163561..163563,163831..163833)
                     /locus_tag="LILAB_00700"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    163942..164133
                     /locus_tag="LILAB_00700"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    164209..164961
                     /locus_tag="LILAB_00700"
                     /note="Thioesterase domains of type I polyketide synthases
                     or non-ribosomal peptide synthetases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: COG3319"
                     /db_xref="CDD:225856"
     misc_feature    164227..>164709
                     /locus_tag="LILAB_00700"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(164965..165765)
                     /locus_tag="LILAB_00705"
                     /db_xref="GeneID:10874600"
     CDS             complement(164965..165765)
                     /locus_tag="LILAB_00705"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663151.1"
                     /db_xref="GI:338529817"
                     /db_xref="GeneID:10874600"
                     /translation="MNARRPLSILLLGWALLLPAAALAEAAPKPAEAAPKLAPDALLR
                     HIDEKMSFTSDYKGVIRLYETRKDGAKRAMEVHVYRREADNDLLFLSTKPRHLAGMGT
                     LRIGRNLWDYEATTGSWRRNTQRTNLLNTFTCEADFDRSRLAEDYAGKDEGDDTVNGV
                     AYRKLLLTAKNDQVTFPLMRIWVDPQNNIVKKVGYTASGRTLRTDIVRSYQRIKDPLS
                     GKHVLHYKEVLETEEQEGTQMVVRYDEVVLAPLAANIFTKAWLESRLR"
     gene            complement(165765..167057)
                     /locus_tag="LILAB_00710"
                     /db_xref="GeneID:10874601"
     CDS             complement(165765..167057)
                     /locus_tag="LILAB_00710"
                     /note="COG1073 Hydrolases of the alpha/beta superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_004663152.1"
                     /db_xref="GI:338529818"
                     /db_xref="GeneID:10874601"
                     /translation="MRALLQIAFRNLLAHRERGLLLLIVLAGASAVLVGVMSVSAGVA
                     RAQREAVRTFLAGDLNVGGYFKEHPDSIFPVVGDTSKVRSVLQPHVPASCQVRERGRG
                     SATAGAGKHRVRSYLMSLDVAAEGNAGFRVRTGSLEALAKPRTVALSTSLAERLQVEV
                     GELATLFVQMPGGKRNAVDVEVVALLERAGVLGESAGLLVSNAMLRELYGFRPDSASV
                     IQLLCEDSTELEPLAGTLRGALQKAGFEVLPPAHEAYGDKLGPLLREGWAGQKLDVST
                     WEDEAAFLDFVGQGLGLLLVLVGAVVFGVVVVGLFVSLNVSVRERTREIGTLRAMGMQ
                     RRSLVAAFMLEGLLVGGAASLVGASVAAGLGVLLRDVLPVPDALATLFFSGTLPLAPS
                     LGHVVAAVLLVTIGAGLASIVPAFRAASLPPRSAMESL"
     misc_feature    complement(165771..167057)
                     /locus_tag="LILAB_00710"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    complement(166347..167036)
                     /locus_tag="LILAB_00710"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    complement(165789..166121)
                     /locus_tag="LILAB_00710"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(167062..169056)
                     /locus_tag="LILAB_00715"
                     /db_xref="GeneID:10874602"
     CDS             complement(167062..169056)
                     /locus_tag="LILAB_00715"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_004663153.1"
                     /db_xref="GI:338529819"
                     /db_xref="GeneID:10874602"
                     /translation="MVGLLAAGAAALLTPGVSLMGSIHEGTRRSLIESGAGDLQVYAA
                     ASTGTPQVVVGPGGVPDLKPIPDYSALEPRLRELPGVREVVPLELGMGAVFRGNALDE
                     KLAVLREAARAPTSEERDARLRRLGEDLRRTLARVARNADRRGEAFAEEPAFADDLRV
                     LKDAAQPAFWERLTEDPQGLLEVLENRVARQAGEGEELPVDYLGTDVARFARAFPRFE
                     LVTGQLPPPGTRGLVMGHATYEQYFKHPIAVRMDTLRRERERGLTLAEDEQLRTLVER
                     NVAEVPDLVARLDIERATSLQAGLARVLGETGELEALLARFLSVDDATFDTRFAQFYG
                     ELAPSLPLYRLKPGDTLSLKTPLESGTAVPVRVYGTFRFQGLGGDDGRVNMMSVVDLV
                     TARHLSGRFTEAQQEEARALFETFGMEGEAMAPPESLEAFHPPDIVDAEARTVDTEQA
                     PVFERARALPDTFSEDELSRGAVLQAAVVLEPGTAVEDVEARIRALPGGEALATVGWQ
                     EAGGLLGGLVVMLQAVLLLFALLLSSFVALVAAGTLLLLARERVAEVGTLRAVGMQRR
                     EVFASLLLEGTLLGGIGSVLGAAVGAALLRLATGGGVAVEDGSLQFFLGGTVLRPELA
                     LGGTLAVVVAVTAVVLLATLVPAWRGSAVAPIEAMRKGEG"
     gene            complement(169204..173154)
                     /locus_tag="LILAB_00720"
                     /db_xref="GeneID:10874603"
     CDS             complement(169204..173154)
                     /locus_tag="LILAB_00720"
                     /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /codon_start=1
                     /transl_table=11
                     /product="putative non-ribosomal peptide synthetase"
                     /protein_id="YP_004663154.1"
                     /db_xref="GI:338529820"
                     /db_xref="GeneID:10874603"
                     /translation="MVQLVEEFLRAEGRVRDVWVSPEVAWVVPRRAVRAAELDALLHE
                     RLGARVPAVALVDALPRLDSGAVDEAALRRGAPPVPARLQSLEDALRQQGIEAVALVG
                     PQRDEEVHTPLDALLPADLLSKAGGVSPVSSKRSVAEARAHTEARPSLIDSGPRRMPD
                     GAPRTLVELLRQAVEHGPQLAITFIDVQGQRETLTFSALWDEALRLWGGLRARGAKAG
                     DRVMLAMERPGDFVRGFWACTLGGVVPVPLALPASLERSQPGVARLLSVSERLGAPLL
                     LTDGRASSALTEGGLRALALESLAGAAPGRPADVAPESPAILSFTSGSTGRPKGVVLT
                     HANLMAMGEGMVAGGWYLPGDLGVSWMPLDHVAGTSYPHLLALRTRTPHVLVARDYVL
                     ADVLRWLDLLTEFGGTMSWAPNFAYGLVADRLERGERRAWRLHQVRVLGCGGESVLPA
                     TLRRFSEPLRDNGLREDAVCPAWGMAETSSYFTMTRGVRGHPVEGATELGPPPVGAAL
                     RVVDDADVVVPEGQVGHLQARGAQVLSGYLDDAELNARSFTADGWFRTGDMAVIQDGQ
                     MAIAGRQKEVLILHGNNVYPQDIEEVVESVPGVLPSYTVACPTRSGAAQTDELAVCFV
                     PAPDAPPLAELLRSIREKVGRVLGFHVAHLLPLARQQVPRTELGKRGRTELRRRFEAG
                     ELVAEHHRALSILGGPATMPPCLAVARWVPRPLASSVSKAETQGAVVVIADEAFAGAM
                     REQMRGREVVRVAPEASGDLVHVLGALAERGLPCGDVVVRLPDVGGEAPAPDAVHQRP
                     VSGAGDAEARRVVLAASVAPLLRALQALSAGPGVRVLAVLPETGTGTHGAGTQAALLA
                     PGLLWAAAAEVPGLEARVTWAPSDASAAAHAAAREVTSQDAAREVAWRDGTRWERLFT
                     PWTPPPLAAPQRLKREGLYLVTGALGGLGREWARQLRQGVDARLLLVGRRAHGPEARA
                     LEAELGAAKYLSVDVTDEAALREAVRHAEAHFGQPCDGAFHFAGTLTPTPVADETPES
                     FVQGAAAHALGALSIAAVLEGRPQAVCVFAASLMGTLGAGRHAAYCAGTAFLERLAER
                     LTAQGRHAAAVSLSQVRETGLARALGTAPPGYRVLEPSQALASVALAGEHAPAHLLVG
                     VVASAWPWRQAGLGSGRYLDAAHVFLVPPPRPEGLSGAVLHPLTEWPRRADSSVDREA
                     LAADLSGTGDGTPAGPFETVVMEAFREVLGAQGVGAGSDFFTLGGSSLQATRVVARIN
                     ERTGLRLREVALFEHPTATALADHVRRVVDLTQLDISVLSDAQVDLLLRVLAPT"
     misc_feature    complement(172936..>173142)
                     /locus_tag="LILAB_00720"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(171091..172692)
                     /locus_tag="LILAB_00720"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    complement(171109..172692)
                     /locus_tag="LILAB_00720"
                     /note="The adenylation domain (A domain) of a family of
                     nonribosomal peptide synthetases (NRPSs) synthesizing
                     toxins and antitumor agents; Region: A_NRPS_TubE_like;
                     cd05906"
                     /db_xref="CDD:213274"
     misc_feature    complement(order(172168..172173,172177..172194,
                     172201..172203))
                     /locus_tag="LILAB_00720"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213274"
     misc_feature    complement(order(171148..171150,171406..171408,
                     171439..171441,171448..171450,171481..171483,
                     171727..171744,171823..171828,172192..172194))
                     /locus_tag="LILAB_00720"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213274"
     misc_feature    complement(169717..170934)
                     /locus_tag="LILAB_00720"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(169873..170358)
                     /locus_tag="LILAB_00720"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    complement(order(169843..169851,169918..169920,
                     169930..169932,169969..169977,170107..170115,
                     170263..170271,170329..170331,170335..170340,
                     170344..170346))
                     /locus_tag="LILAB_00720"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(169918..169920,169930..169932,
                     169969..169971,170041..170043))
                     /locus_tag="LILAB_00720"
                     /note="active site"
                     /db_xref="CDD:187535"
     misc_feature    complement(169294..169482)
                     /locus_tag="LILAB_00720"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            173260..174762
                     /locus_tag="LILAB_00725"
                     /db_xref="GeneID:10874604"
     CDS             173260..174762
                     /locus_tag="LILAB_00725"
                     /note="COG0500 SAM-dependent methyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative O-methyltransferase"
                     /protein_id="YP_004663155.1"
                     /db_xref="GI:338529821"
                     /db_xref="GeneID:10874604"
                     /translation="MAAPHEPISLAQSLHFWARNASNESALFQTALRVGLLDALPVEG
                     REAPLPAEALAERLGCSARGLRSLLELLVCLDFVRMDDARRFSLAPHTATLLGDGAFR
                     KQLEAELPWWGPMGRLADAVRSGDAVDFEGQRWDVLGHLRERLVAPTAFATPAHEDFF
                     DRFARSALRTQVLLAAGEGGLLAALAEGPRAEQALAEATSSRAPGVLLEALAALGMTR
                     RQDDAWALTPEAKTLLEGKALAYLVRSLSVSARYWEALGRLDETVRDERYVLDLKDPE
                     VSGRFYADNSQQITAVFATHFQLSRRAAATLASVRPLEGAAVLDIGTGSGVWGAAFAR
                     ASSSTHVTYFDQAVVLEQVRRNVAKLEVADRARFWPGNLFTEDFGAADFDVIILPQVL
                     NVLSPKDIPGIFARVARALRPDGILVIAEYVLNERRDGPLDHLYFGLRRFMTNEGDLL
                     SASEYAKLLADVGLTTSVCIPLPTQELVFAARDGVRLPTTLAAPPRPPSA"
     misc_feature    173914..174636
                     /locus_tag="LILAB_00725"
                     /note="O-methyltransferase; Region: Methyltransf_2;
                     pfam00891"
                     /db_xref="CDD:250208"
     misc_feature    174211..174531
                     /locus_tag="LILAB_00725"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(174220..174240,174292..174297,174370..174378,
                     174424..174426)
                     /locus_tag="LILAB_00725"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            174882..175859
                     /locus_tag="LILAB_00730"
                     /db_xref="GeneID:10874605"
     CDS             174882..175859
                     /locus_tag="LILAB_00730"
                     /note="COG3239 Fatty acid desaturase"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase family protein"
                     /protein_id="YP_004663156.1"
                     /db_xref="GI:338529822"
                     /db_xref="GeneID:10874605"
                     /translation="MSAALQEDSDAQPSSTARPVRGVHPASIAARLRAEYAREVAALG
                     YHAHSVPGALAHLALHLGLAVAVAAAFELLLSHAPRAAWLGYPLVAFLIATRFRAVGN
                     MLHEACHGMLVRGKRHNRNLGHLLAVLDLTALDPYRRDHFTHHLHLGDAQKDLDFQPR
                     RRFGFADPGRPFVKSHLLRPLLLIHLPAFIRPVLFHREDPVWVTLTRWAFIGGLLAVA
                     HFAVGWDVFLRAYLVPYFVAYQVIRYWSDAVDHAGIISSADEFHRSRNHVFAWGWLNR
                     LLFPRNDEYHLTHHLFPAVPTPFQGRVHRLLLRDAEYAARDHAFSALTR"
     misc_feature    175122..175823
                     /locus_tag="LILAB_00730"
                     /note="Fatty acid desaturase; Region: FA_desaturase;
                     pfam00487"
                     /db_xref="CDD:249898"
     misc_feature    order(175194..175196,175206..175208,175302..175304,
                     175311..175316,175737..175739,175746..175751)
                     /locus_tag="LILAB_00730"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:238511"
     gene            complement(175856..177022)
                     /locus_tag="LILAB_00735"
                     /db_xref="GeneID:10874606"
     CDS             complement(175856..177022)
                     /locus_tag="LILAB_00735"
                     /note="COG0436 Aspartate/tyrosine/aromatic
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="class I aminotransferase"
                     /protein_id="YP_004663157.1"
                     /db_xref="GI:338529823"
                     /db_xref="GeneID:10874606"
                     /translation="MEPLRTFFMEDYLEGSRFTARFNLGESGGRPVTVGELLLGSGVS
                     AERAAEVFLSTPLNDSPNWGRADLRDAVAAMHPGATRDNVLITTGTSEALLLLFRQLR
                     PRKVALAWPAFQLLYELPQRQGAEVVRLPVRWDTRGVPSVDADLWLERLEREQPDTVI
                     INNPHNPSGLVLDAALLAAVDRWAERTGATVVGDEHYRFLSSETSVLGASVYRPGPRH
                     FVTGSFIKCLGCPGLRIGWTVGDTAMLARMQNEKNYTTHTVNPVTEWVAREVLRDLNS
                     PALSRAREDWLRNRATLAAFLERSRGVYGVAPRGGLVTCIGLREARDDAGAEALLKAL
                     SDAGVFVLPLSAMEAGSPEGTHPLARGHGFRLGLGISPERFPEALEAIEGATAR"
     misc_feature    complement(175877..176998)
                     /locus_tag="LILAB_00735"
                     /note="capreomycidine synthase; Region: viomycin_VioD;
                     TIGR03947"
                     /db_xref="CDD:188462"
     misc_feature    complement(175874..176896)
                     /locus_tag="LILAB_00735"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(176321..176323,176345..176350,
                     176354..176356,176432..176434,176525..176527,
                     176684..176686,176750..176758))
                     /locus_tag="LILAB_00735"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(176225..176227,176234..176236,
                     176321..176329,176453..176455,176654..176656,
                     176747..176749))
                     /locus_tag="LILAB_00735"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(176345..176347)
                     /locus_tag="LILAB_00735"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(177041..178540)
                     /locus_tag="LILAB_00740"
                     /db_xref="GeneID:10874607"
     CDS             complement(177041..178540)
                     /locus_tag="LILAB_00740"
                     /note="COG2813 16S RNA G1207 methylase RsmC"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_004663158.1"
                     /db_xref="GI:338529824"
                     /db_xref="GeneID:10874607"
                     /translation="MSQPVSAPSPAFVQQLNFHARDASNEAAALQAAFSLGLFEQLPE
                     TGAGAPVPLEALAKRVGGTWRGTRSVVEPLVALGFVHLEDGKGYSLPAATAAFLRDEG
                     FTAELREARRWWHPLALLPQAVRAGGPVAWGGGTWDVLGWCRALFLAPPPSTPSAEAR
                     DFHDRFARNPARTLALVAAGELDVLARLVRGPVTLDALARDVGAPAEALEVLLGALAA
                     MGIAQAHDAGWGFTEAAGRALDAQSLPYFQRALPATMAYWEALGHLDEAVREQRFRLD
                     LRDPETARRIYQENASRISSIFASHLRLSRQAAALVRSMRPLAQARVLDVGTGSGVWG
                     AAFGLADPTSHVTYLDSPHVLDAVRPHLAKLKLEARSELWAGDCLSVDYGESRFDVIL
                     LPQIIPALPSAELPGFFARLARALRPGGLLLISGYLLTDRRDGPLDALYFALRRYVTN
                     EGDVLSLPEFRALLGPVGLTQARGFDMPIQQVVIAHRGDVAWPAAAPAA"
     misc_feature    complement(177131..178009)
                     /locus_tag="LILAB_00740"
                     /note="C-20 methyltransferase BchU; Region:
                     C20_methyl_CrtF; TIGR02716"
                     /db_xref="CDD:131763"
     misc_feature    complement(177254..177577)
                     /locus_tag="LILAB_00740"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(177359..177361,177407..177415,
                     177491..177493,177545..177565))
                     /locus_tag="LILAB_00740"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(178561..179586)
                     /locus_tag="LILAB_00745"
                     /db_xref="GeneID:10874608"
     CDS             complement(178561..179586)
                     /locus_tag="LILAB_00745"
                     /note="COG0842 ABC-type multidrug transport system,
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004663159.1"
                     /db_xref="GI:338529825"
                     /db_xref="GeneID:10874608"
                     /translation="MSALGQLVLMRLRMVMRQPEVVFWTFIFPVVTTLFLGLAFRNDA
                     LGPVRVAVADGAGAQALVAKLEGVPELSAEVADEASARRRLARGQLSLVLLPGAVPEA
                     LVDPSQPEGRTARLLVAQALAAPEGTPAPEVMKATPVSEPGNRYVDFLIPGLLGLSLM
                     SSSLWVVAGSLVAMRGGKLLKRLAATPMRRSHFFMSYLLARVGFALAEILFFCAFARW
                     LFSVPMFGSYFTLTLVGLAGAMCFASVGVLVATRARTEEAVGGLVNLVSLPMMFVSGV
                     FFASGNFPSWLQPVIRALPLTAINDSLRAVMLEGAGLASLGPPMLVLAVWTVVPLVLA
                     LRWFRWT"
     misc_feature    complement(178579..179526)
                     /locus_tag="LILAB_00745"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     misc_feature    complement(178663..>179079)
                     /locus_tag="LILAB_00745"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     pfam01061"
                     /db_xref="CDD:250332"
     gene            complement(179586..180536)
                     /locus_tag="LILAB_00750"
                     /db_xref="GeneID:10874609"
     CDS             complement(179586..180536)
                     /locus_tag="LILAB_00750"
                     /note="COG1131 ABC-type multidrug transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004663160.1"
                     /db_xref="GI:338529826"
                     /db_xref="GeneID:10874609"
                     /translation="MTHQDELAIEVKGLVKRFGDVTAVDGVDLDIRRGECVGLLGPNG
                     AGKTTTVEILEGLQTATSGEVRLLGLRWEKDAAALRERIGMTLQETRLVDQLTVEEMV
                     RLFTSFYPRPLEVEALIGLVQLGEKRHARVGKLSGGQKQRLALALGLAGDPEVLFLDE
                     PTTGLDPQSRRALWDVVAQLKARGCTVVLTTHYMDEAEVLCDRLVIIDRGRVIARGTP
                     RDIITSLGAEQVIELEAAPAPDLERLRPLPAVVAAQRHASRITLRVRELHLALPEVLR
                     EISAAGGQLLHLSTRRPTLDDVFIDMTGRSLRESAEEKAA"
     misc_feature    complement(179622..180515)
                     /locus_tag="LILAB_00750"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(179901..180512)
                     /locus_tag="LILAB_00750"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(180393..180416)
                     /locus_tag="LILAB_00750"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(179961..179963,180057..180062,
                     180273..180275,180390..180398,180402..180407))
                     /locus_tag="LILAB_00750"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(180273..180284)
                     /locus_tag="LILAB_00750"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(180105..180134)
                     /locus_tag="LILAB_00750"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(180057..180074)
                     /locus_tag="LILAB_00750"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(180039..180050)
                     /locus_tag="LILAB_00750"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(179955..179975)
                     /locus_tag="LILAB_00750"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(179634..179891)
                     /locus_tag="LILAB_00750"
                     /note="Domain of unknown function (DUF4162); Region:
                     DUF4162; pfam13732"
                     /db_xref="CDD:258028"
     gene            180682..181473
                     /locus_tag="LILAB_00755"
                     /db_xref="GeneID:10874610"
     CDS             180682..181473
                     /locus_tag="LILAB_00755"
                     /note="COG0204 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase domain-containing protein"
                     /protein_id="YP_004663161.1"
                     /db_xref="GI:338529827"
                     /db_xref="GeneID:10874610"
                     /translation="MDRLELPFNEFGVDPYGISKSHVKHALRVFGAIYRYYFRVRCYG
                     VEHIPPRGRGMLVGNHSGGVAVDGAMVLTSTMLELDPPRLAQGMVERFLHNFPVSSLW
                     ASRTGQFIGLPEHARRLLEDDRLLMIFPEGARGTAKLYNERYSLVDFGTGFVRLALQT
                     RSPIIPFAFLGGGSAVPTVFNAYTLGKLLGVPYVPLTPYLLPLPLPVQLEIHYGEPLV
                     FHGTGDEEDHVIEGYVEKVKQRIAGLIERGRAQRHSRRLGRNLLP"
     misc_feature    180781..181431
                     /locus_tag="LILAB_00755"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: MGAT-like; Region:
                     LPLAT_MGAT-like; cd07987"
                     /db_xref="CDD:153249"
     misc_feature    order(180859..180861,180871..180873,180880..180882,
                     180931..180942,181075..181083)
                     /locus_tag="LILAB_00755"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153249"
     gene            181470..182408
                     /locus_tag="LILAB_00760"
                     /db_xref="GeneID:10874611"
     CDS             181470..182408
                     /locus_tag="LILAB_00760"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663162.1"
                     /db_xref="GI:338529828"
                     /db_xref="GeneID:10874611"
                     /translation="MRVLIPGISGGIARQLALHLHARGHQVAGIDTRPWAEAHAAGIQ
                     VYRGDVRKRAAEDVFRRWRPEAVVHMATVTAFTVPGKERGRINLDGTKAVFDHCAAHG
                     VKQVLFVGRHTFYGAAPDSPLYHSEDEPPRALEAIPELADLVAADLYAATALWRLPKM
                     TTAVLRLPYTLGAPGTGTLSSFLKGRRVPLVLGYDPLFHVLQEEDVVTALTLALEKQV
                     RGIFNVAPPPPIPLSVIVRETGRTAVPLPAPLLSLLLGRAGLPRLSVGALDHLRFPIV
                     VDNRRLLDATGFEYRHSVADTLRIYRESAPILPAGA"
     misc_feature    181470..182378
                     /locus_tag="LILAB_00760"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    181476..182384
                     /locus_tag="LILAB_00760"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(181488..181490,181494..181499,181503..181505,
                     181557..181565,181677..181685,181794..181802,
                     181884..181886,181896..181898,181968..181979)
                     /locus_tag="LILAB_00760"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(181728..181730,181800..181802,181884..181886,
                     181896..181898)
                     /locus_tag="LILAB_00760"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            182455..184038
                     /locus_tag="LILAB_00765"
                     /db_xref="GeneID:10874612"
     CDS             182455..184038
                     /locus_tag="LILAB_00765"
                     /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase
                     and related FAD-dependent oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="PheA/TfdB family FAD-binding monooxygenase"
                     /protein_id="YP_004663163.1"
                     /db_xref="GI:338529829"
                     /db_xref="GeneID:10874612"
                     /translation="MSADIEEVDVVIAGAGPVGVLTANLLGLQGVRVLVLEREAAPHG
                     QPRAFSCDDEALRIYQAAGLLDALKPDLRQGRHVTFTGVGGQPIARLPLGELDFGYGY
                     TPVWFFHQPLLEKALREGLGRFAGTELRTGTDVESLEQDGAGVTVCYRTSPSGERRRV
                     RARYLVACDGGRSTVRALLGIPMEGRGEQEPWIAICGTVADEDAHPECHVVCDPVRPG
                     FVGRGPLGRFRWEFRLRLGETGEEMTQPGTIRRLIGPYVNPDRVTVERAQLYRFHSLV
                     AQRWQVGRTFLAGDAAHQLPPFMGQGLVSGLRDAANLAWKLAWVIQGRAPEALLDTYS
                     VERRPHVRALLDATARLGAVFTSRSTPMAWVRDTVLRGLQAIPAARRFVEGVQFKPAP
                     SIEEGWLLGGRRSGRRAAEGSYLPQPRVRRASGEERLLDDSLGSGFAVLSRGGSPGTE
                     VARELAESLGARAVTVRSAGVPGVDVDSVEDHTGRLSEWFREHGADVAVVRPDRFVFG
                     AVPLARMPELRAALGVEEA"
     misc_feature    182455..184020
                     /locus_tag="LILAB_00765"
                     /note="3-(3-hydroxyphenyl)propionate hydroxylase;
                     Validated; Region: mhpA; PRK06183"
                     /db_xref="CDD:235727"
     misc_feature    182473..183498
                     /locus_tag="LILAB_00765"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            184394..185455
                     /locus_tag="LILAB_00770"
                     /db_xref="GeneID:10874613"
     CDS             184394..185455
                     /locus_tag="LILAB_00770"
                     /note="COG2852 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663164.1"
                     /db_xref="GI:338529830"
                     /db_xref="GeneID:10874613"
                     /translation="MDGDDVRAVVSAWAAAIARERDLVGDAEAFVARSQPQGQARMLQ
                     FRGKTAHQRRVLMEGLTPPQGQSAAWELCRALLESPVSTPSGALPDVVGQAIGRAPLP
                     ALQALMAMVPAANTPALRVRSSASDFRALRTAAALCSAAPALTTGCVLSTEVLAEHLR
                     REESHALAMLREGRLDLAEPAPDEDAPEFPEAVVASTAARLRQEGSSAQVVALYESAV
                     RTIASASREANGRARSEAERFLHARLQEHAPTRGLFVLNGTLDLGDGGRALEVDLLCR
                     ALHLAVEIDGYFHFRSPDGFRRDRRKDVALQRAGYWVVRFLADDVVTRLEEILETLDT
                     LIATRRGELTGKDASNGKR"
     misc_feature    <185204..185389
                     /locus_tag="LILAB_00770"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00277"
                     /db_xref="CDD:260319"
     misc_feature    order(185207..185209,185240..185242,185246..185248)
                     /locus_tag="LILAB_00770"
                     /note="putative active site [active]"
                     /db_xref="CDD:238508"
     gene            185442..186443
                     /locus_tag="LILAB_00775"
                     /db_xref="GeneID:10874614"
     CDS             185442..186443
                     /locus_tag="LILAB_00775"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663165.1"
                     /db_xref="GI:338529831"
                     /db_xref="GeneID:10874614"
                     /translation="MGSAEQRLSGIALSWLMTRGERRGTRKELEAALRSFVEHRLSRS
                     EWKARFESLLESLLGGGTVALRGRSGLALTPTGRTAVLRFLHLDQPPRGLTWKKLKAT
                     HLVALSLDLPASKAVVARMKDADGVRAAALQRQHGLDAEEGLTLAQTRDRLLWRELGV
                     ETDRPFTLSAVQAHLLGKMLDTETKDPRKGVEQLAARAAGASRADAEAVRLSLLRRFA
                     VAQADDASEDEPEVRAAPGSEAQAAPAAFAERVLSVARDLPTGRFGANKVFISHVWKA
                     LQPEWRTREAFNAALLEANRTRLLSLTRADLVSAMDPKDVAESEVQSFGASFHFVVV"
     gene            186464..189988
                     /locus_tag="LILAB_00780"
                     /db_xref="GeneID:10874615"
     CDS             186464..189988
                     /locus_tag="LILAB_00780"
                     /note="COG0433 Predicted ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663166.1"
                     /db_xref="GI:338529832"
                     /db_xref="GeneID:10874615"
                     /translation="MANDPRLEPFLDDSREVFTSVEQGQHIWQADPYDVETLNAPARR
                     AFKRLLDKASSDSPPSAGKLLLLLGESGSGKTHLVRAFRNTAHGQRQGFVGYMPMTVD
                     VTQYDRYILSNLIDSLDKPFDEAGDDDDSGLMHLSDALMAQCTSAYALHLKDEQILEG
                     EELHGTIRVVADELLMDPRFRDVEVDLLRALIYLHRRDPRLNRRIFHWLRCESLSEAD
                     QRVIGNLIPRTADDAPARMVEHLGRLMGGLGQALVLCVDQVEDVSDFEQRPQMENSFR
                     RAMNSLAAIASKVPRAVVVFCCLTDYWMKMKPLLNRSTVDRIENDPEPVMLEATVTAD
                     TARDLAARRLQALFEQRGFTLSPSDPTWPIPADGFEVLGGHRARDVLNECRRYRDRAI
                     QDGKLPASFPLQRPQELGKPHTPAEPRHQVLKPDMDQLWTDFRATLRIDPPEEPADVA
                     ELLAWAIEAGSKELGDARRFDVKPKEKEMLDVQLHPEGSKLLIALCEKDSRGGGLGKQ
                     MTEALKKASGKTPVIVRTTDFPPARPGGVIAEQLGALLRKGGRRVVVGDTELRDLMAL
                     RTFREKHAGEAALTEWSRTARPITRLKSVGDMLGLEKPDTTPPSPGTKSPNKPAPKNG
                     GASPMGNVGARSTATKAQSELFASPRTQPDGAPLAPDVLSGAKSKPSTRAETSAREAR
                     DVREHREPAVSQGHQHGSAELLAEDPLTGITVESQMLTGRTLTPPRGLKATIGFKRNE
                     PTAASPPSARPTETLTGPMRIGTSEGVFSQIVTVEPSELTRHSAFLGTTGSGKTTLAL
                     NVLEQLLLRGIPAILVDRKGDLAAYARDLSWEEHLDDPALIERRRLLRERVEVALYTP
                     GRSDGRPLAIPVIPRGLESQSPEEREQGVQQAADAIAGMLEYKTSPNDKAARALLTQA
                     LRLLVQRPPGSELTLEMVQKFVAEQDESLRQETGGLPPKTFAKLAQDLEVLRLDLRPL
                     MATGGERLDMNELLGLGAARKPGKTRLSIISTKYLGDLNRIRFWVSQLLLEANRWTSQ
                     HPASKLQAVVLFDEADIYLPATSKPATKQPMENLLKRARSAGLGVMLGTQSPGDLDYK
                     CRENVRTWFVGGVKEDNALKKLKPMFTEARIDAETRLPGQKPGQFHVLREGKVQQLRA
                     DRSAIRTDQLSEDDILKEARRTLERSSE"
     misc_feature    186590..>186883
                     /locus_tag="LILAB_00780"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    188798..189469
                     /locus_tag="LILAB_00780"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    188801..189781
                     /locus_tag="LILAB_00780"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     gene            190454..191908
                     /locus_tag="LILAB_00785"
                     /db_xref="GeneID:10874616"
     CDS             190454..191908
                     /locus_tag="LILAB_00785"
                     /note="COG0147 Anthranilate/para-aminobenzoate synthases
                     component I"
                     /codon_start=1
                     /transl_table=11
                     /product="putative para-aminobenzoate synthase, component
                     I"
                     /protein_id="YP_004663167.1"
                     /db_xref="GI:338529833"
                     /db_xref="GeneID:10874616"
                     /translation="MSRPPSPTRFPDRTSFQAFVAQGYNQVPVVRRLPLGALRPVDLL
                     RTLPAEGRFLLESTRVSAEGRYSFLGAQPYLRFTAQGGQCFIDGTLQQGSPREVLRTL
                     LRRWRGVRHPGMPLFCGGAVGFFGYEAAHCFESLPRHPRDDLHLPEIALSFVDTFLAV
                     DHHEGHLLAVATGADWEDCERRLDTLEAHVRSATPTAPPTPPAMEGPSARYRSNFTQE
                     AYLDAVERVREYIRAGDTYQVNLSQRLEVDFPGEPLALYETLSAINPVHFASYLEGDG
                     FHVVSASPERLVRVEDGRATTRPIAGTRRRGTPEEEARFVHELRTNEKERAEHAMLVD
                     LERNDLGRVCAYGSVAVTKLMDIVEYAHVLHIESEVVGQLAPGVEPLDVVGALFPGGT
                     ITGVPKIRTMQLITELEPHARGLYTGSLGYLSFTGDLDLNIVIRTLVVKDHRAYAQVG
                     GGIVHDSQPRQEYKETLNKARSQLLALASVGRTG"
     misc_feature    190535..191887
                     /locus_tag="LILAB_00785"
                     /note="Anthranilate/para-aminobenzoate synthases component
                     I [Amino acid transport and metabolism / Coenzyme
                     metabolism]; Region: TrpE; COG0147"
                     /db_xref="CDD:223225"
     misc_feature    190571..190954
                     /locus_tag="LILAB_00785"
                     /note="Anthranilate synthase component I, N terminal
                     region; Region: Anth_synt_I_N; pfam04715"
                     /db_xref="CDD:252755"
     misc_feature    191099..191860
                     /locus_tag="LILAB_00785"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     pfam00425"
                     /db_xref="CDD:249850"
     gene            191905..192474
                     /locus_tag="LILAB_00790"
                     /db_xref="GeneID:10874617"
     CDS             191905..192474
                     /locus_tag="LILAB_00790"
                     /note="COG0512 Anthranilate/para-aminobenzoate synthases
                     component II"
                     /codon_start=1
                     /transl_table=11
                     /product="putative para-aminobenzoate synthase, glutamine
                     amidotransferase component"
                     /protein_id="YP_004663168.1"
                     /db_xref="GI:338529834"
                     /db_xref="GeneID:10874617"
                     /translation="MILVIDNFDSFTFNLVQALGAQGAELKVVRNDAITVAQVEALRP
                     DHILISPGPCTPHEAGVSMAVLRELGGRVPMLGVCLGHQCLGQVFGAKVIRAPVPVHG
                     KTAAIEHSGQGVFRGLPVPFTAARYHSLVVDTDSLPACLEVTAWQDGLIMGLRHRELP
                     RLEGVQFHPESFLTPQGPRLLANFLEPAR"
     misc_feature    191905..192459
                     /locus_tag="LILAB_00790"
                     /note="para-aminobenzoate synthase component II;
                     Provisional; Region: PRK08857"
                     /db_xref="CDD:181566"
     misc_feature    191908..192459
                     /locus_tag="LILAB_00790"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Anthranilate synthase; Region:
                     GATase1_Anthranilate_Synthase; cd01743"
                     /db_xref="CDD:153214"
     misc_feature    order(192055..192060,192064..192066,192139..192144,
                     192151..192153,192283..192294)
                     /locus_tag="LILAB_00790"
                     /note="glutamine binding [chemical binding]; other site"
                     /db_xref="CDD:153214"
     misc_feature    order(192139..192141,192406..192408,192412..192414)
                     /locus_tag="LILAB_00790"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153214"
     gene            192492..193316
                     /locus_tag="LILAB_00795"
                     /db_xref="GeneID:10874618"
     CDS             192492..193316
                     /locus_tag="LILAB_00795"
                     /note="COG0115 Branched-chain amino acid
                     aminotransferase/4-amino-4-deoxychorismate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="class IV aminotransferase"
                     /protein_id="YP_004663169.1"
                     /db_xref="GI:338529835"
                     /db_xref="GeneID:10874618"
                     /translation="MFSTVAVNGEVRRWEDLPLRDFAQGFFFGAGFFTTFRIEAGRPW
                     FLARHLARLRASLDAFPGAVRPPPPEHLTEDAVRESLQRCLRADAALGPAFQGVGKLS
                     ASDGRVLLTFRAHSPDLERLHHEGRALDSQEPGAYRRGDPTLNHKGLSYFRQYRVMER
                     LPLLGNEAGEVCELPTANVFVQWDGALVTPPLSAPCLPGIIREVLLEAGHVGPLPVLE
                     RPVPFARLSQASACVFTNAAQVATGVPSLLGRALPDSLALAHDLRRLVEGIAARER"
     misc_feature    192621..193286
                     /locus_tag="LILAB_00795"
                     /note="Aminotransferase class IV; Region: Aminotran_4;
                     pfam01063"
                     /db_xref="CDD:250334"
     misc_feature    order(192645..192647,192930..192932,193008..193010,
                     193089..193094,193200..193202)
                     /locus_tag="LILAB_00795"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    order(192645..192647,192930..192932,193008..193010)
                     /locus_tag="LILAB_00795"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    order(192666..192668,192765..192767,192819..192821,
                     192936..192938,192948..192950,192954..192956,
                     192966..192968,192987..192989)
                     /locus_tag="LILAB_00795"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238254"
     misc_feature    192930..192932
                     /locus_tag="LILAB_00795"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            complement(193322..194884)
                     /locus_tag="LILAB_00800"
                     /db_xref="GeneID:10874619"
     CDS             complement(193322..194884)
                     /locus_tag="LILAB_00800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663170.1"
                     /db_xref="GI:338529836"
                     /db_xref="GeneID:10874619"
                     /translation="MDVSAARERGGISARAFSLGVFGVTAAFGLFCLGLQYTPDSLHY
                     LSVARGLLSGSGLSGTLLAVDTAAPRPLDLWPPLFPMAWAALLWLGPDAAVITLHLLC
                     FAVLAGALFSMAPAGQGARYLWTCAVLIILYRPFGHVAAAAWSEPLCVALLALALARE
                     VRGADGAGRSFLVGALLGLAVLTRYAALFVVPGLLSWRFVWAREAGGPWRRHVVNAVA
                     LGAGLGLVVAPWFIRNVALFGQALGPPRAPRGAGLVASLLSGVETLLGDASFGAFGVL
                     CVAATVWLLLPALRGVKGALPPDDALARLRPAALMAVSYVAGLFWSATRTQMDTLDGR
                     LLAPLGVGLLPVTAAVLVALVERSRLMSAPVLVATGVVVVAGHLWAPLHARVRQPRQG
                     FHHLRERIAPVPAWVEAHVTERDLLLGPQLWWVHPFSRAPVVADGYPERGFLTLQTLG
                     PYLREHGAAYERFFWLGTQPPPVDAASFEVVEVARLETNAYWSTVWNAVWEIRPAGRV
                     TPMDRHKARPAP"
     misc_feature    complement(<194012..194659)
                     /locus_tag="LILAB_00800"
                     /note="4-amino-4-deoxy-L-arabinose transferase and related
                     glycosyltransferases of PMT family [Cell envelope
                     biogenesis, outer membrane]; Region: ArnT; COG1807"
                     /db_xref="CDD:224720"
     gene            complement(194896..195063)
                     /locus_tag="LILAB_00805"
                     /db_xref="GeneID:10874620"
     CDS             complement(194896..195063)
                     /locus_tag="LILAB_00805"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663171.1"
                     /db_xref="GI:338529837"
                     /db_xref="GeneID:10874620"
                     /translation="MDGQVQRLEAPMLALGFHGSDAEGVGTVFERHLPKRDVAEGAWR
                     LLTDGGRGRHV"
     gene            195329..195667
                     /locus_tag="LILAB_00810"
                     /db_xref="GeneID:10874621"
     CDS             195329..195667
                     /locus_tag="LILAB_00810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663172.1"
                     /db_xref="GI:338529838"
                     /db_xref="GeneID:10874621"
                     /translation="MGQAGKEQAKQLGSAAKERVYHQVESRRGDLAKGIRGFVSTLES
                     LSDRDEAKVARPLLGGAAGLLRRTSERLENETTDELLADAQSRVRERPGLFIAGCVAA
                     GFALGRLIKA"
     gene            195682..196110
                     /locus_tag="LILAB_00815"
                     /db_xref="GeneID:10874622"
     CDS             195682..196110
                     /locus_tag="LILAB_00815"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663173.1"
                     /db_xref="GI:338529839"
                     /db_xref="GeneID:10874622"
                     /translation="MEPTIPHQGADGFGALFSEFTAQARRLVRAEVSLARTELRAEAR
                     KASAGARLLAGGGVVLLLGALTFVAFLVAVLAEALPLWASALIVAVVLLAVGGGVAWS
                     GLQRMKQVHGPERTIQTLKEDGQWASRTAHAMKSQIHGHA"
     misc_feature    195721..196062
                     /locus_tag="LILAB_00815"
                     /note="Protein of unknown function (DUF1469); Region:
                     DUF1469; pfam07332"
                     /db_xref="CDD:254159"
     gene            196107..197069
                     /locus_tag="LILAB_00820"
                     /db_xref="GeneID:10874623"
     CDS             196107..197069
                     /locus_tag="LILAB_00820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663174.1"
                     /db_xref="GI:338529840"
                     /db_xref="GeneID:10874623"
                     /translation="MSHLADELARRAEPDRLKALASEKAAALKERAREVATHKATELT
                     QHAKEAAVEKATELKTQARETVMQRSMELKERADTPKGWSLLGALVGAGVGSALMRKA
                     FTRRAARQYDESDGGRDERWRYDGPRAGRDDLRSTREEALGAGIGGIPERRAGGEEAL
                     AGMRASASDKAHEVKGRAADKATELRERTTDVVHKARERASHMRERVPSREDVQHRAS
                     DWFDRTADEQPLLLAVGGITLGMLASTLLPVTGQERKLVEPAKRRAKEGVSQLGGQLH
                     EKLQGEEQPASGGAGGPALAPSDASSVSARRVETTRQEDSRETH"
     misc_feature    <196119..>196700
                     /locus_tag="LILAB_00820"
                     /note="MAEBL; Provisional; Region: PTZ00121"
                     /db_xref="CDD:173412"
     STS             197065..197832
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            197207..198466
                     /locus_tag="LILAB_00825"
                     /db_xref="GeneID:10874624"
     CDS             197207..198466
                     /locus_tag="LILAB_00825"
                     /note="COG2966 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663175.1"
                     /db_xref="GI:338529841"
                     /db_xref="GeneID:10874624"
                     /translation="MCAAVAVPPELLTAASHPPPPGAAVAFTIRLGEALHRYGTPAHR
                     LELLMQRVSERFGLEGRFFSTPTSIFSSFGPPEALRTSLVRVEPGDMDLERLALLDSL
                     ADDVIHGQVPPAEGAQRVEAILAQPDRFGPALQLLCWTLAGGAAGRLFGGGLKEMAVA
                     AFSSLLIGALGVLTRKQPTTARVLEPVAAILSSAVAAVAASLMGPLSAQVATLAGLIV
                     LLPGLSLTVAINELATRNLISGTSRLTAAALVFLQLGFGVALGSRLSLVLPAPPVAPL
                     PPAPPDWTQLPMLLVAIFAVCVLFRARPWDWGWIAGACTFAFAGARLGSLLLGAQLGA
                     FVGSLLLAMGSNALARLRNKPSITTLVPGLMLLVPGSVGFRSLSSLLERDVVAGVDTA
                     FSMLMVAVALVAGLLSANALVPTRKVL"
     misc_feature    197279..197977
                     /locus_tag="LILAB_00825"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2966"
                     /db_xref="CDD:225514"
     misc_feature    197297..197872
                     /locus_tag="LILAB_00825"
                     /note="Protein of unknown function (DUF1212); Region:
                     DUF1212; pfam06738"
                     /db_xref="CDD:253886"
     misc_feature    198062..198457
                     /locus_tag="LILAB_00825"
                     /note="Protein of unknown function (DUF3815); Region:
                     DUF3815; cl01118"
                     /db_xref="CDD:260795"
     gene            complement(198481..198897)
                     /locus_tag="LILAB_00830"
                     /db_xref="GeneID:10874625"
     CDS             complement(198481..198897)
                     /locus_tag="LILAB_00830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663176.1"
                     /db_xref="GI:338529842"
                     /db_xref="GeneID:10874625"
                     /translation="MPPFDSTPFTVWLLQALCAVFLAILFLQSGLDKVIDWKGNLGWL
                     TGHFAKSPLRGVVPLMLATITLLELAAGALSAAGLVALVATGSAALAFWGALLSAVSL
                     VALFFGQRMAKDYAGAGGLVPYFLLTLVAVYVTRLG"
     gene            199046..200209
                     /locus_tag="LILAB_00835"
                     /db_xref="GeneID:10874626"
     CDS             199046..200209
                     /locus_tag="LILAB_00835"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663177.1"
                     /db_xref="GI:338529843"
                     /db_xref="GeneID:10874626"
                     /translation="MFTGLIILSIILLALVVRPLAKAFFLAAVLAGTFYGLYSRLSRK
                     LRGRHSLAAGVIVSGVILALLLPLGGLTAFVVTEVSDGVKFVSDTVQREGVEGLIGKL
                     PGPVRSAVDGLLERVPLEQAELDETLQQQVSSQGGTAARAVTGVVAATGSIAFQTVMM
                     LIALFFLLTDGAKLVGWLESVSPLRRGQTGEILREFRGVSVAVLVSSVATAGVQAAAA
                     LVGFLIARVPASLFFAGVAFFMALIPAVGAAIVVLVAAALMFFSGHPWAALFLVIWGT
                     VVVGLVDNVVKPLLAKRGMHQHGAIVFFALLGGLAAFGTVGLLLGPLIVAFFLALVRI
                     YERDYGRPTPRPGDPSTPGGQGSGEESPIIRPSTLPAESSERAPLSPTPPERH"
     misc_feature    199091..200056
                     /locus_tag="LILAB_00835"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     gene            complement(200286..201953)
                     /locus_tag="LILAB_00840"
                     /db_xref="GeneID:10874627"
     CDS             complement(200286..201953)
                     /locus_tag="LILAB_00840"
                     /note="COG3568 Metal-dependent hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="YP_004663178.1"
                     /db_xref="GI:338529844"
                     /db_xref="GeneID:10874627"
                     /translation="MLAVLAACGGEDLAGGPEGLDGADVGQRQDALGEVRLRLLAANT
                     SSGNGQDYDPGHGIRIFQGTDADIVMIQEFNYRSNSAADLRSFVDTAFGTQFHYYREG
                     GAQIPNGIISRYPIIASGEWDDPYVSNRDFAWARIDVPGPKDLWAISVHFLTTSSGNR
                     NSEASSLVSRIRANIPAGDYLVVGGDLNTGSRNESTFSTLSQVVRTAGPHPVDKNGNG
                     NTNAGRNRPYDHVLVDADLYAHQTSVVIGGSTFTNGLVVDTRVYSPLSDISPALYGDS
                     AASGMQHMAVIKDFLIPGDGASGDDASVTVTAPNGGESWAAGSVRNITWTSTGVTNVK
                     LEYSLNGSTWSTLAASTSAAAGSYAWTVPSSATTTARVRISDASNASVSDTSNAAFSI
                     TTAPSGGTGKVLINEVMVNEPGSSVAGEFVELVNTGTGAVDLSGWTVSDAVSVRHTFP
                     SGTSLAAGGVIVVFGGAAGIPSGTPSAVTASTGTLGLSNSGDTVTVKSATGAVVESAV
                     LSSGVSGTDGVSANRNPDLGATAAFVLHSTLSSLKSSPGRRVTGAAF"
     misc_feature    complement(201216..201836)
                     /locus_tag="LILAB_00840"
                     /note="Endonuclease/Exonuclease/phosphatase family;
                     Region: Exo_endo_phos; pfam03372"
                     /db_xref="CDD:251907"
     misc_feature    complement(order(201267..201269,201390..201392,
                     201396..201398,201501..201503,201735..201737,
                     201825..201827))
                     /locus_tag="LILAB_00840"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    complement(201735..201737)
                     /locus_tag="LILAB_00840"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    complement(order(201390..201392,201501..201503))
                     /locus_tag="LILAB_00840"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     misc_feature    complement(200433..200768)
                     /locus_tag="LILAB_00840"
                     /note="Lamin Tail Domain; Region: LTD; pfam00932"
                     /db_xref="CDD:250237"
     gene            complement(202178..202714)
                     /locus_tag="LILAB_00845"
                     /db_xref="GeneID:10874628"
     CDS             complement(202178..202714)
                     /locus_tag="LILAB_00845"
                     /note="COG1238 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663179.1"
                     /db_xref="GI:338529845"
                     /db_xref="GeneID:10874628"
                     /translation="MLKRVRAGGGHGRLGPPTFAPLMPDPSVLATWGLPGLFLLAMLA
                     GSIVPVPSEALLAALVYGGTSPATAVLIATTGNVLGALSLYVLGRWVAAGGGGALGRW
                     YARRREREGPRLQRVEAWTRTWGAPVLVMSWLPVVGDAFVIAGGMLGVRLLPFVFFVT
                     VGKGLRYLAVALSAAAAL"
     misc_feature    complement(202214..202618)
                     /locus_tag="LILAB_00845"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG1238"
                     /db_xref="CDD:224159"
     gene            202872..204029
                     /locus_tag="LILAB_00850"
                     /db_xref="GeneID:10874629"
     CDS             202872..204029
                     /locus_tag="LILAB_00850"
                     /note="COG0426 Uncharacterized flavoproteins"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase family protein"
                     /protein_id="YP_004663180.1"
                     /db_xref="GI:338529846"
                     /db_xref="GeneID:10874629"
                     /translation="MSSTVAPVPSPSQSSDLRLVPVEIAPETFWVGKREPGNIFYANP
                     YLLRFRGTDKKTQRPTEFNLLVDPGSSSDFSTIHTKVTSLIGGMDRLSAMFINHQDPD
                     VGSSASIISARYAPRAGLLCSEDTWRLIVHQNLPRHRFIPTEKFAQGLSVPTGHRLLP
                     VPSPFCHFRGAVMLYDPQTRVLFTGDLFGGLTDSNARGLWADESDWAGIRAFHQIYMP
                     VNAALQRTVAAIRKLEPGVDIIAPQHGRIIRGPLVQQFLERMEKLQVGLDIMDEAQDK
                     THLQAWNAVLDRVLALARGYLGDSVEAKLAASQELSDTSQYDGARLVVTRLGKWTLEH
                     VVDLLCHGEPPEIAGPIIVEATSAAAEYNLPTPHLDIEGVGAPSHVSLLDP"
     misc_feature    202935..>203627
                     /locus_tag="LILAB_00850"
                     /note="Uncharacterized flavoproteins [Energy production
                     and conversion]; Region: FpaA; COG0426"
                     /db_xref="CDD:223503"
     misc_feature    203058..203603
                     /locus_tag="LILAB_00850"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            204067..205260
                     /locus_tag="LILAB_00855"
                     /db_xref="GeneID:10874630"
     CDS             204067..205260
                     /locus_tag="LILAB_00855"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_004663181.1"
                     /db_xref="GI:338529847"
                     /db_xref="GeneID:10874630"
                     /translation="MHSTDDEDRVAYLGGAALEPQPRVTPPPAIVKPPPRADFPPAPP
                     RAETPPEAAFRPVTPPPALSLGETLRPVTPMSPHGTLLQGIAVPAPSSVMRGLVPGQT
                     VAQRYRVERWLGAGGSSTVYEATDLRQDVRVALKVLAVPHADDALVARFHQEVEHARA
                     LEHVNILRVFDAGVDGERHFLTVELLDGVDLRQRLLERRATLAEALRWLTHATVALEH
                     AHGRGVLHRDVKPANLFITRTGVLKLMDFGLAKSTHVMGTTAQGAVLGTPEYMAPEQV
                     TGNPAVSPATDLYALGVVAYELFTGQLPFRHPEPVPLMFLHVQERPAPPRTLRPDLPE
                     PFERVVLKLLEKRPEDRYRTATELRSALARLWPRALQGPAPTLAAPAPPRASLRTPDP
                     GGHTG"
     misc_feature    204385..205140
                     /locus_tag="LILAB_00855"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    204403..205140
                     /locus_tag="LILAB_00855"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(204403..204417,204427..204429,204466..204468,
                     204472..204474,204565..204567,204613..204624,
                     204634..204636,204640..204642,204748..204750,
                     204754..204756,204760..204765,204769..204771,
                     204802..204804,204811..204813,204862..204873)
                     /locus_tag="LILAB_00855"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(204403..204417,204427..204429,204466..204468,
                     204472..204474,204565..204567,204613..204624,
                     204634..204636,204748..204750,204754..204756,
                     204760..204765,204769..204771,204802..204804)
                     /locus_tag="LILAB_00855"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(204415..204417,204634..204636,204640..204642,
                     204748..204750,204754..204756,204760..204762,
                     204811..204813,204862..204873)
                     /locus_tag="LILAB_00855"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(204799..204819,204862..204873)
                     /locus_tag="LILAB_00855"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(205399..206772)
                     /locus_tag="LILAB_00860"
                     /db_xref="GeneID:10874631"
     CDS             complement(205399..206772)
                     /locus_tag="LILAB_00860"
                     /note="COG0477 Permeases of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_004663182.1"
                     /db_xref="GI:338529848"
                     /db_xref="GeneID:10874631"
                     /translation="MDGSGVTAEPMVSARPGVARRTATGAVLLALVVSAFEGTVVTSA
                     MPTITRELGGQHLYSWVFSAFLFASTVGVLISGKLADRLGRKPVFFAGMGLFLVGSAL
                     CGLADSVPGLIAFRVIQGLGAGALQPTTLTISADLYTLRERAAVQGLFTGAWGAGNVV
                     GPLIGGWLVMHATWRWVFLVNVPVGLFAAALLYLSYRDPPRRPEVRMDRWGPVLAGSS
                     AALLLFSLEPGAASLRWACALAAAGAGWLLVRQQRTTAAPLLPAELLRDRAVLCGVAG
                     GMAGGALLYSMAAWVPLWMTEQGGHTPLAAGLALLPMLLGWSVGSTFGVKLLVRGGMR
                     LSAGVGFAVAALGAGWLSLAAARGWGVPAALVGLAVLGLGLGPAASTSLIGPQSRAPW
                     HHRGIVTSALYATRLLGGSLAVAVLALASGHFAVQFGLAAGLTAVAALGLALLAPGRT
                     EPTVSGA"
     misc_feature    complement(<206182..206697)
                     /locus_tag="LILAB_00860"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(205534..206694)
                     /locus_tag="LILAB_00860"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(206299..206301,206317..206322,
                     206329..206334,206368..206370,206377..206382,
                     206389..206394,206401..206406,206542..206547,
                     206551..206556,206566..206568,206575..206580,
                     206587..206589,206635..206640,206644..206652,
                     206659..206661))
                     /locus_tag="LILAB_00860"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            206843..207778
                     /locus_tag="LILAB_00865"
                     /db_xref="GeneID:10874632"
     CDS             206843..207778
                     /locus_tag="LILAB_00865"
                     /note="COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004663183.1"
                     /db_xref="GI:338529849"
                     /db_xref="GeneID:10874632"
                     /translation="MTSEQLRAFLEVARAGRLATAARGLGLSQSGLSRQLQSLEAALG
                     ARLLVRTPGGAVLTDAGERFLPHARRALDALTAGTSELERLSGTPHGVVSLGTLHTVG
                     AYLLPDIIPAFARQYPEVRPRLSEGLAPTLEEGVARGGLDLAILSLPVRRADLVAQRL
                     WEEPLVLAVPRGHRLTKAGRPLALEDAVEEPWVVIPGMSGTRALEAACEARGVTPRLA
                     LETDNAEAMRRMVERGLGMAVVPQLMARDHRAQGFDVVPLERGGLKRQVALIHRGEGY
                     LTAAARALKAFIVERVRAMPEPWGTRKAAPGPRVR"
     misc_feature    206843..207736
                     /locus_tag="LILAB_00865"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    206852..207028
                     /locus_tag="LILAB_00865"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    207119..207706
                     /locus_tag="LILAB_00865"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(207161..207166,207170..207175,207182..207184,
                     207194..207196,207200..207220,207494..207511,
                     207527..207532,207536..207541)
                     /locus_tag="LILAB_00865"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            207811..208191
                     /locus_tag="LILAB_00870"
                     /db_xref="GeneID:10874633"
     CDS             207811..208191
                     /locus_tag="LILAB_00870"
                     /note="COG3070 Regulator of competence-specific genes"
                     /codon_start=1
                     /transl_table=11
                     /product="TfoX domain-containing protein"
                     /protein_id="YP_004663184.1"
                     /db_xref="GI:338529850"
                     /db_xref="GeneID:10874633"
                     /translation="MARTDSFVEYTLELLEKVGPLQARAMFGGWGIYAAGRMFGLIAG
                     GQLYLKVDEVTKPDFQAAGCRPFVHDTAARPVEMGYWTPPADAADDAYALLPWARRAV
                     DAANRAALKKAAKKPRAKKRVKPS"
     misc_feature    207847..208119
                     /locus_tag="LILAB_00870"
                     /note="TfoX N-terminal domain; Region: TfoX_N; pfam04993"
                     /db_xref="CDD:147262"
     gene            complement(208178..209827)
                     /locus_tag="LILAB_00875"
                     /db_xref="GeneID:10874634"
     CDS             complement(208178..209827)
                     /locus_tag="LILAB_00875"
                     /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding domain-containing protein"
                     /protein_id="YP_004663185.1"
                     /db_xref="GI:338529851"
                     /db_xref="GeneID:10874634"
                     /translation="MAHSPVPSYAHGTSATPLLGETIGQNLRRTVERHGDREALVVAS
                     QGYRVTYQRLWALTTQVARGLMALGVQKGDRVGLWSPNRFEWVAIQYATARIGAILVN
                     LNPAYRTSELEYALNQSGGKVLLYARGFRQTDYRAMVREVQPRCTGLERALVLEDDWQ
                     GLLDGGKDVSEDALAAREASLQFDDPINIQYTSGTTGFPKGATLSHHNVLNNGFFIGE
                     ALRYGPEDRVCIPVPFYHCFGMVIGNLACTSHGATMVIPAEAFDPLTVLQTVQAERCT
                     SLYGVPTMFIAELDHPRFGEFDLSTLRTGVMAGSPCPVEVMKQVQSRMHMREVTICYG
                     MTETSPVSTQSALDEPLDKRVSTVGRVHPHLEVKVIDAGTGEVVPRGAPGELCTRGYS
                     VMLGYWANPEATAAAVDAAGWMHTGDLAVMDEEGYVKVVGRIKDTIIRGGENISPREV
                     EEFLHTHPGVSETQVIGVPSQKYGEEVMAWVRVKPGAALTGEELTRFCSGRIASFKIP
                     RYWKFVDAFPMTVTGKVQKFKMREASVAELGLEDAAAIKTA"
     misc_feature    complement(208196..209809)
                     /locus_tag="LILAB_00875"
                     /note="AMP-binding domain protein; Validated; Region:
                     PRK08315"
                     /db_xref="CDD:236236"
     misc_feature    complement(208235..209278)
                     /locus_tag="LILAB_00875"
                     /note="Uncharacterized subfamily of fatty acid CoA ligase
                     (FACL); Region: FACL_like_2; cd05917"
                     /db_xref="CDD:213284"
     misc_feature    complement(order(209228..209233,209237..209254,
                     209261..209263))
                     /locus_tag="LILAB_00875"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213284"
     misc_feature    complement(order(208256..208258,208496..208498,
                     208529..208531,208538..208540,208574..208576,
                     208820..208837,208901..208906,209252..209254))
                     /locus_tag="LILAB_00875"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213284"
     misc_feature    complement(order(208313..208315,208496..208507,
                     208529..208531,208538..208540,208574..208576,
                     208820..208837,208901..208906,208967..208969,
                     208976..208981,208985..208987,209129..209134,
                     209252..209254))
                     /locus_tag="LILAB_00875"
                     /note="putative active site [active]"
                     /db_xref="CDD:213284"
     misc_feature    complement(order(208313..208315,208331..208333,
                     208499..208507,208904..208906,208967..208969,
                     208976..208981,209132..209134))
                     /locus_tag="LILAB_00875"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213284"
     gene            210035..210880
                     /locus_tag="LILAB_00880"
                     /db_xref="GeneID:10874635"
     CDS             210035..210880
                     /locus_tag="LILAB_00880"
                     /note="COG1045 Serine acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine O-acetyltransferase"
                     /protein_id="YP_004663186.1"
                     /db_xref="GI:338529852"
                     /db_xref="GeneID:10874635"
                     /translation="MDDSNARLVTALLEARQRHCFPADVRRAAPEFVGQVLGLLFPHF
                     AERLECTAAAVHRDVTTVEASLHRIRDTLAPLYPGIEPDLPARFMERLPGLYEWLRQD
                     ADAIFEADPAARTVDEVILTYPGFTAIAIYRVANALHVLGFPLLPRLLTEYAHQRTGV
                     DIHPGATIGRRFVIDHGTGVVIGETTLIGDNVKLYQGVTLGALVVEKGLTDKKRHPTI
                     EDDVVVYANATILGGETVVGRGSIIAGNAWLTQSIPSQSVVTRRSEVRQRGADGSLDA
                     LEFHI"
     misc_feature    210329..210814
                     /locus_tag="LILAB_00880"
                     /note="serine O-acetyltransferase; Region: cysE;
                     TIGR01172"
                     /db_xref="CDD:200082"
     misc_feature    210506..210814
                     /locus_tag="LILAB_00880"
                     /note="Serine acetyltransferase (SAT): SAT catalyzes the
                     CoA-dependent acetylation of the side chain hydroxyl group
                     of L-serine to form O-acetylserine, as the first step of a
                     two-step biosynthetic pathway in bacteria and plants
                     leading to the formation of...; Region: LbH_SAT; cd03354"
                     /db_xref="CDD:100045"
     misc_feature    order(210509..210511,210515..210517,210560..210562,
                     210674..210676,210767..210769,210776..210778,
                     210782..210784)
                     /locus_tag="LILAB_00880"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100045"
     misc_feature    order(210557..210562,210617..210622,210638..210640,
                     210653..210655,210674..210679,210710..210712,
                     210758..210760,210764..210769,210776..210778,
                     210782..210784,210806..210808)
                     /locus_tag="LILAB_00880"
                     /note="active site"
                     /db_xref="CDD:100045"
     misc_feature    order(210557..210562,210638..210640,210674..210679)
                     /locus_tag="LILAB_00880"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100045"
     misc_feature    order(210617..210622,210638..210640,210653..210655,
                     210710..210712,210758..210760,210764..210769,
                     210776..210778,210782..210784,210806..210808)
                     /locus_tag="LILAB_00880"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100045"
     gene            210901..211821
                     /locus_tag="LILAB_00885"
                     /db_xref="GeneID:10874636"
     CDS             210901..211821
                     /locus_tag="LILAB_00885"
                     /note="COG0031 Cysteine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="YP_004663187.1"
                     /db_xref="GI:338529853"
                     /db_xref="GeneID:10874636"
                     /translation="MKVNNILETIGNTPHVRINRLFPSRVTVHVKLERANPGGSIKDR
                     IALSMIEDAEQRGLLKKDSVIIEPTSGNTGIGLAMVAAVKGYKLVLVMPESMSIERRR
                     LMAAYGATFELTPRAQGMKGAIARANELLSQVPNSWMPQQFDNEANIEVHRRTTVQEI
                     LKDFPEGLDYLITGVGTGGHITACAEELKKVWPKLKVFAVEPTKSPVISGGQPGPHPI
                     QGLGAGFIPKNLHKEALDGAIQVAEEDAFEFTRRAAREEGIFMGISSGAALSAVNQKL
                     GEMTDGSRVLVFNYDTGERYLSIEALFPAQ"
     misc_feature    210913..211794
                     /locus_tag="LILAB_00885"
                     /note="cysteine synthase; Region: PLN02565"
                     /db_xref="CDD:166206"
     misc_feature    210931..211794
                     /locus_tag="LILAB_00885"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    order(210943..210951,210985..210987,211003..211005,
                     211009..211011,211135..211137,211144..211146,
                     211192..211197,211204..211209,211216..211221,
                     211384..211389,211660..211668,211672..211680,
                     211750..211752,211780..211782,211789..211791)
                     /locus_tag="LILAB_00885"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(211024..211026,211114..211116,211423..211440,
                     211558..211560,211690..211692,211768..211773)
                     /locus_tag="LILAB_00885"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    211024..211026
                     /locus_tag="LILAB_00885"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            complement(211833..212969)
                     /locus_tag="LILAB_00890"
                     /db_xref="GeneID:10874637"
     CDS             complement(211833..212969)
                     /locus_tag="LILAB_00890"
                     /note="COG0520 Selenocysteine lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="class V aminotransferase"
                     /protein_id="YP_004663188.1"
                     /db_xref="GI:338529854"
                     /db_xref="GeneID:10874637"
                     /translation="MTRPLESYRDLFPVLKEQLYLNHAGVAPTSLRAAEAVRGWMEDL
                     VHHGIKHERGWEAHCERVRELAARLINAEPGEIAFVRNTSHGLGLVAEGLDWRPGDEV
                     AVASSLEYPSNVYPWLHLRDRGVTVREIQTPEGGVTPEAVAAALTPRTRVVAVSSVQF
                     ATGYRTDLDAVGALCERAGVLLCVDGIQSVGCIPVDVKKSRIHFLSADSHKWMLGIAG
                     IGFVYVAREVLPRLRPVLVGWRSTTDAWNFNRSHFELRPDAGKLEEGSAAYTGIYALG
                     AALELLHEVGMDAISTRIRELLGRLETGLRGLGCDVGPAPAHRAGILTFLPPEGDARS
                     LGAWLAGRDVALSVRRGRVRLSPHFYNLPEEMDRLVELVRTYPG"
     misc_feature    complement(211848..212969)
                     /locus_tag="LILAB_00890"
                     /note="Selenocysteine lyase/Cysteine desulfurase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: csdA; COG0520"
                     /db_xref="CDD:223594"
     misc_feature    complement(order(212337..212339,212346..212348,
                     212406..212408,212415..212417,212499..212501,
                     212709..212711,212718..212723))
                     /locus_tag="LILAB_00890"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(212337..212339)
                     /locus_tag="LILAB_00890"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            213109..214791
                     /locus_tag="LILAB_00895"
                     /db_xref="GeneID:10874638"
     CDS             213109..214791
                     /locus_tag="LILAB_00895"
                     /note="COG2010 Cytochrome c, mono- and diheme variants"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytochrome c"
                     /protein_id="YP_004663189.1"
                     /db_xref="GI:338529855"
                     /db_xref="GeneID:10874638"
                     /translation="MRRPPLDALRNTLLAGATLLAGCAGTVHAPYPPIRADLSPAALE
                     RGAAIFHASCESCHRGGDAETASGAPLRELPSYMGRFYAANLTAHAEAGIGGLTDEEL
                     ARAIRYAVSRDGRLMVMPSYGMGDADLAAVLGFMRSGHPLFTPAPEPAPPSKFSFFGG
                     IGFRFITGNEPVERPASGIPVPPKAATLEYGHYMAHDVYDCASCHTDGFSPRKTEGDD
                     VFAGGMAFVDPEGRKVHSSNITFHETGLAHWTLEDFTRAVRDGLAPDGSVLRSPMPRF
                     RGMDAVEAQALYDYLRSVPHRENAVEGARPRLTATSARPDWVAETHGAETPLDGAHAQ
                     GRPDAAPASGAKHAKASEKGAAGSQAPQASSDAKASEQDAAGSQAPQASSDAPAQGSD
                     DTARQAPSQAGPGTTPVTSPAGPDVGTSPTPAPRAAADTSASPEGSNASTPSTSATRI
                     DAAPGSSKPASKPAPRRKPRPAVPQVDAAGLFVKLGCASCHAPGARYHDRLAKVATRS
                     EAELVRWVRNPEQFLPGTPMPTYAELIDEKTARALVRWVKAGGPASLTSTSR"
     misc_feature    213235..213522
                     /locus_tag="LILAB_00895"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            215042..216331
                     /locus_tag="LILAB_00900"
                     /db_xref="GeneID:10874639"
     CDS             215042..216331
                     /locus_tag="LILAB_00900"
                     /note="COG1540 Uncharacterized proteins, homologs of
                     lactam utilization protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="LamB/YcsF family/allophanate hydrolase family
                     protein"
                     /protein_id="YP_004663190.1"
                     /db_xref="GI:338529856"
                     /db_xref="GeneID:10874639"
                     /translation="MTECLLNIDLGELPGEDEQLYALAHVANIACGGHAGDDASMRRA
                     LTLCERHGTRAGAHPSYEDREGFGRRALDVTPEQLRAQVATQCGRLAKLASERRLPVA
                     YAKPHGALYHAANATPDLARAVVAGVVEALGRAVTVIGPGAGALRDAARAAGLPYARE
                     GFADRGTRPDGSLIPRGQPGAVLTDHAQARANTLRLATGDSVDTVCVHGDTPGAVELA
                     REVRATLDALALRSEPLGDGALRLVLPEGLERRATREALRALPGVLDAVITEEHACVY
                     FAPDAPPEEPRLALARLLRVPAPVAGRPLTTISVRYDGQDLNAVAERAGLTGDEVARR
                     HAAREYTVRCVGFLPGFAYLGEVDPSIAAPRLATPRTRVPALAVGIAGGRTGVYPFAS
                     PGGWNLIGTALDFTAFTPEQGSVLQLGDRVRFERVDG"
     misc_feature    215057..215716
                     /locus_tag="LILAB_00900"
                     /note="Catalytic domain of glycoside hydrolase (GH)
                     families 38 and 57, lactam utilization protein LamB/YcsF
                     family proteins, YdjC-family proteins, and similar
                     proteins; Region: GH38-57_N_LamB_YdjC_SF; cl17191"
                     /db_xref="CDD:266542"
     misc_feature    215738..216277
                     /locus_tag="LILAB_00900"
                     /note="Allophanate hydrolase subunit 1; Region: AHS1;
                     pfam02682"
                     /db_xref="CDD:251472"
     gene            216328..217212
                     /locus_tag="LILAB_00905"
                     /db_xref="GeneID:10874640"
     CDS             216328..217212
                     /locus_tag="LILAB_00905"
                     /note="COG1984 Allophanate hydrolase subunit 2"
                     /codon_start=1
                     /transl_table=11
                     /product="urea amidolyase-like protein"
                     /protein_id="YP_004663191.1"
                     /db_xref="GI:338529857"
                     /db_xref="GeneID:10874640"
                     /translation="MTGWLEITGVNAPVSVQDAGRPGQMQHGVPPGGPLVPELLALAN
                     HTVGNASGAAALEVFGRVELRARGRGVRVSVDGRAVTLPDGDRLTLPAPESTSVRYVA
                     VDGGFAVPEVLGGRGTLLVARLGGHEGRLLRAGDMLPLGEAREPVAAKAPGAALDATA
                     PIRVTLGPDTRRFEPATVATLLSGAFAVSAATDRVGMRLQGPALTHGDEGTGTSRPMV
                     RGAIQVTLSGAPIVLGPDHPTTGGYPLIATVIRADWGRLCARRPGAAVRFQEVSIDEA
                     RHAWRQYAEHFGIGTGPT"
     misc_feature    216403..217155
                     /locus_tag="LILAB_00905"
                     /note="Allophanate hydrolase subunit 2; Region: AHS2;
                     pfam02626"
                     /db_xref="CDD:251429"
     gene            complement(217224..217364)
                     /locus_tag="LILAB_00910"
                     /db_xref="GeneID:10874641"
     CDS             complement(217224..217364)
                     /locus_tag="LILAB_00910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663192.1"
                     /db_xref="GI:338529858"
                     /db_xref="GeneID:10874641"
                     /translation="MGNETKRPATYEDLMALPENMVGQIIDGELIALPRPASPHAVAH
                     SV"
     gene            217533..218780
                     /locus_tag="LILAB_00915"
                     /db_xref="GeneID:10874642"
     CDS             217533..218780
                     /locus_tag="LILAB_00915"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663193.1"
                     /db_xref="GI:338529859"
                     /db_xref="GeneID:10874642"
                     /translation="MPPTESGEPTRPARNELRTQNQTLADPLQGPRVAPGSYPSPEEI
                     RAICAMQDLVARNHAVTQSYSDLSIAMGQLLGMENANWSTFATWASKQAGVSVRGEDL
                     PKRFTDLLKRFDAITRPLTKVDDLLRKLGVPVLPLGDLGSAGNDALQDVSNAISEGNK
                     KVFEEVGQELSRFVTTFQGATQYDAAKVAQYLSEFPADKPVLEEAFGHYTQAMFETDA
                     NTKAELILMANTKVGLHEQRRLQPQIEQALDAPVKATFHGILRQTIEANINALLFPAN
                     LAGKAALKSGVVDAVLNPVVDSMASAFRRFSTEHMMKLAVPGSALSLGNDVPPPGMET
                     TLFPPHLRTIETPELRTLLRAFDKSPDSLTGSGAEDWSRLDQRMNYIIDLFRTRQSDP
                     ALFDPPFGRRGTYSVTPPAPRVA"
     gene            218830..220191
                     /locus_tag="LILAB_00920"
                     /db_xref="GeneID:10874643"
     CDS             218830..220191
                     /locus_tag="LILAB_00920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663194.1"
                     /db_xref="GI:338529860"
                     /db_xref="GeneID:10874643"
                     /translation="MSPPKIRPNVSVRPPEPREPLRPARNEVKPQAPVTPRPGTSGVS
                     RFEAPSARQQPVALNAPALPARGPSVTPGSYPTAAQVRDIAAMTDPVARNQAITQGYS
                     DLSNAMGKLLGTENANWSTFATWASKQAGVSIRGEDMPKVFTDLLKGADAVGGPLSKV
                     DDLLRKLGLPSLPLGDVASAGNQALQNVSKAIADGNKAVFEEVGQEFARFVETFQGDT
                     QYDAAKTQQYLSGFPADKPLLKEAFGHYAQAMFEKDPNKKAELMLLANNKVGLHEQTQ
                     LQPHVEKALNSPVKDTFRDVLKQGIEAQINALPFPANLAGKAALKTGVVDAALNPVVD
                     GMASVFRRVATEHMMKLAVPGGALKLGNDLPPPPGMESTLFPPHLRTIDDPELKALLG
                     QLDKSPDSLTGTGAKDWGKLDQRMNYIIDLFRSRQSDPSLFDPPFGQRGTYPVAPSAP
                     RVS"
     gene            complement(220208..221803)
                     /locus_tag="LILAB_00925"
                     /db_xref="GeneID:10874644"
     CDS             complement(220208..221803)
                     /locus_tag="LILAB_00925"
                     /note="COG3604 Transcriptional regulator containing GAF,
                     AAA-type ATPase, and DNA binding domains"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent transcription regulator"
                     /protein_id="YP_004663195.1"
                     /db_xref="GI:338529861"
                     /db_xref="GeneID:10874644"
                     /translation="MQDDFSGATDGANDARDLIELATAEGSVGDLLRRGLDWLTRVVR
                     FDLATVFLLKEGRLVSVAARGPLANAKVRQHTLQLSEFPSLRQALETRRAKAFTEEDH
                     AHGDGDPFDGVLDLPPGHSCMVVPLCAGERCYGVLSLDRAECETYPQPVVELVEVYGQ
                     MLATAIQSAEQRATFERLHRQDHEHAKLLEAQLGGDSEGILETSRSPVMRDLARRARQ
                     VAETDTPVLITGETGTGKERLARAIHRWSARADQPFVTLNCAAIPAGLLESELFGHVK
                     GAFTGATKDRAGRFQMAHGGTLLLDEVGELPFDLQAKLLRALQEKTFEPVGSDKTVRA
                     DVRILAATHVDLQQAIAQKRFREDLYYRLSVFPLRLPPLRERREDLPQLCDFLLEEQA
                     RRTGRRGMRVTPEGLTRLAAYDWPGNLRELANALERATILTRGTALGPESFDVPTRGA
                     AVVAALPEEPAPAAEGAKRGPVLTLAAVQREHIMRVLTLTRGRVYGANGAAALLGLKP
                     STLQSRMKKLGIARLEQFVVDEA"
     misc_feature    complement(220244..221770)
                     /locus_tag="LILAB_00925"
                     /note="Transcriptional regulator containing GAF, AAA-type
                     ATPase, and DNA binding domains [Transcription / Signal
                     transduction mechanisms]; Region: FhlA; COG3604"
                     /db_xref="CDD:226132"
     misc_feature    complement(221303..221725)
                     /locus_tag="LILAB_00925"
                     /note="GAF domain; Region: GAF_3; pfam13492"
                     /db_xref="CDD:257816"
     misc_feature    complement(220712..221185)
                     /locus_tag="LILAB_00925"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(221093..221116)
                     /locus_tag="LILAB_00925"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(220775..220777,220901..220903,
                     221090..221113))
                     /locus_tag="LILAB_00925"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(220898..220915)
                     /locus_tag="LILAB_00925"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(220718..220720)
                     /locus_tag="LILAB_00925"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(220250..220384)
                     /locus_tag="LILAB_00925"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; cl17420"
                     /db_xref="CDD:266671"
     gene            222251..222805
                     /locus_tag="LILAB_00930"
                     /db_xref="GeneID:10874645"
     CDS             222251..222805
                     /locus_tag="LILAB_00930"
                     /note="COG0450 Peroxiredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase C"
                     /protein_id="YP_004663196.1"
                     /db_xref="GI:338529862"
                     /db_xref="GeneID:10874645"
                     /translation="MLTVGDKIPNFKVKATVSLEKGKEFQDITNETFKGKWLVLFAWP
                     KDFTFICPTEIAEFGKKNKDFADRDAQVLGLSTDSEFVHHAWRTHHPDLKDLPFPMLA
                     DLKHELCNALGILHKEEGVALRATFIADPEGIIRHVTVNDLSVGRNVSETVRTLDALQ
                     TDELCPCNWTKGEETLTQKLAKAG"
     misc_feature    222251..222781
                     /locus_tag="LILAB_00930"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    222260..222766
                     /locus_tag="LILAB_00930"
                     /note="Peroxiredoxin (PRX) family, Typical 2-Cys PRX
                     subfamily; PRXs are thiol-specific antioxidant (TSA)
                     proteins, which confer a protective role in cells through
                     its peroxidase activity by reducing hydrogen peroxide,
                     peroxynitrite, and organic hydroperoxides; Region:
                     PRX_Typ2cys; cd03015"
                     /db_xref="CDD:239313"
     misc_feature    order(222260..222262,222395..222400,222407..222409,
                     222587..222589,222617..222619,222656..222664,
                     222668..222676,222686..222691,222710..222712,
                     222743..222754)
                     /locus_tag="LILAB_00930"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(222389..222391,222491..222496,222560..222562,
                     222566..222568,222602..222604)
                     /locus_tag="LILAB_00930"
                     /note="decamer (pentamer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(222392..222394,222401..222403,222620..222622)
                     /locus_tag="LILAB_00930"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239313"
     misc_feature    order(222401..222403,222743..222745)
                     /locus_tag="LILAB_00930"
                     /note="peroxidatic and resolving cysteines [active]"
                     /db_xref="CDD:239313"
     gene            222812..223336
                     /locus_tag="LILAB_00935"
                     /db_xref="GeneID:10874646"
     CDS             222812..223336
                     /locus_tag="LILAB_00935"
                     /note="COG2128 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase AhpD"
                     /protein_id="YP_004663197.1"
                     /db_xref="GI:338529863"
                     /db_xref="GeneID:10874646"
                     /translation="MASLEVVRSELADSHKDTRLNLQSVLEGGSLTPEQRWGTAVACA
                     FAVRNERLKEAMLNEAKKALANPEPVIEDARAAASLMAMNNVYYRFRHMIGKESYSTK
                     RAGLRMNRLAQVLTNKVDFELVCLAVSAINGCEMCMQSHEKVVLEGGLSEEQVHDAVR
                     IASVIHAAAVGLES"
     misc_feature    222818..223333
                     /locus_tag="LILAB_00935"
                     /note="alkylhydroperoxidase, AhpD family; Region: ahpD;
                     TIGR00777"
                     /db_xref="CDD:129859"
     misc_feature    222950..>223126
                     /locus_tag="LILAB_00935"
                     /note="Stage II sporulation protein R (spore_II_R);
                     Region: Spore_II_R; cl09775"
                     /db_xref="CDD:158692"
     misc_feature    223118..223318
                     /locus_tag="LILAB_00935"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     gene            223468..223944
                     /locus_tag="LILAB_00940"
                     /db_xref="GeneID:10874647"
     CDS             223468..223944
                     /locus_tag="LILAB_00940"
                     /note="COG0783 DNA-binding ferritin-like protein
                     (oxidative damage protectant)"
                     /codon_start=1
                     /transl_table=11
                     /product="Dps family protein"
                     /protein_id="YP_004663198.1"
                     /db_xref="GI:338529864"
                     /db_xref="GeneID:10874647"
                     /translation="MYRSPSPLPEKARAAIADSLNERLADGLDLHSQIKVAHWNIKGP
                     QFASLHPLFETFAVSLATHNDSIAERAVTLGGKAYGTSRHVGKTSRLPEYPQETTRDL
                     EHVKLLAERIEIYLDGLRKSRALFVENGDTDSEGLTTDIITEFEKHAWFLRASLEG"
     misc_feature    223519..223935
                     /locus_tag="LILAB_00940"
                     /note="DPS protein, ferritin-like diiron-binding domain;
                     Region: DPS; cd01043"
                     /db_xref="CDD:153102"
     misc_feature    223525..223938
                     /locus_tag="LILAB_00940"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    order(223558..223563,223573..223575,223579..223584,
                     223615..223617,223648..223650,223660..223662,
                     223669..223674)
                     /locus_tag="LILAB_00940"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(223579..223581,223615..223617,223627..223629,
                     223660..223662,223672..223674)
                     /locus_tag="LILAB_00940"
                     /note="DPS ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(223861..223863,223882..223887)
                     /locus_tag="LILAB_00940"
                     /note="ion pore; other site"
                     /db_xref="CDD:153102"
     gene            224124..224930
                     /locus_tag="LILAB_00945"
                     /db_xref="GeneID:10874648"
     CDS             224124..224930
                     /locus_tag="LILAB_00945"
                     /note="COG1894 NADH:ubiquinone oxidoreductase,
                     NADH-binding (51 kD) subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663199.1"
                     /db_xref="GI:338529865"
                     /db_xref="GeneID:10874648"
                     /translation="MRRITCLALTVLVTTACGGAPTQEEVDAARQRVERVVAASHQAR
                     GALEVLGVLPVYTCGEPRPEFLNTAVRTVRTRWACARATVEPHDSVTDRVVLTFDEGG
                     CDVHGLRVAGQAAFLYRGGEDLMEVEADLRGLTVDGHPLQAEVGYGTCGDETRLWADV
                     RGGVPGREGHTFHVDGRVGMRAGLPVIGGTSLVLDGPGELTGPDGTDRLTLTGLHYEV
                     GEYLPKEGTAVLETADGRRVEARFQPVLWRLGKAEVTVDELEPVTVPIVR"
     gene            224974..226263
                     /locus_tag="LILAB_00950"
                     /db_xref="GeneID:10874649"
     CDS             224974..226263
                     /locus_tag="LILAB_00950"
                     /note="COG0436 Aspartate/tyrosine/aromatic
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="class I aminotransferase"
                     /protein_id="YP_004663200.1"
                     /db_xref="GI:338529866"
                     /db_xref="GeneID:10874649"
                     /translation="MSDDVSLPAFRAVPRTGVIFVTAEATRRGYRSSDPEWCNLGQGQ
                     PETGDLPGAPPRLNQVTIDVADMEYAPVAGLWEVRESIASLYNRLYRRGLPSQYSAEN
                     VCLSGGGRAALTRAAASLGAINLGHFLPDYTAYEELLDVFKAFTAIPILLEGERGYAF
                     TAEDLRREVQGRGLSALLFSNPCNPTGKLVHGEEMARWVSVAREHECTLLVDEFYSHY
                     IWTGRPGHLPVESAARYVEDVNKDPVVLFDGFTKNWRYPGWRMTWTVGPRQVIEAVSS
                     AGSFLDGGGSRPLQRAAIPLLQEEPVVKETLAIHNAFREKRDRFHSRLERIGIRTDRA
                     PDGTFYVWGNVSGLPAPLNDGMGFFRAALEQKIIAVPGEFFDVNPGKRRARPSRFRGY
                     VRLSFGPSMETLDKALSRLEDLVLHYSRTPGKPQPAP"
     misc_feature    225088..226230
                     /locus_tag="LILAB_00950"
                     /note="Aspartate/tyrosine/aromatic aminotransferase [Amino
                     acid transport and metabolism]; Region: COG0436"
                     /db_xref="CDD:223513"
     misc_feature    225088..226212
                     /locus_tag="LILAB_00950"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(225295..225303,225367..225369,225523..225525,
                     225616..225618,225718..225720,225724..225729,
                     225751..225753)
                     /locus_tag="LILAB_00950"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(225304..225306,225397..225399,225595..225597,
                     225745..225753,225838..225840,225847..225849)
                     /locus_tag="LILAB_00950"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    225727..225729
                     /locus_tag="LILAB_00950"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(226313..226918)
                     /locus_tag="LILAB_00955"
                     /db_xref="GeneID:10874650"
     CDS             complement(226313..226918)
                     /locus_tag="LILAB_00955"
                     /note="COG0500 SAM-dependent methyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663201.1"
                     /db_xref="GI:338529867"
                     /db_xref="GeneID:10874650"
                     /translation="MKRMMGVLMLTVGVAASAAGVSTAQQNVTVQVRGASGSAVRAPE
                     VPFVPTPEGAVEGMLALAGVKPGDTVYDLGSGDGRIVISAVQKHGAKRAVGVDINPER
                     ISEANQNASQAGVKNKVEFRQGDLFDADIGDASVVTLYLLPSVNERLKPKLLAELKPG
                     TRIVSHSFDMGDWAPTKTVESEGRTLYLWVVPERGTGGAPR"
     misc_feature    complement(226316..226726)
                     /locus_tag="LILAB_00955"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    complement(226427..226714)
                     /locus_tag="LILAB_00955"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(226499..226501,226541..226549,
                     226625..226630,226682..226702))
                     /locus_tag="LILAB_00955"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(226915..228357)
                     /locus_tag="LILAB_00960"
                     /db_xref="GeneID:10874651"
     CDS             complement(226915..228357)
                     /locus_tag="LILAB_00960"
                     /note="COG0531 Amino acid transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="YP_004663202.1"
                     /db_xref="GI:338529868"
                     /db_xref="GeneID:10874651"
                     /translation="MEHVTMQEQQAGDEAVKRGEGAPSPSLRVVDVMALTVGIVLGAG
                     IFKAPSLVAAQSASGEAMLLTWLLGGVASLVGALCYAELASAWPHPGGDYHYLYRALG
                     KGPAFLFAWARLTVIPTGSIALLAFVFGDYATQLFPLGPYSSPLYATALVVGLTAVNI
                     AGLRQGTRTQNLLTALEVLGVGAVIIVGLLFTPALGPAEAAPAPAASSGTAWGLAMVF
                     VLLTYGGWNEVAYLSSEVRGSRRTIAWSLLASIGLVTALYLLVNVAYLRGLGLAGMAD
                     SEAVAADLMQRAVGSGGALVLSVLIAISALTSANATVLTGARTHYAFGRDSVLFNGLG
                     RWHAKANGPSRALLVQGAITLALVGLGTLTRQGFETMVEYTAPVFWLFFLLTGVSLMV
                     LRVREPAAPRPFRVPLYPLTPLLFIGICAYVLYSSLAFTGLGALAGLAVLGTGGVLLA
                     VETARTRRATTAASPKARSSPRLQRTKEAT"
     misc_feature    complement(227005..228264)
                     /locus_tag="LILAB_00960"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: PotE; COG0531"
                     /db_xref="CDD:223605"
     misc_feature    complement(227146..228210)
                     /locus_tag="LILAB_00960"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            228578..229816
                     /locus_tag="LILAB_00965"
                     /db_xref="GeneID:10874652"
     CDS             228578..229816
                     /locus_tag="LILAB_00965"
                     /note="COG0477 Permeases of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_004663203.1"
                     /db_xref="GI:338529869"
                     /db_xref="GeneID:10874652"
                     /translation="MLCMLYFVQGLPFGFQATALPVYLRAQGASLTTIGLLGALWLPW
                     ALKALWAPLVDRYGSARIGRRKSWILPMQAGLVVTCAAAAVVASRDALLLLLAPIFLM
                     NLFAATQDIAVDGFAVDTLRPSELGLGNTAQVVGYKLGMLTGGGLLVWASARIGWPGL
                     FVAMALLCLAAFIVMLFAREVPPEPRAEPSALPARREPGWRELFQRLKAALLLPGAGW
                     LLLFITTYKLGESMSDVLFKPFLVDMGITPAQIGLWVGTWGTGASIMGSLAGGVLASR
                     MPLLGAVGLTATLRVVPLVGRWLLATGNVSDTGVIGVTMAEEFFGGALTTVMFAFMMS
                     RVDRRIGATHYTLLASLEVWGKAPAGPLAGWLADARHGLGLGYANVFLLGIGLSVVFL
                     ALLVPMRCQRHAPATALNTA"
     misc_feature    228581..229606
                     /locus_tag="LILAB_00965"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    228605..229630
                     /locus_tag="LILAB_00965"
                     /note="muropeptide transporter; Reviewed; Region: ampG;
                     cl17669"
                     /db_xref="CDD:266767"
     gene            complement(229824..230558)
                     /locus_tag="LILAB_00970"
                     /db_xref="GeneID:10874653"
     CDS             complement(229824..230558)
                     /locus_tag="LILAB_00970"
                     /note="COG0122 3-methyladenine DNA
                     glycosylase/8-oxoguanine DNA glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-3-methyladenine glycosylase"
                     /protein_id="YP_004663204.1"
                     /db_xref="GI:338529870"
                     /db_xref="GeneID:10874653"
                     /translation="MLRKIRVARGGLGGGIMATPMPRPPPDVIRHPTYYTPAVRRALT
                     RADPTLGALMKRVGPFRLQVRPLHSPFGALAESIVYQQLHGKAAATIFGRVCERVGSG
                     RKFTPEALLAVPDTSLREAGLSANKLAALQDLARKTLSGTVPPLAKVRRMDDAELIEH
                     FTQVRGIGQWTVEMLLMFQLERPDVLPVDDYGVRKGFMRAYGLPEMPKPKALLAYGER
                     WRPWRSVASWYMWRSAELPVEPPAED"
     misc_feature    complement(229833..230504)
                     /locus_tag="LILAB_00970"
                     /note="3-methyladenine DNA glycosylase/8-oxoguanine DNA
                     glycosylase [DNA replication, recombination, and repair];
                     Region: AlkA; COG0122"
                     /db_xref="CDD:223200"
     misc_feature    complement(229863..230348)
                     /locus_tag="LILAB_00970"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(230178..230180,230298..230300,
                     230307..230315))
                     /locus_tag="LILAB_00970"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(230046..230069)
                     /locus_tag="LILAB_00970"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(229866..229868,229878..229880,
                     230037..230039))
                     /locus_tag="LILAB_00970"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    complement(229989..229991)
                     /locus_tag="LILAB_00970"
                     /note="active site"
                     /db_xref="CDD:238013"
     gene            complement(230562..231050)
                     /locus_tag="LILAB_00975"
                     /db_xref="GeneID:10874654"
     CDS             complement(230562..231050)
                     /locus_tag="LILAB_00975"
                     /codon_start=1
                     /transl_table=11
                     /product="cation-binding protein"
                     /protein_id="YP_004663205.1"
                     /db_xref="GI:338529871"
                     /db_xref="GeneID:10874654"
                     /translation="MDAIELLTQQHDEVKKLFKKYEKLSDGAEAKRQGLFEMISDRLS
                     AHASIEEQYFYPAAKAQDTEDLLREAAEEHLSAKRLIADLLDLEPSDEEFDAKMQVLQ
                     EQIEHHVEEEEGELFKKVRKLLSKEQLVDLGVQMQQEFEELMEGEPRTQVPAETEHAA
                     PI"
     misc_feature    complement(<230763..231038)
                     /locus_tag="LILAB_00975"
                     /note="Hemerythrin family; Region: Hemerythrin-like;
                     cl15774"
                     /db_xref="CDD:265780"
     gene            complement(231110..232585)
                     /locus_tag="LILAB_00980"
                     /db_xref="GeneID:10874655"
     CDS             complement(231110..232585)
                     /locus_tag="LILAB_00980"
                     /note="COG0665 Glycine/D-amino acid oxidases
                     (deaminating)"
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske family iron-sulfur cluster-binding
                     protein"
                     /protein_id="YP_004663206.1"
                     /db_xref="GI:338529872"
                     /db_xref="GeneID:10874655"
                     /translation="MTAPPRDFPALPGDVTVDVAIIGGGMAGLTTAWLLKRAGKRVAV
                     LEMHRILSGQTGQTTAHLTEVLDTPYTTLKHDFGEKGARLAASSSRAAIEQIAALVEE
                     LGIDCDFQRVPMFRYAETERELAELHAEVAAAREAGLLATFTQDVPLPYPVKGAMRVE
                     DQALFHPRKYLLALADRIPGDGSHLFENTKVTEIHDGAPCRVVTERGTVTAAAVVEAT
                     TTPLNRVAMHTKLYPYRTYAVAGPLNGPLEPGQYYDSQDPYHYIRTQQVNGRPYVIVG
                     GEDHKVGTEEDTARCYAALEAYTLRRFPVTDITHRWSGQVIEPADGLAYIGRNTASRH
                     VYVATGFSGTGMTFGTLAGMILSDLILEQQNPYAALYAATRVKPQAGAKDFLQENAEV
                     AFHFVADRLARPEGHRLADVAPGEGKVLEVDGQKVAVYRAEDGTPHAVSPVCTHLGCH
                     VHWNGAERSWDCPCHGGRFSPTGKVLNGPAVKDLPAKKLPT"
     misc_feature    complement(231485..232576)
                     /locus_tag="LILAB_00980"
                     /note="putative aminophosphonate oxidoreductase; Region:
                     Phn_aa_oxid; TIGR03329"
                     /db_xref="CDD:132372"
     misc_feature    complement(231509..232534)
                     /locus_tag="LILAB_00980"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    complement(231122..231358)
                     /locus_tag="LILAB_00980"
                     /note="YhfW family, C-terminal Rieske domain; YhfW is a
                     protein of unknown function with an N-terminal DadA-like
                     (glycine/D-amino acid dehydrogenase) domain and a
                     C-terminal Rieske domain. The Rieske domain is a [2Fe-2S]
                     cluster binding domain involved in...; Region:
                     Rieske_YhfW_C; cd03477"
                     /db_xref="CDD:239559"
     misc_feature    complement(231119..>231337)
                     /locus_tag="LILAB_00980"
                     /note="Rieske Fe-S protein [Energy production and
                     conversion]; Region: QcrA; COG0723"
                     /db_xref="CDD:223795"
     misc_feature    complement(order(231185..231187,231191..231193,
                     231200..231202,231245..231250,231254..231256))
                     /locus_tag="LILAB_00980"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239559"
     gene            232839..233030
                     /locus_tag="LILAB_00985"
                     /db_xref="GeneID:10874656"
     CDS             232839..233030
                     /locus_tag="LILAB_00985"
                     /note="COG0202 DNA-directed RNA polymerase, alpha
                     subunit/40 kD subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663207.1"
                     /db_xref="GI:338529873"
                     /db_xref="GeneID:10874656"
                     /translation="MPVERMAGSASLVDVLDRVLDRGLRWDDNVRGQALQDWPPASTR
                     PIVVKFVEVRTPPPHPHGA"
     misc_feature    232848..>232931
                     /locus_tag="LILAB_00985"
                     /note="Gas vesicle protein; Region: Gas_vesicle; cl02954"
                     /db_xref="CDD:243248"
     gene            233035..235140
                     /locus_tag="LILAB_00990"
                     /db_xref="GeneID:10874657"
     CDS             233035..235140
                     /locus_tag="LILAB_00990"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory box histidine kinase"
                     /protein_id="YP_004663208.1"
                     /db_xref="GI:338529874"
                     /db_xref="GeneID:10874657"
                     /translation="MAPPVALTTPLSEPDVEARLALAEHLLACDEPRLCAQRVVDWLT
                     RQRPSDVAACLARDGGTGRWVCLAARNLSESERAALAFQPGTSTHPLAEAPHQDGPRF
                     FAAPRAPLPPGGCITLPLGRPGAPAVGLLLLSADSPTPSPDAAWVSAHFGPRLASALP
                     TLSREVAGGELLRRIIDTVVDPVLLTDLEGRPHIANARAEVLLVAGPDASEGRRRATE
                     LNQQVFSAALASFASGGASAVRRREVPLVDPVEGIDLLFEVVSTPVVEPDGREALVSV
                     LRNVTDLGRATQALGESYRRLRATEREARSERHRLDRVLDSVPDPIILSDPAGGMVMM
                     NGPAEKLFATPPDSGEDALRRLRSNNAGFASFLANLMDAEGRPRWRGQLALVNPATGA
                     TLPMEAVASKVLGDAGELTGIVTLFHDRSEALEKARLLERVKEGSVHLEARVQAATAE
                     LAEQNEMLRRQAIQVEQASAAKSQFLANMSHEFRTPLNAILGYTNMLLQGVSGELNPA
                     QKRNLTRIDSNGRHLLEVINEILDITRIEAGRMPLNLSDFGIPELFQEVMAEMDPIIA
                     RSKLTVSTELGPRVPAVYSDRQKVKQIVLNLLSNALKFTHEGSVQVRAEYVAATSTLA
                     ISVTDTGIGIDPANQEKIFDDFQQVDSSPTRAYGGTGLGLSICRRLATMLGGRVTLQS
                     TQGEGSTFTLHFPRRARRA"
     misc_feature    233578..234300
                     /locus_tag="LILAB_00990"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    233959..>234075
                     /locus_tag="LILAB_00990"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    234100..235137
                     /locus_tag="LILAB_00990"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    234439..234639
                     /locus_tag="LILAB_00990"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(234457..234459,234469..234471,234481..234483,
                     234490..234492,234502..234504,234511..234513,
                     234568..234570,234580..234582,234589..234591,
                     234601..234603,234610..234612,234622..234624)
                     /locus_tag="LILAB_00990"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    234475..234477
                     /locus_tag="LILAB_00990"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    234805..235116
                     /locus_tag="LILAB_00990"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(234820..234822,234832..234834,234841..234843,
                     234913..234915,234919..234921,234925..234927,
                     234931..234936,235015..235026,235072..235074,
                     235078..235080,235093..235098,235102..235104)
                     /locus_tag="LILAB_00990"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    234832..234834
                     /locus_tag="LILAB_00990"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(234925..234927,234931..234933,235015..235017,
                     235021..235023)
                     /locus_tag="LILAB_00990"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            235170..235547
                     /locus_tag="LILAB_00995"
                     /db_xref="GeneID:10874658"
     CDS             235170..235547
                     /locus_tag="LILAB_00995"
                     /note="COG0784 FOG: CheY-like receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_004663209.1"
                     /db_xref="GI:338529875"
                     /db_xref="GeneID:10874658"
                     /translation="MLVVDDYQDAREMYAEYLEFSGFRVAEAKNGQEALDKAFELHPD
                     IILMDLSLPIMDGWEATRRLKNDDRTRTIPVVALTGHAMTGQSDEAKGAGCDSFVTKP
                     CLPDALVDEVRRVLATHGGAQPR"
     misc_feature    235173..>235517
                     /locus_tag="LILAB_00995"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    235173..235517
                     /locus_tag="LILAB_00995"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(235182..235187,235314..235316,235338..235340,
                     235404..235406,235461..235463,235470..235475)
                     /locus_tag="LILAB_00995"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    235314..235316
                     /locus_tag="LILAB_00995"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(235323..235328,235332..235340)
                     /locus_tag="LILAB_00995"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    235470..235478
                     /locus_tag="LILAB_00995"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            235544..236389
                     /locus_tag="LILAB_01000"
                     /db_xref="GeneID:10874659"
     CDS             235544..236389
                     /locus_tag="LILAB_01000"
                     /codon_start=1
                     /transl_table=11
                     /product="GvpL/GvpF family gas vesicle protein"
                     /protein_id="YP_004663210.1"
                     /db_xref="GI:338529876"
                     /db_xref="GeneID:10874659"
                     /translation="MKRTMPRTTRPRKGAARGGKRAPQAARPPPPEPEPVTPDGPRYL
                     YGIVRATAALELGRIGVGTVPTQVYALHESGLAALVSEAPGRVVDPTRAHLLGHQRVT
                     EHLLREHTVLPAAFGTVLASEAQVRDLLRTAHDALAGVLEALEGKVEMGLKVLWHREH
                     LVQRLLLEDAQLARRDDEPEAEHEQRLASAVEDRAGRDMRALLEGLRPRAVALREHPP
                     VGERMLLNAAFLVERTGLESFEEKVRSLAARSDTYAFRFTGPWAPYSFVDVRLGPRDE
                     DAVGT"
     misc_feature    235655..236356
                     /locus_tag="LILAB_01000"
                     /note="Gas vesicle synthesis protein GvpL/GvpF; Region:
                     GvpL_GvpF; pfam06386"
                     /db_xref="CDD:253698"
     gene            complement(236411..237529)
                     /locus_tag="LILAB_01005"
                     /db_xref="GeneID:10874660"
     CDS             complement(236411..237529)
                     /locus_tag="LILAB_01005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663211.1"
                     /db_xref="GI:338529877"
                     /db_xref="GeneID:10874660"
                     /translation="MKVRDLALQGALAAAALVAAFVVWQREPSAGPGEVTVVDVPVRA
                     LDSIRYEDDTRFVDVFRDASARDQLWVRLGSKSPRPGSGGAKDGAKDGATDAGSGDAG
                     TATAAVEPDAGPGAAAPAQSPVAAREAPPPPRELRANEVADKLFSRFAPMRAMRALGE
                     LDAKKLEEVGLATSPRKLTLTVGGKARVFALASPVGGWGTPYLRSEEDGRVYLLGPAM
                     LPDLENASSRLVDRRLHTFDLGDFDAVSIRAGGITRAFRATGKAPGPVALAPEEAPEQ
                     PDDFARNWHDRVWRMMPLDLLGRDEAPPGGEPQEAFRVEYLRAGRPVGHVTVAKAEDG
                     YYARTEHTSGWARLHSGMDALAEEAARVTAPVSSASGK"
     misc_feature    complement(236684..237133)
                     /locus_tag="LILAB_01005"
                     /note="Domain of unknown function (DUF4340); Region:
                     DUF4340; pfam14238"
                     /db_xref="CDD:258428"
     gene            complement(237526..239361)
                     /locus_tag="LILAB_01010"
                     /db_xref="GeneID:10874661"
     CDS             complement(237526..239361)
                     /locus_tag="LILAB_01010"
                     /note="COG3225 ABC-type uncharacterized transport system
                     involved in gliding motility, auxiliary component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663212.1"
                     /db_xref="GI:338529878"
                     /db_xref="GeneID:10874661"
                     /translation="MTLAFVAALLAVFIGERIFGIGTGRTVLSSLGVAVAVGALGWRL
                     TRMRSASADRRAVEAWVSGLYGVGLLALGLYFLQSDAGSALFGGPLSQKAPRLAVSLA
                     ALFPALLACCLLPLAMVEVAAAAMTRAPLLETGRVRSALYSGLGLAFVLIFAFASMFV
                     ATQVDVTWDLSYFRTAKPGDGTRKVIRGLNEPLQVTLFFPPANEVGEAVGQYFRDLAV
                     ESPGLLNVERLDQAVEPVRARSLGVHSNGTVVLARGDRKEPLTVGLEIERARGQLQRL
                     DQEVQRRLLTVARPRRVVYFTAGHGERAESRAVPGETMRPSVEKLKELLRAQNVDVRP
                     LGVSEGLGTEVPRDAAVVVVAGPTQAFLPEELNALSEYAARGGRLWLALEPDGPDLQP
                     LLEPWGLKFLKTPLANDQVYFRTSRKQSDRGNLGTATFSSHPSVTSLSSLAGQMPTVF
                     VSAGALEQLQPLPGGIAQNVSVRAHGATFADANGNFTLDAGETRRPWPLVIAVEKPAP
                     AGQEAMRAVVMADADAVGDLLLGNMGNAYLALDTLRWLTGEESISGAVSSEEDTPILH
                     TREQDVLWFYATVFLGPALVLAVGFVTTRRRGRRAPRPAVAGGER"
     misc_feature    complement(238138..238863)
                     /locus_tag="LILAB_01010"
                     /note="ABC-type uncharacterized transport system; Region:
                     ABC_transp_aux; pfam09822"
                     /db_xref="CDD:255585"
     gene            complement(239391..240113)
                     /locus_tag="LILAB_01015"
                     /db_xref="GeneID:10874662"
     CDS             complement(239391..240113)
                     /locus_tag="LILAB_01015"
                     /note="COG1277 ABC-type transport system involved in
                     multi-copper enzyme maturation, permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane spanning protein"
                     /protein_id="YP_004663213.1"
                     /db_xref="GI:338529879"
                     /db_xref="GeneID:10874662"
                     /translation="MKALLIARRELSAYLRTLSGYVIIAVILALNGLFFNAYALGGAS
                     RRSAEVLSQFFYYSSGFTIVASVFISMRLLAEERQTGTLPLLYSSPLRDRDIVLGKFL
                     AGLAFLALYVACTVYMPLLVMVNGKVSFGHVAAGYLGLLLLGSASLAVGTFGSALARN
                     QLLAAITSAVMLVALILCWLLARITEQPLADVFSAMSLWNQHFPPFQAGLIHVRDVVY
                     YLVVTYVALFAATRVLEARRWR"
     misc_feature    complement(239403..240113)
                     /locus_tag="LILAB_01015"
                     /note="gliding motility-associated ABC transporter
                     permease protein GldF; Region: ABC_perm_GldF; TIGR03518"
                     /db_xref="CDD:132557"
     misc_feature    complement(239472..>239966)
                     /locus_tag="LILAB_01015"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     gene            complement(240110..241039)
                     /locus_tag="LILAB_01020"
                     /db_xref="GeneID:10874663"
     CDS             complement(240110..241039)
                     /locus_tag="LILAB_01020"
                     /note="COG1131 ABC-type multidrug transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004663214.1"
                     /db_xref="GI:338529880"
                     /db_xref="GeneID:10874663"
                     /translation="MIQVEGLTKYYGEHAAIRELAFTISQGEVIGFLGLNGAGKSTTL
                     KVLGCVLLPTSGRVVIDGHDVVSNAHEVRQRIGYLPDVPPLYDEMTVGEYLAYVAQLR
                     GVTARDTASRVGEAEEKTGLRDVHGELISTLSHGYRQRVGVAQALVHKPALLILDEPT
                     SGLDPRQIVEMRDVIRGLKGAHTVLVSSHILPEISQTCDRLLIIHKGMLVAQGTEEEL
                     AAKMGGRGTIELEVRGDKARAVEVLQGFGAVEVDRAADGLVALTVRASPDQRPRVAQA
                     VVGAGLELLRLDQGAGQLESIFLRLTHGQEVRA"
     misc_feature    complement(240128..241039)
                     /locus_tag="LILAB_01020"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(240413..241036)
                     /locus_tag="LILAB_01020"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(240917..240940)
                     /locus_tag="LILAB_01020"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(240473..240475,240566..240571,
                     240797..240799,240914..240922,240926..240931))
                     /locus_tag="LILAB_01020"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(240797..240808)
                     /locus_tag="LILAB_01020"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(240614..240643)
                     /locus_tag="LILAB_01020"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(240566..240583)
                     /locus_tag="LILAB_01020"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(240548..240559)
                     /locus_tag="LILAB_01020"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(240467..240487)
                     /locus_tag="LILAB_01020"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            complement(241112..242533)
                     /locus_tag="LILAB_01025"
                     /db_xref="GeneID:10874664"
     CDS             complement(241112..242533)
                     /locus_tag="LILAB_01025"
                     /note="COG4276 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663215.1"
                     /db_xref="GI:338529881"
                     /db_xref="GeneID:10874664"
                     /translation="MGKSHVFDARSRMPVTAHELFAWHAREGAFERLAPPWERMEVLE
                     RTGDGIRTGARVVVRMRVGPVPQRLVAEHTAYSEGAMFQDTQRSGPFTKWVHTHRMWP
                     EPTTGTSILDDEVEYILSVGPLGSLFGGGFARRTLERMFAYRHRITREDLKRHAAFVG
                     QGPLTIAVTGASGLVGSALVPFLTTGGHTVKRLVRGKADPARNEVAWAPDKGEVDTDA
                     LEGVDAVVHLAGVNVAGQRWTPEYKDAILKSRTQGTRTLAEALARMKRKPKVLVSAGG
                     SSIYGDRGDELLTEESSTDGEGFLSQVSREWEAAAAPAEAAGIRVVHLRIGPVLDARE
                     GALAKMLPAFLAGGGGPIGSGRQWMSWVALEDVLGLIHFSVFTEAARGALNTVAPGAV
                     RQADFARTLGKVLRRPAVFPVPSPVVRTLFGQMGQEALLDGARIVPQAAQRLGFAFLL
                     PDLEGALRFTLGRTTEGPEYRHS"
     misc_feature    complement(242099..242515)
                     /locus_tag="LILAB_01025"
                     /note="Ligand-binding SRPBCC domain of an uncharacterized
                     subfamily of proteins; Region: SRPBCC_3; cd07820"
                     /db_xref="CDD:176862"
     misc_feature    complement(order(242114..242116,242123..242131,
                     242138..242146,242150..242164,242183..242185,
                     242189..242191,242195..242197,242201..242203,
                     242225..242227,242231..242233,242237..242242,
                     242261..242263,242267..242269,242315..242317,
                     242321..242323,242381..242383,242387..242389,
                     242393..242395,242399..242401,242414..242416,
                     242459..242464,242468..242476,242501..242503,
                     242507..242509,242513..242515))
                     /locus_tag="LILAB_01025"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176862"
     misc_feature    complement(241160..242041)
                     /locus_tag="LILAB_01025"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(241163..242038)
                     /locus_tag="LILAB_01025"
                     /note="TIGR01777 family protein; Region: yfcH"
                     /db_xref="CDD:233570"
     misc_feature    complement(order(241547..241558,241622..241624,
                     241634..241636,241706..241714,241844..241852,
                     241949..241954,242009..242011,242015..242020,
                     242024..242026))
                     /locus_tag="LILAB_01025"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(241622..241624,241634..241636,
                     241706..241708,241784..241786))
                     /locus_tag="LILAB_01025"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            242601..243527
                     /locus_tag="LILAB_01030"
                     /db_xref="GeneID:10874665"
     CDS             242601..243527
                     /locus_tag="LILAB_01030"
                     /note="COG0009 Putative translation factor (SUA5)"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC/YwlC family protein"
                     /protein_id="YP_004663216.1"
                     /db_xref="GI:338529882"
                     /db_xref="GeneID:10874665"
                     /translation="MLRRGGVVALPTETVYGLSANAEDELAVRRVFAIKGRPATHPLI
                     VHIPGVEHLGAWAHEVPEAARKLAEAFWPGPLTLVLKRTARATDAVTGGQDTVALRVP
                     NHPVALAVLRRLGGGLAAPSANRFGKVSPTTAEHVREDLGGDVDLVLDGGPCTVGVES
                     TIVDLSSEEPAILRPGGLAAEDVERVLGRKVPVRTTSKVRVSGSLESHYAPRAGVVLV
                     EPGQAVARVQELRGQGLRVGVLGPASLVLPAAVPRFDVPDEPAGAARVLYARLREADA
                     QGHDVLVACLPAESGLGIAVRDRLSRAAAPRG"
     misc_feature    242604..243167
                     /locus_tag="LILAB_01030"
                     /note="Putative translation factor (SUA5) [Translation,
                     ribosomal structure and biogenesis]; Region: SUA5;
                     COG0009"
                     /db_xref="CDD:223088"
     misc_feature    243132..243515
                     /locus_tag="LILAB_01030"
                     /note="Putative GTP-binding controlling metal-binding;
                     Region: SUA5; pfam03481"
                     /db_xref="CDD:251991"
     gene            243661..244272
                     /locus_tag="LILAB_01035"
                     /db_xref="GeneID:10874666"
     CDS             243661..244272
                     /locus_tag="LILAB_01035"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663217.1"
                     /db_xref="GI:338529883"
                     /db_xref="GeneID:10874666"
                     /translation="MLSCLLSACASTPPASTPPRGIAEHESTELCAATEASPCVSLAC
                     DEGWCAFYLCEDLAPRVEPALAPVARPPLRRGWGARLGIRHGAQPVITFPWRPHFQIR
                     PVYQLPAGRYVRHHIFPQAPDLALYFQRAGIKIHDYTLVIPEHVHRYIHGGGPRGGRW
                     NAAWAEFIRAHPHPPRPDVIYRHAGDLLFRFELTGKVMPYYKR"
     misc_feature    243661..244260
                     /locus_tag="LILAB_01035"
                     /note="Predicted lipoprotein of unknown function
                     (DUF2380); Region: DUF2380; cl15289"
                     /db_xref="CDD:199147"
     gene            244299..245027
                     /locus_tag="LILAB_01040"
                     /db_xref="GeneID:10874667"
     CDS             244299..245027
                     /locus_tag="LILAB_01040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663218.1"
                     /db_xref="GI:338529884"
                     /db_xref="GeneID:10874667"
                     /translation="MKFYVVEEDRTAGFSGNLRAIPPWGFPGLSPCNSCGAAGGWAGL
                     QYPCVDLSSLPERKELENPGRQVDFEEFSRLRNLVRPFAPSWARLEPGADFGPPTGTG
                     SGTFGDLFMQNPWSLYVRREAMERLQDVGIQGLSGCPLNVRFRGKNPPDLLALQLELH
                     GRLHIDGAPSDMSCVCPTCGRPDHEIPQPPVLDIHSIPERADLFRLHDWPTFIVASER
                     LVDAARRCSLTGVRFNELSNRQAP"
     misc_feature    244302..245015
                     /locus_tag="LILAB_01040"
                     /note="Protein of unknown function (Gmx_para_CXXCG);
                     Region: Gmx_para_CXXCG; pfam09535"
                     /db_xref="CDD:118071"
     gene            245205..245870
                     /locus_tag="LILAB_01045"
                     /db_xref="GeneID:10874668"
     CDS             245205..245870
                     /locus_tag="LILAB_01045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663219.1"
                     /db_xref="GI:338529885"
                     /db_xref="GeneID:10874668"
                     /translation="MSTTRLHSRSLGVLFLLPFFAYGVGTALVTSILQEPEHLAVVAG
                     QRTLFVGGALLLLLNSILVVGIGVLCFPILRARSPSIAVAYVCTRVMEALVLIIGVIF
                     LLCILQLGASAQGQPAPELVTLTRLLSKGNFWAYQLAMIILGTGSVAFCLSLYRARLL
                     PSLLPLVGALGYGLLALGAVLELFGLPWGIFFSGPGGLFELFLGGWLIAKGFRTVTPS
                     VAA"
     misc_feature    245229..245840
                     /locus_tag="LILAB_01045"
                     /note="Domain of unknown function (DUF4386); Region:
                     DUF4386; pfam14329"
                     /db_xref="CDD:258503"
     gene            complement(245848..246483)
                     /locus_tag="LILAB_01050"
                     /db_xref="GeneID:10874669"
     CDS             complement(245848..246483)
                     /locus_tag="LILAB_01050"
                     /note="COG0664 cAMP-binding proteins - catabolite gene
                     activator and regulatory subunit of cAMP-dependent protein
                     kinases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Crp/Fnr family transcriptional
                     regulator"
                     /protein_id="YP_004663220.1"
                     /db_xref="GI:338529886"
                     /db_xref="GeneID:10874669"
                     /translation="MPPHRSRSAHMKHRLVDYFRRIAPLSDEEAQAILDSMVVKTCPK
                     GTHLLMAGQVCTEAYFVLQGCVRQYSVVDGEERSGGFFTEDEWVLSIHSMVNQIPAEH
                     FLVCVEDTTVVVGTEQREGDLYRRFPRFESISRMVMQKVLAEQQERFASYLTDTPEQR
                     YLKLSKTRPDMLQRIPQYQLASYIGVQPESLSRIRKRIATRGKPATPRRKG"
     misc_feature    complement(245878..246420)
                     /locus_tag="LILAB_01050"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(246142..246417)
                     /locus_tag="LILAB_01050"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(246178..246186,246211..246216))
                     /locus_tag="LILAB_01050"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     gene            complement(247239..247973)
                     /locus_tag="LILAB_01055"
                     /db_xref="GeneID:10874670"
     CDS             complement(247239..247973)
                     /locus_tag="LILAB_01055"
                     /note="COG1484 DNA replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB-like ATP-binding protein"
                     /protein_id="YP_004663221.1"
                     /db_xref="GI:338529887"
                     /db_xref="GeneID:10874670"
                     /translation="MSHDLVHARVREHLGRLRLGHLAERLDALLREEIGAKQKKRVSM
                     GITIAHFPAVKTLEDFDFKAQPSVDSKLVRELATGRFIAQAENVLLFGPPGVGKTHLA
                     IGLGRAAVEAGHSVLFTSATALLAALAKAESEGALKDKLNYFAKPKLLIIDELGYLPF
                     EKRSAHLFFQLVARRYEKGSLLITTNQLVGQWGGVFGDDVLAAAILDRLLHHSHTVLI
                     QGDSYRLRQKRKAGLLGRSAPPGNHG"
     misc_feature    complement(247254..247964)
                     /locus_tag="LILAB_01055"
                     /note="transposase/IS protein; Provisional; Region:
                     PRK09183"
                     /db_xref="CDD:181681"
     misc_feature    complement(247338..247763)
                     /locus_tag="LILAB_01055"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(247677..247700)
                     /locus_tag="LILAB_01055"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(247419..247421,247515..247517,
                     247674..247697))
                     /locus_tag="LILAB_01055"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(247512..247529)
                     /locus_tag="LILAB_01055"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(247350..247352)
                     /locus_tag="LILAB_01055"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(247970..249418)
                     /locus_tag="LILAB_01060"
                     /db_xref="GeneID:10874671"
     CDS             complement(247970..249418)
                     /locus_tag="LILAB_01060"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004663222.1"
                     /db_xref="GI:338529888"
                     /db_xref="GeneID:10874671"
                     /translation="MVEQEVVRQVRVLAKAGWGAKRIAREVGVARNTVRRYLRAGSAA
                     DTQVRPKARRLTESEQQRAVELWDSAAEGNAVVVKALLAQEGVEASVRTVQRAVELWD
                     SAAEGNAVVVKALLAQEGVEASVRTVQRAVELWDSAAEGNAVVVKALLAQEGVEASVR
                     TVQRAVEKRRRQVHAAQTATVRFETKPGQQMQVDFGEKKVRLGGQVVKVFLLVAVLSF
                     SRRLFVRAFLNQRGDDWREGVAAAFVHFGGVPLEVLSDNARPLVEENNRQAGTVRFHP
                     AWVQFCRDWDVMPKACGPYRARTKGKTESGVKYVKRNALAGRDFEAFGAMEAHLAQWM
                     GEADERVHGTTHEPPLERFEREEKAALRPLPLRVLPRRHQRLKRKVANDALVDVDTVR
                     YSVPHRLVRENVEVQVGDDEVRIFHAGALVATHARHRQPHARVVDPAHWEGLWRPRAE
                     KRSEKDSSLTGLGRSLEDYAAVVEQDSKRGAA"
     misc_feature    complement(249296..>249394)
                     /locus_tag="LILAB_01060"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    complement(249131..249382)
                     /locus_tag="LILAB_01060"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    complement(248363..>249031)
                     /locus_tag="LILAB_01060"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(248483..248866)
                     /locus_tag="LILAB_01060"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(249529..249654)
                     /locus_tag="LILAB_01065"
                     /db_xref="GeneID:10874672"
     CDS             complement(249529..249654)
                     /locus_tag="LILAB_01065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663223.1"
                     /db_xref="GI:338529889"
                     /db_xref="GeneID:10874672"
                     /translation="MQSQMRAAVARTALAVHQKTAEPLRLSTSMGVVTTVERQQN"
     gene            249896..250426
                     /locus_tag="LILAB_01070"
                     /db_xref="GeneID:10874673"
     CDS             249896..250426
                     /locus_tag="LILAB_01070"
                     /note="COG1413 FOG: HEAT repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="HEAT repeat-containing PBS lyase"
                     /protein_id="YP_004663224.1"
                     /db_xref="GI:338529890"
                     /db_xref="GeneID:10874673"
                     /translation="MSEEQRESALRAIVGSDRATIVSAATLLSGDPTTTDRLIPLLDT
                     ASSADSRQGILYALSWHGDIRIWRLMVRILANPQEAPVVRGQAAEGIAYMFSQVRPGT
                     AEFELAAKALLSALMDPSLEVRFGAIFALGASNHLPFVPVLEALVNDQTPVPGWVETI
                     GEKAAAAIESLTWGKT"
     misc_feature    249941..250171
                     /locus_tag="LILAB_01070"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            complement(250727..250870)
                     /locus_tag="LILAB_01075"
                     /db_xref="GeneID:10874674"
     CDS             complement(250727..250870)
                     /locus_tag="LILAB_01075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663225.1"
                     /db_xref="GI:338529891"
                     /db_xref="GeneID:10874674"
                     /translation="MADVERCRVAGDIDGARQLLNDVLAVEVVPHYQDILRANLAALD
                     DES"
     misc_feature    complement(250739..>250855)
                     /locus_tag="LILAB_01075"
                     /note="Protein of unknown function (DUF2379); Region:
                     DUF2379; cl15283"
                     /db_xref="CDD:199141"
     gene            complement(251643..255188)
                     /locus_tag="LILAB_01080"
                     /db_xref="GeneID:10874675"
     CDS             complement(251643..255188)
                     /locus_tag="LILAB_01080"
                     /note="COG0553 Superfamily II DNA/RNA helicases, SNF2
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="SNF2/helicase domain-containing protein"
                     /protein_id="YP_004663226.1"
                     /db_xref="GI:338529892"
                     /db_xref="GeneID:10874675"
                     /translation="MSTPLDESVTPLFDTASDALAWLRAQGLEHLSRLSLAVLMPLVD
                     AAWLPQARPVLARRRLVELLSTDSLARWMTEAMPSPRMKELLPTLAWRFVEAERLGAE
                     ASRASLEERLAPPGDSRTHRVHGLLLALRARVPASVAPRPVHALVPDLMQYDAPLPGF
                     RLRETRISELPVGAHAGFILPEARLIFSPTEVTGDCSCGATFCVHLLAVIDTALLWLR
                     QPWSETFGEELEELVRPGWERALRALERAVDDSPGGPGGGEVSWRLDVINGYGVELAP
                     YVHKRNKKGQRSTGAKVSRRKLLQEHGSQLSAADARLAALLPESEAPASRALLFELVG
                     HPRIHLDENPDLLVRIERAKVGLVAEDRDGVVIVSAGVDGATLPSAMLERVRRAPPEE
                     GLYVWDDHQRVLTVLDAGPEVRALLTALNRHGNAFPPESHVALLDQLSKLSLRVPVAL
                     PRSVMGESVPLRYVSVVRMEAHASGAVRVELRARPLPDSPTFIPGEGARDVHIRRGTG
                     AVHAVRDFVQERDTAELLQARLPLDTAEPEELPFTFRFTSAQGGLAVLAACTEVEPRP
                     ELEWVGAPVRLFQAPSPQALKVILERKRDWFGVLGGLSVEGERVELARLLDAARRKER
                     WVQVDATSYVEIEGALREHLERLADHAHATRHGLEVGPSAVEALTALQDAGADVEADK
                     TWQSLVERIFAAKELKPRVPAGLKTALRDYQQEGFRWLTRLASWGAGGVLADDMGLGK
                     TVQALTVLLDRSKLGPALVLAPTSVAFNWMEEAKRFAPSLRMTLFSEVADRGQTLERL
                     GPKDVLVMSYGLLTRDIERLSKLRFSTIIFDEAQTLKNATTHRFRAARALQGDFKFAL
                     SGTPLENHLGELWSLFAVVFPGLLGSWEAFRSRFAAPIERGVDPTAAPALARVLQPFL
                     LRRTKAQVEAQLPPRTDIRVPIVLSSEEWALYEDARLAALSDLETRKPKLKEQERRIE
                     ILAALTRLRLLASHPRLYDAGSKLESAKLERFMELVRELRAEGHRALVFSQFTSHLAL
                     VREVLDAEGIDYEYLDGQTPAGARAERVRAFQEGDVPLFLISLKAGGFGLNLTAATTV
                     IHLDPWWNPAVEDQASDRAHRIGQERPVTVYRLVTRGTIEEQMLSLHEHKRALVAGVL
                     EGKDAAGRLSTHELLGLLSQRLAPPGEEEGPRTRH"
     misc_feature    complement(251676..253121)
                     /locus_tag="LILAB_01080"
                     /note="DNA or RNA helicases of superfamily II
                     [Transcription / DNA replication, recombination, and
                     repair]; Region: SSL2; COG1061"
                     /db_xref="CDD:223989"
     misc_feature    complement(252609..253004)
                     /locus_tag="LILAB_01080"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(252966..252980)
                     /locus_tag="LILAB_01080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(252693..252704)
                     /locus_tag="LILAB_01080"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(251832..252200)
                     /locus_tag="LILAB_01080"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(251964..251972,252048..252053,
                     252111..252122))
                     /locus_tag="LILAB_01080"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(251862..251864,251871..251873,
                     251883..251885,251946..251948))
                     /locus_tag="LILAB_01080"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            255361..255951
                     /locus_tag="LILAB_01085"
                     /db_xref="GeneID:10874676"
     CDS             255361..255951
                     /locus_tag="LILAB_01085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663227.1"
                     /db_xref="GI:338529893"
                     /db_xref="GeneID:10874676"
                     /translation="MTMSPRFASVLMLLVLTGCTSQRQTLLERTSSHVVYDMPARQVM
                     KAAEAVLGERGYALLPSTDPLFLITPWKVSGNYDVFTHWSRIYVEGHKRPDGRFTVRA
                     YQMAANMPARTQSMPVPENTAAVAPEEKQNIMPTVLLSAEPVLVRSARPDLRRDLELE
                     WAIMERLDPDFAGRVKTQVDIYLAHSSPKRPGDVLE"
     gene            256000..257013
                     /locus_tag="LILAB_01090"
                     /db_xref="GeneID:10874677"
     CDS             256000..257013
                     /locus_tag="LILAB_01090"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663228.1"
                     /db_xref="GI:338529894"
                     /db_xref="GeneID:10874677"
                     /translation="MKRSVYGLVLALSLTACKEEPRGKMEPIPRPPGMKDAPPPPEAA
                     PAQAAEPPEDPSKVVLRWKLTAGAPTSYRLDIERTGGAPEEGSSTRKGRGKGKEKPAA
                     AAPAATLPDALTYALERTDSGDYRLRVIPEGSNAEVDVGTLSERGFVLDGLQGATRNT
                     ATLVLELPREPVGTGDTWSLGTELILSEALGAQFQAGQPERRNRVKLASLTPADGGEQ
                     VATLEYDISEKLGGTLHAQEAPPTSPARAAEEEAEAADSENPRRKPSPETSASAEVTI
                     TGRGEFLVKAGRWRSWEGTITSVTKGGFPTAALQVPTGTMKLRLSAAEAAPAPAPTAQ
                     PQQ"
     gene            complement(256991..258052)
                     /locus_tag="LILAB_01095"
                     /db_xref="GeneID:10874678"
     CDS             complement(256991..258052)
                     /locus_tag="LILAB_01095"
                     /note="COG0276 Protoheme ferro-lyase (ferrochelatase)"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_004663229.1"
                     /db_xref="GI:338529895"
                     /db_xref="GeneID:10874678"
                     /translation="MPTPTSKRGLLLVNLGTPDAPQPGPVRRYLREFLSDPRVIDIHP
                     VARWALLNLVILPVRPAKSAEAYRKIWMKEGSPLLVYSQALAAQVAERLAGEYEVVLA
                     MRYGSPSIPDGIAALKARGVSEFTVLPLYPQEAASSTASSLARTYEVLAQSWDVPFVR
                     AVPAFFEHPGFLDAFTTVARPVIDEARADYVLFSFHGLPERHMRKSDPTGAHCLSTAS
                     CCDALTDANRHCYRAQSYATARGLAQRLGLPADGWSVSFQSRLGRTPWVKPYTDVVLP
                     ELAKQGVKRLAVMCPAFVADCLETLEEIGLRAREQFVEAGGESLTLVPSLNAHPAWVD
                     AVVRMVRESDGPPTAAAAP"
     misc_feature    complement(256994..258046)
                     /locus_tag="LILAB_01095"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    complement(<257654..258028)
                     /locus_tag="LILAB_01095"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(257654..257656,257663..257665,
                     257798..257800,257810..257812,257843..257845,
                     257855..257857,258011..258013))
                     /locus_tag="LILAB_01095"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(257948..257956,257966..257968,
                     258008..258010))
                     /locus_tag="LILAB_01095"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    complement(257072..257488)
                     /locus_tag="LILAB_01095"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(257156..257158,257255..257257,
                     257450..257452,257465..257467))
                     /locus_tag="LILAB_01095"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(257072..257074,257147..257149,
                     257159..257161,257165..257173,257177..257179,
                     257339..257341,257351..257353,257360..257362,
                     257429..257434))
                     /locus_tag="LILAB_01095"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            complement(258052..258438)
                     /gene="apaG"
                     /locus_tag="LILAB_01100"
                     /db_xref="GeneID:10874679"
     CDS             complement(258052..258438)
                     /gene="apaG"
                     /locus_tag="LILAB_01100"
                     /note="COG2967 Uncharacterized protein affecting Mg2+/Co2+
                     transport"
                     /codon_start=1
                     /transl_table=11
                     /product="CO2+/MG2+ efflux protein ApaG"
                     /protein_id="YP_004663230.1"
                     /db_xref="GI:338529896"
                     /db_xref="GeneID:10874679"
                     /translation="MSSSATTDGIRITVKPSYWPERSAPESGQFAFMYTVEIANEGDA
                     PAQLKARHWVITDATGKVEEVRGEGVVGRQPHLGPGERFEYTSWAMLRTPFGTMRGSY
                     DMARPDGTRFEARIAEFALTLPNSLH"
     misc_feature    complement(258055..258432)
                     /gene="apaG"
                     /locus_tag="LILAB_01100"
                     /note="CO2+/MG2+ efflux protein ApaG; Reviewed; Region:
                     apaG; PRK05461"
                     /db_xref="CDD:180098"
     gene            complement(258509..259459)
                     /locus_tag="LILAB_01105"
                     /db_xref="GeneID:10874680"
     CDS             complement(258509..259459)
                     /locus_tag="LILAB_01105"
                     /note="COG0861 Membrane protein TerC, possibly involved in
                     tellurium resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="TerC family membrane protein"
                     /protein_id="YP_004663231.1"
                     /db_xref="GI:338529897"
                     /db_xref="GeneID:10874680"
                     /translation="MNTQVALWVGFNVFVLAMLALDLGLFHRKDHAVTPKEAGLWTLV
                     WITLSLIFCAGIWHYQGPTVGLQWLTAYVVEYALSVDNLFVFLMVFSYFRVAPEHQHR
                     VLFWGILGAFVMRAGLILAGTALVKQFHWLIYLFGAFLVFTAVKMLVSKDEEIDPEQK
                     GIVKFARRVLPVARLGEGSRFMVQEDGRSKFTPLFIVLLVVEATDLLFALDSIPAVLG
                     ISQDAFIIYTSNVCAILGLRSLFFVVASLMDKFHFLKVGLSAILGFVGVKMLITFFDI
                     HLHIGISLGVIAGILLAAIIASLVWPKQPDPGQDRESAKT"
     misc_feature    complement(258551..259447)
                     /locus_tag="LILAB_01105"
                     /note="integral membrane protein, TerC family; Region:
                     R_switched_Alx; TIGR03718"
                     /db_xref="CDD:234327"
     gene            complement(259580..261721)
                     /locus_tag="LILAB_01110"
                     /db_xref="GeneID:10874681"
     CDS             complement(259580..261721)
                     /locus_tag="LILAB_01110"
                     /note="COG1523 Type II secretory pathway, pullulanase PulA
                     and related glycosidases"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching enzyme GlgX"
                     /protein_id="YP_004663232.1"
                     /db_xref="GI:338529898"
                     /db_xref="GeneID:10874681"
                     /translation="MRRAEVLPGKPYPLGATFDGHGVNFAVFSEHAKKVEVCLFDPED
                     PAKETRRFPLLETTHQVWHGYVPGLAAGTLYGLRVHGPYEPKKGQRFNPHKLLVDPYA
                     RAIHGQVDYQGPIYAYTPGAKEDDLAFDARDDAAAVPKGVVLGPDTFDWEGDAPPAVP
                     WHDTLIYEVHVKGFTKLHPRVPEALRGTYAGLAHPASIEHLKKVGVTAVELLPIQHIV
                     DEPFLIEREKVNYWGYNTLGYFAPDARYSGSGSLGGQVDEFKRMVKQLHRAGIEVILD
                     VVYNHTCEGNQLGPTLSFKGVDNAAYYRLTDKDARYYMDFTGCGNSWNATHPYALKLI
                     ADSLRYWVEEMHVDGFRFDLATTLGRDRYGYDTRAAFFQIVHQDPVLSRVKLISEPWD
                     VGDFGYQVGNFPVLWSEWNGKYRDTIRRYWKGDDRQAAEIGYRLTGSSDLFSMSGRKP
                     TASVNFVTAHDGFTLHDLVTYNDKHNEANGEENRDGANDNHSWNCGVEGETTDAKINA
                     LREQQKRNFLATLFLSQGVPMLVAGDEMGRTQKGNNNAYCQDNELSWVDWELNDTQRA
                     LLDFTCALTKLRREQPVLHKRRFFRGAHMWDSELKDLAWFRPDGKEMRKDDWEKPYVR
                     SLGILLGGDAIAAPDDEGNRIVGDTVLVLMNAHHEPITFMLPAVEWGADWELVVDTAV
                     SGESPRTHTPAGGTVQVVGRSLAVLRRPATE"
     misc_feature    complement(259595..261700)
                     /locus_tag="LILAB_01110"
                     /note="glycogen debranching enzyme GlgX; Region:
                     glgX_debranch; TIGR02100"
                     /db_xref="CDD:131155"
     misc_feature    complement(261218..261688)
                     /locus_tag="LILAB_01110"
                     /note="N-terminal Early set domain associated with the
                     catalytic domain of Glycogen debranching enzyme and
                     bacterial isoamylase (also called glycogen
                     6-glucanohydrolase); Region: E_set_GDE_Isoamylase_N;
                     cd02856"
                     /db_xref="CDD:199886"
     misc_feature    complement(259982..261277)
                     /locus_tag="LILAB_01110"
                     /note="Alpha amylase catalytic domain found in glycogen
                     debranching enzymes; Region: AmyAc_Glg_debranch; cd11326"
                     /db_xref="CDD:200465"
     misc_feature    complement(order(260339..260344,260555..260557,
                     260660..260665,260669..260671))
                     /locus_tag="LILAB_01110"
                     /note="active site"
                     /db_xref="CDD:200465"
     misc_feature    complement(order(260339..260341,260555..260557,
                     260663..260665))
                     /locus_tag="LILAB_01110"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200465"
     gene            complement(261718..264759)
                     /locus_tag="LILAB_01115"
                     /db_xref="GeneID:10874682"
     CDS             complement(261718..264759)
                     /locus_tag="LILAB_01115"
                     /note="COG3280 Maltooligosyl trehalose synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="maltooligosyltrehalose synthase"
                     /protein_id="YP_004663233.1"
                     /db_xref="GI:338529899"
                     /db_xref="GeneID:10874682"
                     /translation="MTAEALAEGLYSRVQAELAARPHTPLSTYRVQFHKGFTFEDARQ
                     VVPYLARLGASDLYASPYLKATPGSTHGYDCVDHQQLNPEVGTPESHAALCAALREQG
                     MGQVLDVVPNHMGIERDNRLWFDVLENGPSSVYAKFFDVDWSPVKEELRDRVLLPILG
                     DQYGIVLERGELKLSFQEGAFFLHYYDHLLPVAPRQYARILRHGLERLESRLGGEHPG
                     MVELLSILTAIDHLPARTEVERPKVVERHREKEVIKRRLASVTAEFPEVLAYIEDNVR
                     VFNGEPGNPRSYDLLDSVLSACSYRLAHWRVAGEEINYRRFFDINGLAALREEDPDVF
                     QEAHALIFRWLREGLVTGLRIDHPDGLFDPTAYFLDLQEAYFVERAHALFLQAHAEDD
                     TRWPAVERALRERWRAEVTQQPDSPLRKALYVVVEKIQGGRERMPESWAVHGTTGYRF
                     ANAVSGLFVQPDAEKPLTELYERFVGGQADFAELVYQKKLLIMRVSMASEINVLAHEL
                     NRISEMNRRTRDFTLNSLRRALVEFIALFPVYRTYVDGWRPELDGRDVQYIEWTLQRA
                     KERNATTNASIFDFLRDILLRRYPEHVDARERDVMLRFAMKLQQVTGPVMAKGLEDTV
                     FYIYNRLVSLNEVGGEPERFGVHANTFHLRNQERAEQWPASQLTSSTHDTKRSEDVRA
                     RINVLTELPEAWRKRVRKWARQTEKAVSQLPTGPAPTANDIYLFFQTVVGAWPMGESH
                     SAEELADFQRRVREYMGKAIKEAKVRTSWTNPDSAYDDAVARFVDACFDPKVTGHFLE
                     DARDFKRSIERAGQHNALGQLLLKMASPGVVDTYQGCELWDLSLVDPDNRRPVDFAQR
                     ARLLEALDAEVKQDRGALSRRLAANLDDGQVKLYVLAESLRLRQRQAALFREGGYRAL
                     ELTGPRAKAAVAFAREHGDSVVVACAPRYTLSALASPEGLAGAYGSTFLDLPEAYAGM
                     MFREVFTGRQVRPERGPGGAVLPLGPLLAEFPVILLERSTG"
     misc_feature    complement(261730..264696)
                     /locus_tag="LILAB_01115"
                     /note="maltooligosyl trehalose synthase; Provisional;
                     Region: PRK14511"
                     /db_xref="CDD:237740"
     misc_feature    complement(262054..264681)
                     /locus_tag="LILAB_01115"
                     /note="Alpha amylase catalytic domain found in
                     maltooligosyl trehalose synthase (MTSase); Region:
                     AmyAc_MTSase; cd11336"
                     /db_xref="CDD:200475"
     misc_feature    complement(order(262216..262218,262228..262230,
                     262741..262743,262849..262851,262897..262899,
                     263140..263142,263473..263475,263479..263481,
                     263692..263694,263809..263811,264421..264423,
                     264541..264543,264547..264549))
                     /locus_tag="LILAB_01115"
                     /note="active site"
                     /db_xref="CDD:200475"
     misc_feature    complement(order(262741..262743,263479..263481,
                     263692..263694))
                     /locus_tag="LILAB_01115"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200475"
     misc_feature    complement(<261859..262026)
                     /locus_tag="LILAB_01115"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cl11424"
                     /db_xref="CDD:264361"
     gene            complement(264985..265302)
                     /locus_tag="LILAB_01120"
                     /db_xref="GeneID:10874683"
     CDS             complement(264985..265302)
                     /locus_tag="LILAB_01120"
                     /note="COG5531 SWIB-domain-containing proteins implicated
                     in chromatin remodeling"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase domain-containing protein"
                     /protein_id="YP_004663234.1"
                     /db_xref="GI:338529900"
                     /db_xref="GeneID:10874683"
                     /translation="MAAKKAAAKKAPAAKKAPAAKKRTPNASFMKEMTPSAALAEIVG
                     AKPLPRTEVVKKLWAYIKKQGLQDAKNKRQINADDKLKPIFGGKKSVTMFEMTALVNK
                     QLS"
     misc_feature    complement(264997..265218)
                     /locus_tag="LILAB_01120"
                     /note="SWIB/MDM2 domain; Region: SWIB; pfam02201"
                     /db_xref="CDD:251152"
     gene            265649..266629
                     /locus_tag="LILAB_01125"
                     /db_xref="GeneID:10874684"
     CDS             265649..266629
                     /locus_tag="LILAB_01125"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663235.1"
                     /db_xref="GI:338529901"
                     /db_xref="GeneID:10874684"
                     /translation="MRALITGAGGFLGTWLAKALAARGDSVTCLLRPGGDASGLAGVS
                     HSRVDGDVTVPSTLAAAVAGQDVVFHLAGARRGATRDDFMRVNAEGTRHLCEAMVAAG
                     HRPRLVLTGSLAACGPSTPTRPHVEEDAFHPHEWYGESKAEAERIAFSYGDRLPVTVS
                     RPPRILGPGDRENLTFFKMARRGIRLELSGGPRPLTMIDVEDVVDVLLLQATHPAAVG
                     EAFFCAGPGAPLSLEQVQDLGARALGISPRTVRVHPAVLRALATAADGVSQLTGRKLA
                     LSRKLAKQLLAPAWTCSGAKAERLLGFHPRRDLADSIRRSVTWYQEQGWL"
     misc_feature    265649..266608
                     /locus_tag="LILAB_01125"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    265655..266608
                     /locus_tag="LILAB_01125"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(265667..265669,265673..265678,265682..265684,
                     265739..265747,265859..265867,265976..265984,
                     266057..266059,266069..266071,266132..266143)
                     /locus_tag="LILAB_01125"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(265907..265909,265982..265984,266057..266059,
                     266069..266071)
                     /locus_tag="LILAB_01125"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            266719..267384
                     /locus_tag="LILAB_01130"
                     /db_xref="GeneID:10874685"
     CDS             266719..267384
                     /locus_tag="LILAB_01130"
                     /note="COG0560 Phosphoserine phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_004663236.1"
                     /db_xref="GI:338529902"
                     /db_xref="GeneID:10874685"
                     /translation="MSAKAAFFDVDGTLVKTNVVHVYAYYAMNRGSVLGIAGRTLSTA
                     LSVPLFGVMDALDRKTFNEFFYRYYAGLSEDRLVTIAEDMFEDVLQPALFEQTQDLID
                     QARRSGCKIVLVTGALDFTMRPLARHLGADDMIANKMQFVGGKATGKVIPPIIEGANK
                     ANAIRAYCTKEGLSLDKCHGYSDSASDYAMLAVVGRPTAVNPDLRLRSIARAYNWPIL
                     DLK"
     misc_feature    266728..267303
                     /locus_tag="LILAB_01130"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase; pfam00702"
                     /db_xref="CDD:250068"
     misc_feature    266962..267318
                     /locus_tag="LILAB_01130"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    267061..267063
                     /locus_tag="LILAB_01130"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            267399..269009
                     /locus_tag="LILAB_01135"
                     /db_xref="GeneID:10874686"
     CDS             267399..269009
                     /locus_tag="LILAB_01135"
                     /note="COG3875 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663237.1"
                     /db_xref="GI:338529903"
                     /db_xref="GeneID:10874686"
                     /translation="MRPFKTLQKLYDEESQVVITEKGSPPRVLFHGENFLQEDLPVGT
                     RVIFPRPPLAGVPNVKAAIRYAINHPEGMEPLHALLKPGMRLTCVIDDISVPLPPMVT
                     PDVRQTILEIVLELAADSGVDDVHLVIANALHRRMTEGEMKRMVGEKIFDAYYPDRYY
                     NHDAEDPDGMVALERTSHGEEVSVNRRVAESDLIVYVNVNFVPMNGGHKSMGTGVSNY
                     ASLRHHHNPKTIRASDSYMEPKTSALYKSNERIGRNIDKHLKVFHIETALNNRMFGGP
                     TDFLAKKEEDYTEGDRLKFQAMRFALSKLPRAAARKVLNSVPAPYDVTGVYAGATEPT
                     HAKTLETSYKQYVVPVEGQSDIVIFPIPFISPYSVNSILNPLLVQVMGLGYFYNLNRG
                     VPLVKKGGVLILLHPAYDEFDPEHHPSYIEFFHRLLPETRDSMKLEHKYEREFAENPS
                     YVHLYRKGNAYHGVHPFYMWYWGENGRQHVGKVIVAGAENNHVPALMGWERTDTLTEA
                     IEEARGFMGRSATISLLRIAPTVMVDVK"
     misc_feature    267531..268076
                     /locus_tag="LILAB_01135"
                     /note="Domain of unknown function (DUF2088); Region:
                     DUF2088; cl15406"
                     /db_xref="CDD:265688"
     gene            269018..273430
                     /locus_tag="LILAB_01140"
                     /db_xref="GeneID:10874687"
     CDS             269018..273430
                     /locus_tag="LILAB_01140"
                     /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /codon_start=1
                     /transl_table=11
                     /product="putative long-chain-fatty-acid--CoA ligase"
                     /protein_id="YP_004663238.1"
                     /db_xref="GI:338529904"
                     /db_xref="GeneID:10874687"
                     /translation="MAPLPELNVTQTFTGKRLLFAGATGFVGKVTLSMLLSRYGQDLD
                     KVYVLVRKGSAASAERRFFDKVATSEPFQPLRDSLGDAGALAFIQQKVEVLDGDITDP
                     WMGLEEARVAELTGQVHAFINCAGLVSFNPSLEVGLNVNTHGLKFAAELALRWSVPLI
                     HMSTAFVAGNRSGLVFEDEDIRGYFPKRDEMDGRDFSLEQELQDAARVVARLREQAED
                     RALTSTFRKKALDRLEEEGRDTNDEKTLRLAVGRERKLWLSGELVRAGMERAAHWGWP
                     NTYTYTKSLGEQVLAATPGLRYSIVRPSIVESARHFPFPGWNEGFTTSAPLAFAGIKG
                     PGGIPAGESTILDIIPVDQVAGATIGITAHAMDVEERRIYQLASGDENPFYAGRSVEL
                     VGLYRRRYYRNRESGNALMNKLRSRLEPQPVSKKEFELFSAPMLSRGARFLKKAIDEV
                     RPAWGAPAVQAMLDKAKVSLDEVEENAQGIIALTELFLPFLYENRYVFRCDNTRSVYA
                     RMAHADRLKVPWDPEHIDWREYFLGTHLPGLEKWVFPGMESEREKRTVIPAHRDLLEL
                     LEATVHAYRHRVAFRMVAGEREERFTYGEVHRYAARVGSFLLAKGIKHGDRVLLVSEN
                     RPEWGITYFGILRSGATVVPVDPALSEAELVNIARRAEARACLVSEDAARDYPGLFAA
                     LGEGVTVASLAEAMTGDPAHPDRIGPVRKSAAADDLASVIFTSGTTGTPKGVMLTHRN
                     FASLVAKLAGTFDIGVGDGVLSVLPLHHTFEFAAGFLTPFWRGAEITYIDELTSDRLG
                     EVFETGRITAMVGVPALWQLLHRKMTQEFASRPPFIEQALKALMATHGELRNRNNINL
                     GKLLFWPVHRKFGGRIKVLVSGGSALPDDVHKAFHELGFNITEGYGLTEAAPVLAVTK
                     PGNKRQPGTVGRALPGIELRILNPDNDGLGEVLAKGPNVMPGYFGDREATEAVLKDGW
                     LHTGDLGRLDAEGRLYLVGRAKDVIIDHNGKNIYPDELEELYQDHPHIKELSVVGLPD
                     EAGGEKVACLCVPDYGDRPREEVRRELEEHFRKVGSGMPFYRRVKVLRLWDGELPRTA
                     KRSVKRKQVVEELKRQERMAASASKAREKAANPTTGGVADWLFPLIAEVSHRPVTDVR
                     PDALLSGDLGFDSLMLTELSSALEAAGVPLPAVEDLTQVQTVEDLRKVVASSGKRPSV
                     ETRAKDISKENERAEEVEIPVPDVVADVGRQLLSFGQKVLYGGVFDVKVTGKPFIPQN
                     RNFLVIANHSSHLDAGLVRTALGEQGERLVSLAARDYFFNTPLKRAWFENFTNLVPIE
                     RQGSLRESLRMAGEALRQGFNVLIFPEGTRSPTGELMEFKSTLGYLALTYHVDVLPLY
                     IGGAFDALPKGSVLPRTKTPLRVNIGPVLGHADLRTRVQGMARSEGYRYVTRIAEDSM
                     RALRDGRVLSLERVDLPPAGATSRTSSSTEGKDS"
     misc_feature    269033..270649
                     /locus_tag="LILAB_01140"
                     /note="fatty acyl-CoA reductase; Region: PLN02996"
                     /db_xref="CDD:215538"
     misc_feature    269063..270196
                     /locus_tag="LILAB_01140"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(269081..269083,269087..269092,269096..269098,
                     269165..269173,269387..269395,269501..269509,
                     269852..269854,269864..269866,269924..269935)
                     /locus_tag="LILAB_01140"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(269447..269449,269507..269509,269852..269854,
                     269864..269866)
                     /locus_tag="LILAB_01140"
                     /note="active site"
                     /db_xref="CDD:187535"
     misc_feature    <270455..270649
                     /locus_tag="LILAB_01140"
                     /note="C-terminal domain of fatty acyl CoA reductases;
                     Region: FAR_C; cd09071"
                     /db_xref="CDD:176924"
     misc_feature    270689..272335
                     /locus_tag="LILAB_01140"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    270776..272308
                     /locus_tag="LILAB_01140"
                     /note="Long-chain fatty acid CoA synthetases and
                     Bubblegum-like very long-chain fatty acid CoA synthetases;
                     Region: VL_LC_FACS_like; cd05907"
                     /db_xref="CDD:213275"
     misc_feature    order(271178..271180,271187..271204,271208..271213)
                     /locus_tag="LILAB_01140"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    order(271187..271189,271538..271543,271712..271729,
                     271946..271948,271982..271984,271991..271993,
                     272027..272029,272282..272284)
                     /locus_tag="LILAB_01140"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    order(271187..271189,271307..271312,271451..271453,
                     271457..271462,271469..271471,271538..271543,
                     271712..271729,271946..271948,271982..271984,
                     271991..271993,272018..272029,272228..272230)
                     /locus_tag="LILAB_01140"
                     /note="putative active site [active]"
                     /db_xref="CDD:213275"
     misc_feature    order(271307..271309,271457..271462,271469..271471,
                     271538..271540,272018..272026,272213..272215,
                     272228..272230)
                     /locus_tag="LILAB_01140"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    272399..272590
                     /locus_tag="LILAB_01140"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    272744..273262
                     /locus_tag="LILAB_01140"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    order(272828..272830,272837..272839,272843..272845,
                     272900..272911,273059..273067)
                     /locus_tag="LILAB_01140"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            273427..274455
                     /locus_tag="LILAB_01145"
                     /db_xref="GeneID:10874688"
     CDS             273427..274455
                     /locus_tag="LILAB_01145"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD dependent epimerase/dehydratase family
                     protein"
                     /protein_id="YP_004663239.1"
                     /db_xref="GI:338529905"
                     /db_xref="GeneID:10874688"
                     /translation="MKLLVTGGTGFLGTHLVPRLVAAGHEVRLIGRSQPTGAAYAGTE
                     YVPGDLKNRDAVRRALEGVEAVYHLAGLVSFQPKDARKMFELHVDSTRELLSDVREAG
                     VKRVVLASTSGTIAVSKEERVLDERADYPITVVGQWPYYLSKIYEEKLALAYCRKHAI
                     PLVVLNPSLLMGPGDDRLSSTWTVVKFLNGEIPAMPGGGISFVDARDAADAFVQALTR
                     GEVYGRHLMGVNLSMTDFFQRLERLSGVPAPKLKLPSKLNVLGGKLLERWAKVRGTTP
                     ALDPQEIDIGEHWFWLDASKAEAELGFRARDIQETLSETVRHIYGKMPPQSLPGTKGR
                     LAELRENT"
     misc_feature    273427..274377
                     /locus_tag="LILAB_01145"
                     /note="hopanoid-associated sugar epimerase; Region: HpnA;
                     TIGR03466"
                     /db_xref="CDD:163279"
     misc_feature    273436..274377
                     /locus_tag="LILAB_01145"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(273445..273447,273451..273456,273460..273462,
                     273514..273522,273631..273639,273751..273759,
                     273844..273846,273856..273858,273925..273936)
                     /locus_tag="LILAB_01145"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(273685..273687,273757..273759,273844..273846,
                     273856..273858)
                     /locus_tag="LILAB_01145"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(274501..274671)
                     /locus_tag="LILAB_01150"
                     /db_xref="GeneID:10874689"
     CDS             complement(274501..274671)
                     /locus_tag="LILAB_01150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663240.1"
                     /db_xref="GI:338529906"
                     /db_xref="GeneID:10874689"
                     /translation="MAASAGEAGPSFLARLVLVLLGCAFLGAAWVWGHRSEPWAARLV
                     DDAQRTVGVPRR"
     gene            complement(274675..275556)
                     /locus_tag="LILAB_01155"
                     /db_xref="GeneID:10874690"
     CDS             complement(274675..275556)
                     /locus_tag="LILAB_01155"
                     /note="COG2199 FOG: GGDEF domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain/GGDEF domain-containing protein"
                     /protein_id="YP_004663241.1"
                     /db_xref="GI:338529907"
                     /db_xref="GeneID:10874690"
                     /translation="MAGDETRVTKISTLNVHAHRSTECCLVQIHGPELGKKYLIEDAE
                     LTIGRDQHNHIVVDLDNVSRRHARILGRGGKMLVEDLGSTNGTFLNDQEVLQASPLRS
                     GDLVKVGGSIFKFLDGDNIETQYHETIYTLTIADGLTGINNKRYFLEYLEKEMGRSTR
                     YQRTLTLMMFDIDHFKQINDVHGHLAGDYVLRELAQSIKRLVRREQCFARYGGEEFAV
                     VLPEDGPDKARLFAEKIRRLIEGKSFVYDDKEIPVTISIGVAEQTPDMLEPTHFIKVA
                     DANLYKAKKSGRNRVVG"
     misc_feature    complement(275209..275490)
                     /locus_tag="LILAB_01155"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    complement(275218..>275424)
                     /locus_tag="LILAB_01155"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    complement(order(275299..275307,275365..275370,
                     275374..275376,275410..275412))
                     /locus_tag="LILAB_01155"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     misc_feature    complement(274681..275151)
                     /locus_tag="LILAB_01155"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(274915..274917,275044..275046))
                     /locus_tag="LILAB_01155"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(274912..274923,274927..274929,
                     274993..274995,275005..275007,275017..275022,
                     275029..275031))
                     /locus_tag="LILAB_01155"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(274855..274857,274939..274941))
                     /locus_tag="LILAB_01155"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            275815..277044
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /db_xref="GeneID:10874691"
     CDS             275815..277044
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /EC_number="2.7.7.27"
                     /note="COG0448 ADP-glucose pyrophosphorylase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="YP_004663242.1"
                     /db_xref="GI:338529908"
                     /db_xref="GeneID:10874691"
                     /translation="MSKVLAMILAGGAGTRLEPLTRERAKPAVPFGGRYRIIDFVLSN
                     FANSGVYRMKVLTQYKSDSLNNHLSRAWRMTAFLGHYVEAVPAQMRTGVDWYKGSADA
                     IYQNLNIITDEEPDHIFVFGADHVYRMDTRQMLDFHCAKKAACTVAAIPVPIEQGREF
                     GIIDVGPDGRMLQFLEKPKDPPPMPGNPKMCLASMGNYLFNTDTLVQEVVRDAANEAS
                     AHDFGKSIISELYKRAPVYVYDFAQNEVAGQEAKERGYWRDVGNIDVYYQSNMDLVEV
                     DPTFNLYNDRWPIHTQPNNYPPAKFVFADEQNHRVGHAMDTLVAEGCIISGGSVRRSV
                     LSPKVRVNSYSEVEDSILFENVTIGRRCRIRRAIIDKNVEIPPGMTIGFDPVEDRRRF
                     HVTPAGVVVIPKGMKVT"
     misc_feature    275815..277038
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="glucose-1-phosphate adenylyltransferase;
                     Provisional; Region: glgC; PRK00844"
                     /db_xref="CDD:234846"
     misc_feature    275830..276594
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="ADP-glucose pyrophosphorylase is involved in the
                     biosynthesis of glycogen or starch; Region:
                     ADP_Glucose_PP; cd02508"
                     /db_xref="CDD:133002"
     misc_feature    order(275839..275841,275845..275850,276103..276105,
                     276109..276111,276181..276186,276475..276477,
                     276481..276486)
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="ligand binding site; other site"
                     /db_xref="CDD:133002"
     misc_feature    order(275998..276000,276007..276009,276061..276063,
                     276070..276072,276079..276081,276130..276132,
                     276136..276138,276148..276153)
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="oligomer interface; other site"
                     /db_xref="CDD:133002"
     misc_feature    276742..277038
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="Glucose-1-phosphate adenylyltransferase, C-terminal
                     Left-handed parallel beta helix (LbH) domain:
                     Glucose-1-phosphate adenylyltransferase is also known as
                     ADP-glucose synthase or ADP-glucose pyrophosphorylase. It
                     catalyzes the first committed and...; Region:
                     LbH_G1P_AT_C; cd04651"
                     /db_xref="CDD:100056"
     misc_feature    276742..276771
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100056"
     misc_feature    order(276760..276762,276772..276777,276808..276810,
                     276814..276816,276823..276825,276922..276924,
                     277027..277029)
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100056"
     misc_feature    order(276922..276927,277024..277026)
                     /gene="glgC"
                     /locus_tag="LILAB_01160"
                     /note="sulfate 1 binding site; other site"
                     /db_xref="CDD:100056"
     gene            277052..277576
                     /locus_tag="LILAB_01165"
                     /db_xref="GeneID:10874692"
     CDS             277052..277576
                     /locus_tag="LILAB_01165"
                     /note="COG0454 Histone acetyltransferase HPA2 and related
                     acetyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_004663243.1"
                     /db_xref="GI:338529909"
                     /db_xref="GeneID:10874692"
                     /translation="MGADGLLLRPAKESDRRTLWRIHTQAVEALCPRAYAPHEVRTWV
                     RLLRPEGYLRPERPRTVLVAERGRRAVGFGQVDAALGELEALYVVPDEAGHGVGATLL
                     WALESTVWRGDAARLGLDASLNAEHFYQRHGYASVHPARRPLTPEVQLACVRMQKQRP
                     ATARGGGRPGSAAR"
     misc_feature    277232..277411
                     /locus_tag="LILAB_01165"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(277307..277315,277343..277348)
                     /locus_tag="LILAB_01165"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(277569..278018)
                     /locus_tag="LILAB_01170"
                     /db_xref="GeneID:10874693"
     CDS             complement(277569..278018)
                     /locus_tag="LILAB_01170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663244.1"
                     /db_xref="GI:338529910"
                     /db_xref="GeneID:10874693"
                     /translation="MENTYGTMNSPGGPGAQEAVSLPAILLMVLSGITVLLGLVNLLQ
                     SFGGTDPAVTEALQNPDLPEGARRLIAGLSSTGGKVMFALLTIALNGLIFFGALKMKN
                     LQSHGLAMTAAIISVIPCCSPCACLGIPVGIWALVVLNKPEVKASFT"
     gene            complement(278149..279573)
                     /locus_tag="LILAB_01175"
                     /db_xref="GeneID:10874694"
     CDS             complement(278149..279573)
                     /locus_tag="LILAB_01175"
                     /note="COG1690 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663245.1"
                     /db_xref="GI:338529911"
                     /db_xref="GeneID:10874694"
                     /translation="MQPKLNRLLRALAREGLEVAYDGRLYSVRLQGDAHAPPAEVLLP
                     PDLPVEGKAFQQLAHLAALRHPSGGQVLRVRATPDFHPGDSGVAIGSVLHTRGLVVPG
                     AIGTDINCGMRLHVANVSVEAFLAKRTAFVERMKGHYFFGTRDVTMGSRASEALLRDG
                     VQGWLVETLERPLGCAGRADLAQLDAEVARIHLGGGLKGHPRWAPESFTREGLVRDAG
                     LATIGGGNHFVEVQRVEAVEDRARAWGWGVREGQLAFMIHSGSRDVGKHVGVAWQDRA
                     RQAWPVGAPLPESGILPLGDARLVEQYLEAEATAANYAFLNRLLLAELLRQTLRELFG
                     DVEAPLVYDVPHNLTLPYEGGWLARKGACPAGAEQPVIIPGSMGATSFLMVGCGDARA
                     LESASHGAGRARSRFSLSRGGADQSEAALGLAGVDCITLRAERRVEEAPAAYKPIRPV
                     VDAQVEAGIVREVARLAPLLTFKA"
     misc_feature    complement(278152..279438)
                     /locus_tag="LILAB_01175"
                     /note="tRNA-splicing ligase RtcB; Region: RtcB; pfam01139"
                     /db_xref="CDD:250393"
     misc_feature    complement(278155..279432)
                     /locus_tag="LILAB_01175"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: RtcB; COG1690"
                     /db_xref="CDD:224604"
     gene            complement(279735..280514)
                     /locus_tag="LILAB_01180"
                     /db_xref="GeneID:10874695"
     CDS             complement(279735..280514)
                     /locus_tag="LILAB_01180"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_004663246.1"
                     /db_xref="GI:338529912"
                     /db_xref="GeneID:10874695"
                     /translation="MDLELGGKVVLVTGGSEGLGAAVARRLVREGAKVALCARGVERL
                     EATAAALRAEGGDVLTVQADVSRAWEVEHFVDAAHARFGRIDALVNNAGTAAGRPFAS
                     VSDAEWEADLQLKVFAAIRASRQALPFLKESGGGAIVNVLAIAAKTPGANSTPSSVSR
                     AAGLALTKALSKEFGPHDIRVNAVLVGIIESGQWERRAREVGKPVESFQQEMARHAGI
                     PLGRVGKAEEFADTVAFLLSPRGGYISGAAINVDGGLSAAV"
     misc_feature    complement(279747..280514)
                     /locus_tag="LILAB_01180"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07062"
                     /db_xref="CDD:180818"
     misc_feature    complement(279747..280496)
                     /locus_tag="LILAB_01180"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(279948..279959,280035..280037,
                     280047..280049,280086..280094,280236..280244,
                     280395..280403,280458..280460,280464..280469,
                     280473..280475))
                     /locus_tag="LILAB_01180"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(280035..280037,280047..280049,
                     280086..280088,280170..280172))
                     /locus_tag="LILAB_01180"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(280595..281755)
                     /locus_tag="LILAB_01185"
                     /db_xref="GeneID:10874696"
     CDS             complement(280595..281755)
                     /locus_tag="LILAB_01185"
                     /note="COG1816 Adenosine deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="YP_004663247.1"
                     /db_xref="GI:338529913"
                     /db_xref="GeneID:10874696"
                     /translation="MPTIRDDEIPNATGIPSSARRTDFMPPPTLAVTEELLRALPKTD
                     LHCHLDGSMRLKTILELAEQQKIKLLADTEDGLAKAIHMGEVCESLEEYLVAFDVTLS
                     VLQTAEALYRAAYELAVDAAAENVRWLEVRYSPALHLQKGLKMTTVIDSVLEGLRAAK
                     RETGIKCGVIVCGIRHINPQTSMRLAELAVAYKNRGVIGFDLAGAEASFPAKDHRDAF
                     QLILKNNVNCTAHAGEAYGPESISQAIHNLGAHRIGHGTRLREDGDLLNYVNDHRIPL
                     EVCPTSNVQTGAVSSLSAHPLKFYFDYGLRVTINTDNRLITDTTVTKELWTAHSELGL
                     SLEDLTTILVSGFKSAFLPFREKQDMLRAVNEEIARTLAAFDQKRHPVKQPA"
     misc_feature    complement(280664..281638)
                     /locus_tag="LILAB_01185"
                     /note="Adenosine deaminase (ADA) is a monomeric zinc
                     dependent enzyme which catalyzes the irreversible
                     hydrolytic deamination of both adenosine, as well as
                     desoxyadenosine, to ammonia and inosine or desoxyinosine,
                     respectively. ADA plays an important role in...; Region:
                     ADA; cd01320"
                     /db_xref="CDD:238645"
     misc_feature    complement(order(280817..280822,280991..280993,
                     281054..281056,281063..281065,281612..281614,
                     281618..281620))
                     /locus_tag="LILAB_01185"
                     /note="active site"
                     /db_xref="CDD:238645"
     misc_feature    complement(order(280817..280822,281054..281056,
                     281144..281146,281606..281608,281612..281614))
                     /locus_tag="LILAB_01185"
                     /note="purine riboside binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238645"
     gene            281821..282882
                     /locus_tag="LILAB_01190"
                     /db_xref="GeneID:10874697"
     CDS             281821..282882
                     /locus_tag="LILAB_01190"
                     /note="COG1520 FOG: WD40-like repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663248.1"
                     /db_xref="GI:338529914"
                     /db_xref="GeneID:10874697"
                     /translation="MLPALALTLVAAMGCREPATSAFRYSTDASSRAGLVALTDGVLT
                     ANEAGTVVRLERSGRVAWRVPLDREVATRPALLADSVIAGTVGGDLVRLALDTGAVRW
                     RLSGEPPVLTAPVADAAGKYVFLVAPDGAVRALFTDTGKTDWERPPPGKPGPAAAPRA
                     FPTPVLRDGLLVVALGDAGVMALATQDGARRWQRDVRDVLGMTLWRDTLYVSTRQGRV
                     LALRLGDGTPLWERAPAAALSSPPSLALGAVWVGTGGAEPLLVGLSSEDGEEVARATL
                     PDALVAGVTPVREDLLLVPTSGRQGRLVALKTGTWQPAFSVRADTPLRTQPVALGDQV
                     IVLGLDGRVLSWRLRTPTR"
     misc_feature    281893..282852
                     /locus_tag="LILAB_01190"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    281965..282633
                     /locus_tag="LILAB_01190"
                     /note="PQQ-like domain; Region: PQQ_2; pfam13360"
                     /db_xref="CDD:257688"
     misc_feature    order(281977..281979,281983..281985,281989..281997,
                     282004..282006,282094..282096,282100..282102,
                     282109..282117,282124..282126,282220..282222,
                     282226..282228,282235..282243,282250..282252,
                     282364..282366,282370..282372,282379..282387,
                     282394..282396,282478..282480,282484..282486,
                     282493..282501,282508..282510,282604..282606,
                     282610..282612,282619..282627,282634..282636,
                     282733..282735,282739..282741,282748..282756,
                     282763..282765)
                     /locus_tag="LILAB_01190"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199833"
     misc_feature    order(282025..282027,282154..282156,282202..282207,
                     282301..282303,282460..282462)
                     /locus_tag="LILAB_01190"
                     /note="active site"
                     /db_xref="CDD:199833"
     gene            complement(282913..285264)
                     /locus_tag="LILAB_01195"
                     /db_xref="GeneID:10874698"
     CDS             complement(282913..285264)
                     /locus_tag="LILAB_01195"
                     /note="COG0210 Superfamily I DNA and RNA helicases"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="YP_004663249.1"
                     /db_xref="GI:338529915"
                     /db_xref="GeneID:10874698"
                     /translation="MSPANPHETALLEDLNAPQREAVLHGDGPLLVLSGAGSGKTRVI
                     TRRVAYLVKVHDVYPWRILAVTFTNKAAREMRERLTQLLGAQANELVVSTFHSAAAQI
                     LRREAEHVGLTRSFVIYDDSDQLNVVKRAMREAGIESMQPREILHRIDQEKNAARLPE
                     HMQVAPGDERGQLVRKVYAAYQERLRAANAVDFGDLLLLLVTLFRTRPDVLENYRRRF
                     THVLVDEFQDTNPVQYALLKQLAPPPSANLVVVGDDDQSIYRWRGADVDNILSFPRQY
                     PGAKVVKLEQNYRSDQNILDAAHEVIRKNTRRMEKKLWSERPRGQTLDLLLNRDERAE
                     AQEVARQILALQREGFIKLSSMAVFYRANAQSRVLEEALRLARVPYTLVSGRSFYDRA
                     EVRDASAYLRLMVNPRSDADLLRIINIPARGIGDTTVERLTDFANTRGVSLYEALSQP
                     EQVPALNGAAVKRLKGFRNLLESLTAFAQTNEEAAGAVDQMLRETKLVETLLAEGSDE
                     AQTRAENLREFLGAAQEFDLNRAAAAVAAAANPPPEVPPEVDAAPLTADVPALQAFLE
                     QISLVGEADAEVGDGRVALMTLHAAKGLEFDAVFLTGMEENVFPHARAVKSETTFLNE
                     DASADGEPSEEMAEERRLCYVGFTRARKRLFVSLAQCRSLFGELRYNAPSRFLRDVPS
                     PLFGISEQELPEAPRPRVPSMPRRRPHDEDDGPRIDRSYSQASSDMDGVGGDVRGMRV
                     RHEQFGVGRVVSADGNGPNAKVTVEFGGGVGLKRIIARFLMPG"
     misc_feature    complement(282928..285234)
                     /locus_tag="LILAB_01195"
                     /note="ATP-dependent DNA helicase PcrA; Region: pcrA;
                     TIGR01073"
                     /db_xref="CDD:233261"
     misc_feature    complement(284968..285204)
                     /locus_tag="LILAB_01195"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(283297..>283518)
                     /locus_tag="LILAB_01195"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            285383..285868
                     /locus_tag="LILAB_01200"
                     /db_xref="GeneID:10874699"
     CDS             285383..285868
                     /locus_tag="LILAB_01200"
                     /note="COG2050 Uncharacterized protein, possibly involved
                     in aromatic compounds catabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase family protein"
                     /protein_id="YP_004663250.1"
                     /db_xref="GI:338529916"
                     /db_xref="GeneID:10874699"
                     /translation="MSDSSSGAPSKPSQADLDRYAEQFSQSLTLRLFGARLSFPEGRK
                     VVVSIPALRPEHRGGAGSASAVNGGILAALFDYAIGCTGALVDPGRRCATVQLSMSFE
                     RAVTGDHLRVESEIDSQTVSLLFATARVYDGEGRVCGRCQGVVKLSNLRWASGDSPAV
                     N"
     misc_feature    285476..285823
                     /locus_tag="LILAB_01200"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    order(285578..285580,285662..285664,285683..285694)
                     /locus_tag="LILAB_01200"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(285581..285583,285587..285589,285596..285598,
                     285665..285679,285683..285685)
                     /locus_tag="LILAB_01200"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(285584..285586,285608..285613,285620..285622,
                     285662..285664)
                     /locus_tag="LILAB_01200"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            286004..286639
                     /locus_tag="LILAB_01205"
                     /db_xref="GeneID:10874700"
     CDS             286004..286639
                     /locus_tag="LILAB_01205"
                     /note="COG1595 DNA-directed RNA polymerase specialized
                     sigma subunit, sigma24 homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663251.1"
                     /db_xref="GI:338529917"
                     /db_xref="GeneID:10874700"
                     /translation="MQGLRMTTLRLSKEADEPDAATAPGGDEALLARRALAGERAAWD
                     ALVARHHRRVVVSLLARGVRVDRAQELAQETWARLIQQQQRGLLTELRLPNLALTQAA
                     FLAADDARRARRESIAGAVEELPERHHPVDPAVSAERRLLSEEQLSRAHAALAQVSPS
                     ARNVFLLACDGQELPHAEVASRVGLSVQRVRQILCEVRKKLRTALEEETHA"
     misc_feature    286064..286627
                     /locus_tag="LILAB_01205"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK12513"
                     /db_xref="CDD:183566"
     misc_feature    286460..286609
                     /locus_tag="LILAB_01205"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     misc_feature    order(286475..286477,286505..286507,286526..286531,
                     286559..286561,286565..286570,286574..286582,
                     286586..286591,286595..286597)
                     /locus_tag="LILAB_01205"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            286632..287186
                     /locus_tag="LILAB_01210"
                     /db_xref="GeneID:10874701"
     CDS             286632..287186
                     /locus_tag="LILAB_01210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663252.1"
                     /db_xref="GI:338529918"
                     /db_xref="GeneID:10874701"
                     /translation="MLKPHLTRDSAEQYILGALAPEKAASLEAHTLECEPCARLLQEE
                     ALLSEQLHEVASTCSPAAAVIRPARWDARRHVAGLAGAALAAAAAVVFVVLPGERPPP
                     ASPRTIALDVTPPTVGLETEVAEPQAIVVACPDLATQASCTQAAEERGLLVQYPWGTG
                     EVPRYEARTGLPEGALSARRPVSL"
     gene            287198..288361
                     /locus_tag="LILAB_01215"
                     /db_xref="GeneID:10874702"
     CDS             287198..288361
                     /locus_tag="LILAB_01215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663253.1"
                     /db_xref="GI:338529919"
                     /db_xref="GeneID:10874702"
                     /translation="MDFRKKLAALLLALASTGAGAQPSEGTQKLPVGWYVTESAPKRY
                     EAGVDSSATCEGSRSAYLRSLSPDSNGYGTFMQAFGAQDFRGKRLRFSGALRIKDVEG
                     WAGLWMRVEGPDPKQPLAFDNMQSRALVGTAGCKRYDVVLDVPKEATTIMAGLIMSGT
                     GQAWLDGVRFEVVDASVPVTDLLASRPVVAASSPSGLEDAPEPVAKNDPLPLGRVGDV
                     WFNQGRIAADKPYTRRKDGVWVSILGEEVYEHGIAVTGTLGQRALDLKLKAGGRRTLV
                     EGTWGDEPVDIQLTPEKLTLRWGRNTRELARHLDPQVDATCNRYQKTEGPRVTDQLDV
                     CGAALGTRPPSAQLVIALLANGFSPTLPAGSAPIPQPPVRSRQALDTERTAVP"
     gene            complement(288421..289608)
                     /locus_tag="LILAB_01220"
                     /db_xref="GeneID:10874703"
     CDS             complement(288421..289608)
                     /locus_tag="LILAB_01220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663254.1"
                     /db_xref="GI:338529920"
                     /db_xref="GeneID:10874703"
                     /translation="MIVGDTLSRYAARRSQLLSGMASPGEVLEAAGDLLRRRSRLETE
                     GVDAALRGLGRPQVEAWLKSQKPQSLQPVLLRAAEEAVEVVLDGGEEADMWRTSALEG
                     LSARDRAASAAHALAVWEGFHGALDGDAAQLRDRFLAALQSLDSALSSRARWFIPLNP
                     QRRQERDLLEPAEQDAAWWFSARAGCDDLVATWTASPQTLTPHLQECEACRADMADAA
                     PVDMPPRRHLTADDLWRLDMGLLSEDERTRLDAHTARCGECAQAVLALDEGEAAIDEA
                     LDMEEDGTVARSARTSRAPVSHRAHAARLPEQREVLDERRDFRVVLVRERQRVRLLVQ
                     PLAGRAVTAAVFLSPGRPSLKPAHGPEGIAFDLTSASATGARSAHLSVQAGSETLERD
                     FAF"
     gene            complement(289657..290325)
                     /locus_tag="LILAB_01225"
                     /db_xref="GeneID:10874704"
     CDS             complement(289657..290325)
                     /locus_tag="LILAB_01225"
                     /note="COG1595 DNA-directed RNA polymerase specialized
                     sigma subunit, sigma24 homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663255.1"
                     /db_xref="GI:338529921"
                     /db_xref="GeneID:10874704"
                     /translation="MYEQLTDDELFAEVVRRRATNEPYQGPLGALVQRWARPSRYVIS
                     KIQASYGRGSPADSDELFQDAVGKFIDRGLDQFRGVSEQMPGRSASPKTFFLRIVKHV
                     AIDFYRKHREELAAPPADPDDAMEEPPSQVARAVEFGKRREERAEAQELYWAAFARLQ
                     QEHPKEASAWDLYHHEDVEDHEECARRLNITVVNSYKRVSRAQAYLKLYLLDLQRESY
                     GEGA"
     misc_feature    complement(289993..290235)
                     /locus_tag="LILAB_01225"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(289696..290169)
                     /locus_tag="LILAB_01225"
                     /note="DNA-directed RNA polymerase specialized sigma
                     subunit, sigma24 homolog [Transcription]; Region: RpoE;
                     COG1595"
                     /db_xref="CDD:224511"
     gene            290760..291467
                     /locus_tag="LILAB_01230"
                     /db_xref="GeneID:10874705"
     CDS             290760..291467
                     /locus_tag="LILAB_01230"
                     /note="COG0639 Diadenosine tetraphosphatase and related
                     serine/threonine protein phosphatases"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase family
                     protein"
                     /protein_id="YP_004663256.1"
                     /db_xref="GI:338529922"
                     /db_xref="GeneID:10874705"
                     /translation="MSRRTIVIGDLHGCYDEAVELLDKVGATSSDRVIFAGDLVDRGP
                     KRRECVELAMRHEAVLGNHEEKHLQQRHRADERLLPDHLETRRVLEAEHYAWMAGLPH
                     YLRLPEHNAIVVHAGMLPGRPVEEQDAYHLLHAQCIRPPATKSYWPSKAPAGWTFWTH
                     HWKGPERVIFGHTAFDAPLVTEYAVGIDTGCVYGHSLTAVVLPTWEFVSVPARSTYRG
                     GKRVARIAVHGDVSVFS"
     misc_feature    290760..291416
                     /locus_tag="LILAB_01230"
                     /note="diadenosine tetraphosphatase; Reviewed; Region:
                     apaH; PRK00166"
                     /db_xref="CDD:234673"
     misc_feature    290775..291365
                     /locus_tag="LILAB_01230"
                     /note="phosphoprotein phosphatases of the
                     metallophosphatase superfamily, metallophosphatase domain;
                     Region: MPP_PPP_family; cd00144"
                     /db_xref="CDD:163613"
     misc_feature    order(290787..290789,290793..290795,290871..290873,
                     290883..290885,290943..290948,291102..291104,
                     291159..291161,291273..291275)
                     /locus_tag="LILAB_01230"
                     /note="active site"
                     /db_xref="CDD:163613"
     misc_feature    order(290787..290789,290793..290795,290871..290873,
                     290943..290945,291102..291104,291273..291275)
                     /locus_tag="LILAB_01230"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163613"
     gene            291634..293403
                     /locus_tag="LILAB_01235"
                     /db_xref="GeneID:10874706"
     CDS             291634..293403
                     /locus_tag="LILAB_01235"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663257.1"
                     /db_xref="GI:338529923"
                     /db_xref="GeneID:10874706"
                     /translation="MTTQTQHPNALLPEAQRGPAERLLDLVLSGSAHLWHNRPGLEVN
                     GIWHAAAHATPFQREKGRPVKPGLFVPAAVRLYRQLLDIYKLNAELMAHFASYALTQT
                     DWRDLKVATCALMLVQEHAGQPVRDEQGGVAFHDDDWRAIGEAMVLHYERKSTRMLTP
                     KAVLRVAELLEHPEIARLNREAGFGDPASRKAPLGRWRRVASKWLAAREANLPMLQGL
                     VKAGYKETLKKLARKAGYKPRAQGFFEVLGWKQKQSAQGHREVGLNGLTLVKRERFDG
                     LSEAEICEWIDLERLSYKEVVGRLPKDVGLTPAIMVALLPSLSDRDLRLMTPTLEDLG
                     LLTDPAIRARWEKAVQTATDQRALNIAKNVRGEALRARLEEASDNAARQAVAEATAET
                     DVRVMFLVDKSGSMEGAIESSKEALSRILAGFPMDKLHIAAFDTLGTVLRPKAASRIA
                     VQHMLAGLRASGGTAHASAVYALHRAGVQVPEGAKLVVIVVGDEAGEAGDQFARAFRD
                     LRIPVSAMALLVSVAHARGSTVRTCAAQLGVPFSEVDVAQFEDPYQVPRVLKALLDAP
                     TLPGARQSGWVERVLRTPLLKVA"
     misc_feature    292813..293187
                     /locus_tag="LILAB_01235"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    order(292834..292836,293023..293025,293110..293112)
                     /locus_tag="LILAB_01235"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            293434..294402
                     /locus_tag="LILAB_01240"
                     /db_xref="GeneID:10874707"
     CDS             293434..294402
                     /locus_tag="LILAB_01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663258.1"
                     /db_xref="GI:338529924"
                     /db_xref="GeneID:10874707"
                     /translation="MDYRKFLGKVESRVLPYFGGGTVDSASRRLRVTTPVKPGWWRFD
                     VKGRDATPREPSEPEGLEVLPRVRGHVWGRRLVREGAVAEPLALMPEEEPPRLAPVSA
                     RRWVDGALLFESVDFESEAEGAARLALEEDQPLSGIRGVSASLRAAFGYALLAQVSRD
                     VGIRFVPAEVRGRILAVAEGGRVPAEDCLRRLSLEREAHASRLRQAQAHAERRALSAR
                     LVAEAQRRTGHLGASEDGMQRAQQALLNAGARPLGLRRLADQRLEVTYAFMGERFVSI
                     VAADSLQVLDAGICLAGADGEVTLESLPSVIREAIETEVLVVTRYA"
     gene            294413..294784
                     /locus_tag="LILAB_01245"
                     /db_xref="GeneID:10874708"
     CDS             294413..294784
                     /locus_tag="LILAB_01245"
                     /note="COG0536 Predicted GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663259.1"
                     /db_xref="GI:338529925"
                     /db_xref="GeneID:10874708"
                     /translation="MPTREVCLLISGDGEVLWCDASDSPLQLPDSRARWEAIWRLRDV
                     LEEVAHSHPEGPLGFSAEDESTMAALTSALGKPLRFSVVAPEGMVARRQGRDVLVADE
                     PWWAEALRGASGIRHTPGGLA"
     misc_feature    <294497..294634
                     /locus_tag="LILAB_01245"
                     /note="Mpr1p, Pad1p N-terminal (MPN) domains; Region: MPN;
                     cl13996"
                     /db_xref="CDD:265414"
     gene            complement(294789..295295)
                     /locus_tag="LILAB_01250"
                     /db_xref="GeneID:10874709"
     CDS             complement(294789..295295)
                     /locus_tag="LILAB_01250"
                     /note="COG5502 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663260.1"
                     /db_xref="GI:338529926"
                     /db_xref="GeneID:10874709"
                     /translation="MPNDREQGKGAPQGSERQTSRRDTPIEVRRRLRHESRTSQTYAA
                     FIKHLCERGGMSPAVAEKAAVAVLCALEQRILSEEASDLEDQLPRKLTLLLHRCEKHE
                     DELPPKFHREHLLRRVGEDLSLQPDAVEPVVRAVMDAVRDQITEGEAEDVMGQLPPDI
                     RDLWTRTV"
     misc_feature    complement(294804..295175)
                     /locus_tag="LILAB_01250"
                     /note="Uncharacterized conserved protein (DUF2267);
                     Region: DUF2267; pfam10025"
                     /db_xref="CDD:255704"
     gene            complement(295403..297700)
                     /locus_tag="LILAB_01255"
                     /db_xref="GeneID:10874710"
     CDS             complement(295403..297700)
                     /locus_tag="LILAB_01255"
                     /note="COG2303 Choline dehydrogenase and related
                     flavoproteins"
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="YP_004663261.1"
                     /db_xref="GI:338529927"
                     /db_xref="GeneID:10874710"
                     /translation="MVVVGSGYGGAITASRLARAGQQVCVLERGRELLPGDYPRTDAE
                     FMSELQVHFDPEAAADVGSPTALFELHRGGDVSVVTGCGLGGTSLINANVAMRPDPRV
                     FLDTRWPDAFRADVDGLLEDGFAWAEHMLRPLPYPEAAPPLATLAALARSAEKLGGTF
                     RRPPLTVTFEEGVNAAGVRQGACTLCGDCMTGCNFGAKNSVLMNYLPDAHRHGAKLFT
                     EVGVRYLARDGARWRVYYRPMNAGRERFDAPDLWLTADRVILAAGTLGTAEILLRSKA
                     LGLPLSGQLGQRFSNNGDVMAFGYNTDVPVHGVGLGEAPAAGREPVGPTISGIIDDRA
                     TLRQEDGMVIENGAIPAALARPVTALLAAASALAGQDTDRGVIDRVEELARIADSAVR
                     GPYHGAMRNTQTFLVMSHDDGAGQLRLSGDRVRVDWPDAGRQAVFTRVDERLRRATEA
                     LGGTFVRNPLWSKLTGHELLCTHPLGGCAMGERAEEGVVDHEGRVFAGPEGTEVHEGL
                     YVSDGSVIPRPLGINPLLTISAVAERTVALMARRHGWSVDYSPVPEAPGPKPARPLAV
                     QFTETMYGYISAGADEDFLRAGDPARRDTSPFRFIVTVDTRDLEATLAHPLHPMQLSG
                     SVVAPVLSSRPMTVEHGVLHLMTHEGARPGGRRMRYQLPLVSESGERFFVDGYKDVHD
                     DDGPDLWVDTTRLLVSIFHGEDASGPCIARGYLRLNAKDFAVQLSTLRVLHAQGTVQR
                     LAALARFGRFFFGELFETYVRSKAA"
     misc_feature    complement(296069..297697)
                     /locus_tag="LILAB_01255"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    complement(<297602..297694)
                     /locus_tag="LILAB_01255"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(296879..297460)
                     /locus_tag="LILAB_01255"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(296102..>296365)
                     /locus_tag="LILAB_01255"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(297945..298646)
                     /locus_tag="LILAB_01260"
                     /db_xref="GeneID:10874711"
     CDS             complement(297945..298646)
                     /locus_tag="LILAB_01260"
                     /note="COG1515 Deoxyinosine 3'endonuclease (endonuclease
                     V)"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="YP_004663262.1"
                     /db_xref="GI:338529928"
                     /db_xref="GeneID:10874711"
                     /translation="MELQPEVSRWDVTPSEAVALQRRLREQLVLRPPPGLKVERVAGA
                     DISTEKGKDTGFGGLVVLDVATLAPVARSGAAVTLHFPYVPGLLSFRELPIIAAAWER
                     LTVRPDVVIFDGQGTAHPRRMGIACHGGLLFGVPSIGCAKSLLVGTHGPLGETRGATA
                     PLLHRGEVVGMAVRTRKGVQPVYVSPGHLMDLPTAVDLVLKVSPKYREPETTRHAHRL
                     VNALRRADGEAAELE"
     misc_feature    complement(297984..298607)
                     /locus_tag="LILAB_01260"
                     /note="Endonuclease_V, a DNA repair enzyme that initiates
                     repair of nitrosative deaminated purine bases; Region:
                     Endonuclease_V; cd06559"
                     /db_xref="CDD:143472"
     misc_feature    complement(order(297987..297989,297999..298001,
                     298212..298226,298272..298277,298290..298292,
                     298302..298310,298383..298394,298398..298400,
                     298503..298508,298512..298514))
                     /locus_tag="LILAB_01260"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            298963..300270
                     /locus_tag="LILAB_01265"
                     /db_xref="GeneID:10874712"
     CDS             298963..300270
                     /locus_tag="LILAB_01265"
                     /note="COG1404 Subtilisin-like serine proteases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aqualysin I"
                     /protein_id="YP_004663263.1"
                     /db_xref="GI:338529929"
                     /db_xref="GeneID:10874712"
                     /translation="MNRHTLKLFVSVGMMLLMGACASRQVPCKDRTVSRPTVGQKRAG
                     KFIAVKKKIPGEYIVVLKSPAQSLEQVQVQQATANLTTAYGGTAFAMYENALRGFAAK
                     MTEAQARAMADDPAVDYVQENGVVKIAESQQGPTWGIDRMDQRKLPLDKLYTFTATGQ
                     GVHIYILDTGVRFSHREFGGRASVGFDAIGDSMRGNDCNGHGTHVAGTAAGASYGLAR
                     NAIVHSVRVLGCDGSGATSGVIAGVDWVTRNHVSPAVANMSLGSDVDPALDDAVRRSI
                     AAGVTYVVAAGNEDNDACKHSPARTPEAITVAATDNKDKRATFSNWGDCVDVFAPGNK
                     IKSSWHYGDKESRELSGTSMATPHVTGLAALFLEANPTAKPEAVASAVNANATPDTVS
                     NPGWCSPNLMAYSGFITAIPGLPVVQLKDYLPKPAVVSSSEPR"
     misc_feature    299128..299349
                     /locus_tag="LILAB_01265"
                     /note="Peptidase inhibitor I9; Region: Inhibitor_I9;
                     pfam05922"
                     /db_xref="CDD:253461"
     misc_feature    299371..300090
                     /locus_tag="LILAB_01265"
                     /note="Peptidase S8 family domain in ProteinaseK-like
                     proteins; Region: Peptidases_S8_PCSK9_ProteinaseK_like;
                     cd04077"
                     /db_xref="CDD:173790"
     misc_feature    order(299380..299382,299389..299394)
                     /locus_tag="LILAB_01265"
                     /note="calcium binding site 2 [ion binding]; other site"
                     /db_xref="CDD:173790"
     misc_feature    299452..300090
                     /locus_tag="LILAB_01265"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    order(299464..299466,299563..299565,299740..299745,
                     299824..299826,300010..300012,300019..300021)
                     /locus_tag="LILAB_01265"
                     /note="active site"
                     /db_xref="CDD:173790"
     misc_feature    order(299464..299466,299563..299565,300019..300021)
                     /locus_tag="LILAB_01265"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:173790"
     misc_feature    order(299866..299868,299872..299874,299941..299943)
                     /locus_tag="LILAB_01265"
                     /note="calcium binding site 1 [ion binding]; other site"
                     /db_xref="CDD:173790"
     gene            complement(300296..303928)
                     /locus_tag="LILAB_01270"
                     /db_xref="GeneID:10874713"
     CDS             complement(300296..303928)
                     /locus_tag="LILAB_01270"
                     /note="COG0265 Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain"
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="YP_004663264.1"
                     /db_xref="GI:338529930"
                     /db_xref="GeneID:10874713"
                     /translation="MRTAPEASAKVLSSRRRTEEEEVLGDFSIDVDLEPEAPAPPRRV
                     RPAPAPRAARAPGLAGRLRDRWSAWVPEESTSGARIAAVFLLVNAALTVAGHFLYPHS
                     RVVDVSGWVSSAVDVALAVGLLVGARRAHSLMLVRLFLGLLLMLGTAAFAAPSVVVLQ
                     AGGMLGLLLLLVGAPGARRQTAGALVSGATCLILVVLLSSRFTQTSPLDGWVLRLDGA
                     LEPGAVTDVQGLDADYTLTFPATGWRQARPEHVAKMSPGFDRVWLLPARGAVVSTRVL
                     HVPGAGGVDLDEAAEKMLESRPDAEEGAEDTEVVATEPIDGTFDAARRYHLRLRKDGQ
                     PMEAHAAVVVQGDYAFFIDAVAPRHRFASLDQELADIVASFAFQVVTPRLEAGVLDKV
                     RQAAVQVLSGEASGSGFVIHSENERTLVITNDHVIREKGEVPRFVKVVMMTRSGRREV
                     FDAIVAASDEEQDLALLSLTEAFGTWPALDFRHTAKLPPRSPLFVVGFPFGGSLAVRG
                     TYPEVSLNAGWMASRTPAPLLEKGLRVVDVGINPGNSGGAVVDASGRVLGVAVAHVQG
                     SATSVVISTETVSDWLRRAKDFTLTFDDRELDVAEASQHALHAEGEARARAATVLVRS
                     AQGSTAGVIVGRKGEHHLLVIASLDALGEAWRPGTALPEMTVRFRPAQPESVDRKAEV
                     LRASAEAGMVLLSVVGRPDDAEPLEPASASKHDSGTPVRVLGYRLGEDGKLLRKNPSA
                     QAAAGAVASVQRDSNQQVRFLHVDVGVNYGQTTGPVLDAQGALVGLAVARVKNTNVSL
                     VLPGENLVGLLRGGIRSGGWKLFRDRDGRCALSVLAVLDNPLGVSQTVQVRMSREPVY
                     GEPSGPAGVKPLGEALIAADAGHRSQLELTAEVDCAAVAPSVQLGLVDSQGSRYTAPG
                     RGEHRSGGMLMGLVAGTSGAGDEADDMVEFFLSPVPAPGAWGQECAEGDAVLCRQQCD
                     VAQSRPCLRLGRLHLEASRHAEALAAFTRSCSLGNLNGCIELGLASQSMGSRRGSIAW
                     PDESEERLRKVCQASSQHPDSRRACWALRPESYDTALSSAVRLCASSRVQCTELGHLY
                     LAGSWNPQRFGTSAAKAFSMGCETGDAQACLSLARLQLEGVGVPRNIRVAMNTFEKHC
                     QQGRYLGCEDLARMHATGLGVPKNLAESRRLMREICRTGVSRSPHCEFVRHQARNERL
                     GTARRE"
     misc_feature    complement(<302207..302869)
                     /locus_tag="LILAB_01270"
                     /note="Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: DegQ; COG0265"
                     /db_xref="CDD:223343"
     misc_feature    complement(302252..302713)
                     /locus_tag="LILAB_01270"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(301571..>301912)
                     /locus_tag="LILAB_01270"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(<300374..300628)
                     /locus_tag="LILAB_01270"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(300482..300586)
                     /locus_tag="LILAB_01270"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            304478..304726
                     /locus_tag="LILAB_01275"
                     /db_xref="GeneID:10874714"
     CDS             304478..304726
                     /locus_tag="LILAB_01275"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663265.1"
                     /db_xref="GI:338529931"
                     /db_xref="GeneID:10874714"
                     /translation="MATLNITYDGMSADVPVELDGPVPDADIRRIATELVRSGGVPGL
                     HLSQLRDDAFAHFVVDRLRGARGVERIYLRPKVPFGAR"
     gene            304736..305305
                     /locus_tag="LILAB_01280"
                     /db_xref="GeneID:10874715"
     CDS             304736..305305
                     /locus_tag="LILAB_01280"
                     /note="COG0476 Dinucleotide-utilizing enzymes involved in
                     molybdopterin and thiamine biosynthesis family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiF domain-containing protein"
                     /protein_id="YP_004663266.1"
                     /db_xref="GI:338529932"
                     /db_xref="GeneID:10874715"
                     /translation="MRILFCGVGAIGSLAAVLCRNLEATLVFVDFDRVESKNLLSQAY
                     VKPSVGRNKAEALKLQFLNLHGVKAEAHGVRLTRDNAEALCGGADLLVDCMDNHHSRQ
                     VLIDYARQAGKPLVHGAVSADGTFGLVRWDDRFVPDAEDAPGQATCEGGAHLPLLGLL
                     AATLARAIQDFVKQGTRRDSLVNLSAVVS"
     misc_feature    304739..>305182
                     /locus_tag="LILAB_01280"
                     /note="Superfamily of activating enzymes (E1) of the
                     ubiquitin-like proteins. This family includes classical
                     ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
                     activating enzymes and other mechanistic homologes, like
                     MoeB, Thif1 and others. The common...; Region:
                     E1_enzyme_family; cl17196"
                     /db_xref="CDD:266547"
     misc_feature    304739..>305134
                     /locus_tag="LILAB_01280"
                     /note="Dinucleotide-utilizing enzymes involved in
                     molybdopterin and thiamine biosynthesis family 2 [Coenzyme
                     metabolism]; Region: ThiF; COG0476"
                     /db_xref="CDD:223552"
     misc_feature    order(304754..304756,304760..304762,304766..304768,
                     304823..304825,304829..304831,304856..304858,
                     304892..304894,305015..305017,305033..305035)
                     /locus_tag="LILAB_01280"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238760"
     misc_feature    order(304766..304768,305036..305038,305090..305095,
                     305108..305110)
                     /locus_tag="LILAB_01280"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238760"
     gene            complement(305323..305916)
                     /locus_tag="LILAB_01285"
                     /db_xref="GeneID:10874716"
     CDS             complement(305323..305916)
                     /locus_tag="LILAB_01285"
                     /note="COG0778 Nitroreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="malonic semialdehyde reductase"
                     /protein_id="YP_004663267.1"
                     /db_xref="GI:338529933"
                     /db_xref="GeneID:10874716"
                     /translation="MSEARSEELALLFREARTHNAWLDRPVDDALLARVYELARMGPT
                     SANAHPMRLVFVKSADAKAKLLPAVLPLNFDKVRTAPVTAIVAYDSAFYEFMPQLFPA
                     RPEMRDVMAGYPAEGRAKLAEQSAFLGAGYVILAARALGLDVGPLGGFDPAGVDAAFF
                     PDGKWRSVLLLNLGYGDSSQLHPRNPRLSFGQACRVA"
     misc_feature    complement(305326..305901)
                     /locus_tag="LILAB_01285"
                     /note="malonic semialdehyde reductase; Provisional;
                     Region: PRK05365"
                     /db_xref="CDD:180040"
     misc_feature    complement(order(305470..305475,305779..305781,
                     305857..305859,305863..305865,305869..305871))
                     /locus_tag="LILAB_01285"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239015"
     misc_feature    complement(order(305512..305514,305521..305526,
                     305533..305538,305542..305544))
                     /locus_tag="LILAB_01285"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239015"
     gene            306099..307037
                     /locus_tag="LILAB_01290"
                     /db_xref="GeneID:10874717"
     CDS             306099..307037
                     /locus_tag="LILAB_01290"
                     /note="COG2207 AraC-type DNA-binding domain-containing
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004663268.1"
                     /db_xref="GI:338529934"
                     /db_xref="GeneID:10874717"
                     /translation="MLGVSLLRNALYKRIEARAPWGIRLRTHERAVFYLIARGAGRLE
                     VEGERPLDLSVGDAAFLPHGTGHVLRDALTTPPLDAHDGRRCTEPGPRKLGGSGAPTS
                     ILTGFFDLGGRPPSLLASLPRVVALSPNDRATVPWVSATLQLLLAEAAHPGPASMLVL
                     QRLADVLFVQALRSLATTGGTSGHVCRHPGIAALGDDAIREALGLIHQRPGAPWTVAS
                     LGTQVGLSRSTFAARFTELVGEPPLEYIARWRMTRAAEFLRDTDLAIDDIAARVGYES
                     VPSFSRAFVRFRGERPGAYRRSARERARLDAEPTPG"
     misc_feature    306117..306623
                     /locus_tag="LILAB_01290"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    306714..306836
                     /locus_tag="LILAB_01290"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    306735..306986
                     /locus_tag="LILAB_01290"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            307417..307491
                     /locus_tag="LILAB_t36737"
                     /db_xref="GeneID:10874718"
     tRNA            307417..307491
                     /locus_tag="LILAB_t36737"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:10874718"
     gene            307498..307571
                     /locus_tag="LILAB_t36739"
                     /db_xref="GeneID:10874719"
     tRNA            307498..307571
                     /locus_tag="LILAB_t36739"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:10874719"
     gene            307575..307647
                     /locus_tag="LILAB_t36741"
                     /db_xref="GeneID:10874720"
     tRNA            307575..307647
                     /locus_tag="LILAB_t36741"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:10874720"
     gene            complement(308280..308540)
                     /locus_tag="LILAB_01295"
                     /db_xref="GeneID:10874721"
     CDS             complement(308280..308540)
                     /locus_tag="LILAB_01295"
                     /note="COG3415 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004663269.1"
                     /db_xref="GI:338529935"
                     /db_xref="GeneID:10874721"
                     /translation="MHSFQGMRPARSPAELGLTAYDRRKLERALRQSRDARHFRRLLA
                     IKLIAEGKAPGEAAHLAALSRPAVYFWPPPNLFPTNYTRFGT"
     misc_feature    complement(<308328..308438)
                     /locus_tag="LILAB_01295"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     gene            complement(308676..309071)
                     /locus_tag="LILAB_01300"
                     /db_xref="GeneID:10874722"
     CDS             complement(308676..309071)
                     /locus_tag="LILAB_01300"
                     /note="COG3328 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004663270.1"
                     /db_xref="GI:338529936"
                     /db_xref="GeneID:10874722"
                     /translation="MDDTEFESPAHEEVQADLRALFRGAIRMTLEALLEEAVRELVGA
                     GRWQRMVGRADVRNGSYLRTLVTTAGAVDVTVPRTRHSGSAGEVLGRYKRRSAELDEA
                     ITSAYVQGVSTRKMGKVTRALMGVDAHVC"
     misc_feature    complement(<308688..309029)
                     /locus_tag="LILAB_01300"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(<308688..309014)
                     /locus_tag="LILAB_01300"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            309552..309637
                     /locus_tag="LILAB_t36743"
                     /db_xref="GeneID:10874723"
     tRNA            309552..309637
                     /locus_tag="LILAB_t36743"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:10874723"
     gene            309882..309954
                     /locus_tag="LILAB_t36745"
                     /db_xref="GeneID:10874724"
     tRNA            309882..309954
                     /locus_tag="LILAB_t36745"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:10874724"
     gene            310065..310135
                     /locus_tag="LILAB_t36747"
                     /db_xref="GeneID:10874725"
     tRNA            310065..310135
                     /locus_tag="LILAB_t36747"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:10874725"
     gene            310160..310702
                     /locus_tag="LILAB_01305"
                     /db_xref="GeneID:10874726"
     CDS             310160..310702
                     /locus_tag="LILAB_01305"
                     /note="COG1403 Restriction endonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease domain-containing protein"
                     /protein_id="YP_004663271.1"
                     /db_xref="GI:338529937"
                     /db_xref="GeneID:10874726"
                     /translation="METLVLSQSFEPVARVPWQRAVMLIFQGKVEVVEEYEDRVVRSV
                     TVEIRMPSVIRFIRGLRRRPKGVKFSRENVYLRDSCRCQYCGTRVTRPEATHDHVLPR
                     AQGGKTSWENIVIACVPCNQKKGNRTPEQARMALRTAPTKPKKVPEAMHLTFLFEKGM
                     PMSWAKFLRDVAYWHVELQE"
     misc_feature    310370..310534
                     /locus_tag="LILAB_01305"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(310442..310444,310448..310456,310460..310462,
                     310493..310498,310508..310513,310520..310522,
                     310532..310534)
                     /locus_tag="LILAB_01305"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            310952..313774
                     /locus_tag="LILAB_01310"
                     /db_xref="GeneID:10874727"
     CDS             310952..313774
                     /locus_tag="LILAB_01310"
                     /note="COG0542 ATPases with chaperone activity,
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ClpA/B family protein"
                     /protein_id="YP_004663272.1"
                     /db_xref="GI:338529938"
                     /db_xref="GeneID:10874727"
                     /translation="MATRKSEDQERLIDRDLTALAREGKLPAAHGVDAAVTEVLGLLT
                     RGGKHPLLSGEAGVGKSALVQEVARRIAEGRVDAGLANARVVEVSVANILARSTQRQA
                     AESFEELLTYLSRHPRPIVYIRDLPAALGGPLAPVAVRGLRTVGLRFIFETEPKRVQE
                     LLRSDEALAERLHLLPLHEPPPEKARWVLGRVAEELERELRLPIDPAACDLALRLSSK
                     FLLAQRMPRKAIELLKETAAEAASAAKDHVGPEDVLSRFCAATRLPRFVVDDAMPLDL
                     EETERFFGERLLGQTDAVSAVLRSVALLKAGLNDPRRPLGVFLFAGPTGVGKTQLAKL
                     LAEYLFGSADRLVRLNMADYPNDGDESVPFGATWAPALETRRGELSALLDGKVFTVLL
                     LDEFEKAARSVHDRFLQLFDEGTFVNGAGETVSCNNTLIVATSNVGAEVYRESGMGFT
                     GARRAEEMVPEVDRRIGEAFRPEFLNRFDAICHFRPLSKVDIRKIAQREVGRVLEREG
                     IRARALDVEVTPAVVDLLVERGYSPQFGARYLQREIEKTLTAALAVEIARKPLPPGTP
                     VRVEARPGGRVTAVAEPAAPPPSPTAQILLPSARAAPVKRRLDRKSLLFEMDRLVGKA
                     RALADSTGRPQLEQRRAELLAETQAPNLWDDPTRAAEVLRAFRAVEAQINELERLEAA
                     VLFARRLVREAKNEVQLGSAAKQVEDVAREVQMSAALHASGATTQDTEALVDICASDS
                     AEAQETWVQELATMYLGWAQRRGYEAVAVAEAEEPSRVVVRIAGPGAYGFLAGEAGMH
                     RRLEDEKRQRAYVRVHRGGTLSEEELAYLEVQGRPMKSHEGAYLQRVRTEVTVKDESS
                     GRVLTLAGATELDELKDIAARVVYGQGSHTDEARRYYLGRGARVEDPRTGAGTPRVKD
                     VLRGELDVFIAAWISRPPTDSQPPGN"
     misc_feature    310994..312664
                     /locus_tag="LILAB_01310"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    311042..>311239
                     /locus_tag="LILAB_01310"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    311111..311134
                     /locus_tag="LILAB_01310"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    311114..311137
                     /locus_tag="LILAB_01310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    311855..312259
                     /locus_tag="LILAB_01310"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    311915..311938
                     /locus_tag="LILAB_01310"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(311918..311941,312131..312133,312257..312259)
                     /locus_tag="LILAB_01310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    312119..312136
                     /locus_tag="LILAB_01310"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    312410..312658
                     /locus_tag="LILAB_01310"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     misc_feature    312857..313735
                     /locus_tag="LILAB_01310"
                     /note="peptide chain release factor 2; Region: prfB;
                     TIGR00020"
                     /db_xref="CDD:232785"
     misc_feature    <313175..313333
                     /locus_tag="LILAB_01310"
                     /note="PCRF domain; Region: PCRF; cl17745"
                     /db_xref="CDD:266807"
     gene            complement(313790..314284)
                     /locus_tag="LILAB_01315"
                     /db_xref="GeneID:10874728"
     CDS             complement(313790..314284)
                     /locus_tag="LILAB_01315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663273.1"
                     /db_xref="GI:338529939"
                     /db_xref="GeneID:10874728"
                     /translation="MFGREVPVGKGRPTLVLYANKGSRDELRQHAYSFIYDLREERPI
                     VLIHVDLRDVPGLFKGMARGEIKKSHRESIEHMRNIFRQHGEAPPPELESSLYMVADA
                     KGEPHQAMGLKKGFGQVVARVLGPSGQEVARGPFPESARKLGQSMASAPERLSTLRVV
                     DMSR"
     gene            314595..315791
                     /locus_tag="LILAB_01320"
                     /db_xref="GeneID:10874729"
     CDS             314595..315791
                     /locus_tag="LILAB_01320"
                     /note="COG0726 Predicted xylanase/chitin deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase domain-containing
                     protein"
                     /protein_id="YP_004663274.1"
                     /db_xref="GI:338529940"
                     /db_xref="GeneID:10874729"
                     /translation="MYRRLITLLFLSLAAPAFAAKPFTEGMVTITLDDGWATQYSLAR
                     PELNARNVPATYGLVTLAIHESWAGYINLTQAQTLVTEGNDIASHTLTHPDLTALSPA
                     QLLAELQDSRTWLENALGLPAVPNLIVPYGLQNGPVLDAIRQHYASSRTVNAGRNFRD
                     TVVYELRANDVARTVPVSTVQGWVDQAIAEKSWLILVFHEFTNGTPTRDTEYLTSQFA
                     DILDYVQTQGVRTVTLSEGLALTEGRTEPDLTAGLFVYNDALQNGFADWSWADHSLDE
                     TGVVHTGSASIRFEPDTWNGLLFHHHGLDLADHQSLRVWVHGGTVGGQAVRLVLHDGA
                     QLLGTIRLDTALGGPIAPGVWQQVSIPLASIGATTGTLRDIYFQDDSGTDQPVMYLDD
                     LVLLPH"
     misc_feature    314670..315263
                     /locus_tag="LILAB_01320"
                     /note="Putative catalytic NodB homology domain of
                     uncharacterized prokaryotic polysaccharide deacetylases
                     which consist of a 6-stranded beta/alpha barrel; Region:
                     CE4_DAC_u1_6s; cd10970"
                     /db_xref="CDD:213027"
     misc_feature    <314673..315338
                     /locus_tag="LILAB_01320"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    order(314691..314696,314859..314861,314871..314873,
                     314982..314990)
                     /locus_tag="LILAB_01320"
                     /note="putative active site [active]"
                     /db_xref="CDD:213027"
     misc_feature    order(314694..314696,314859..314861,314871..314873)
                     /locus_tag="LILAB_01320"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:213027"
     gene            complement(315805..316647)
                     /locus_tag="LILAB_01325"
                     /db_xref="GeneID:10874730"
     CDS             complement(315805..316647)
                     /locus_tag="LILAB_01325"
                     /note="COG2030 Acyl dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC domain-containing protein"
                     /protein_id="YP_004663275.1"
                     /db_xref="GI:338529941"
                     /db_xref="GeneID:10874730"
                     /translation="MRAAVARRPARPGEVPRLDVRVRGFTPDAGQLARYREVCGFPED
                     GYLPLPFPQVLATSLHLTLLNHPDFPYRLLGMVHVRNHIQQQRRLRAGARLSVHAWVE
                     GQREARQGRELDLHTEVEEDGALVWSAVTTMLRRLPGMGERPREAGRPPATDEAQVFA
                     ASRPASWSVPENAGRRYARASGDYNPIHLYGFTARPFGFPRAIVHGMWTVGRCVAEMG
                     EAAEAPALTLRSEFRRPLLLPSRVVFQTAPQPEGAVAYRVMSEDGQPHLLGRLSPEGG
                     PRAR"
     misc_feature    complement(<316015..316122)
                     /locus_tag="LILAB_01325"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     gene            316965..320309
                     /locus_tag="LILAB_01330"
                     /db_xref="GeneID:10874731"
     CDS             316965..320309
                     /locus_tag="LILAB_01330"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine kinase family protein"
                     /protein_id="YP_004663276.1"
                     /db_xref="GI:338529942"
                     /db_xref="GeneID:10874731"
                     /translation="MLARVTPPGAAAQRTAAARDIVTDTATSAGGPPEDDTLPTELIR
                     VGNGPALRQPPAPMNKAGERTPRHAVRRTGLAAHLDAPPPEGSGALAAPPAPAAPGFS
                     AAPSALPAPSGLAAPPAPPPPTSVAVPPPTPPQDLSGRILPAAHEGAPSPGVSGKNFA
                     GAHVLPHGGRLLSAAAEARGSRATLSIPMAPMPAKAPPASGGLGKAGRSPARKDAEDT
                     EPRDSGQVRVGRYHILDTLGAGGMGAVYSAYDPELHRRVAIKLLHPDANPAARSDGAS
                     RLLREAQAMARLSHPNVVSVYDAGTFAGRVFIAMERVDGLSLRHWLRAEHRTWREVLD
                     IFRQAGRGLAAAHAAGLVHRDFKPANVLVSKEGRAQVTDFGLARTTADLDAAEAGRGT
                     TPALPRVAPEDLLQTALTEAGLVMGTPAYMPPEQHEDGRIDARGDQFSFCASLYEALY
                     GQLPFNGKRPDEYLEEARSGRVRPPPRGSRVPAWVLRAVTRGLSPVPEARFPSMGVLL
                     EALGADPLAAWRRRGTVAAASLLLNSVVAVTWLLVGSQRGGPCPDPEARLAGVWDAAR
                     RAEIQQAFAATGKVHASAAFERVATTLDGFANEWTRMHREACEATRVLGHQSDHELAL
                     RMACLDRRHSALVALTGVLAQTDAAALAAAPDAAQRLPPVAACADVDALWLGLSEPAG
                     QRQQVEALRARVDRATALVDAGRYPQAQEEAKAVLAEARQLGYGPVLAEALELEGRLG
                     LVTGDDARAAAALRESLFTAQAHRHDQLAARAAARLVTTVSAEPTLESWTVDQARASI
                     QRAGGASELEALLQTSLGRNAFLRGQYTQAAEAFGRSAALREKELGPEHLLTLESLRN
                     QAAALSRTPETEHAMALLRRVLETTERVLGPDHPQTAMAANAMGYHLVIVRRFEEAIP
                     YLQRAIRLEEQSLGRDSATLSYPLNNLAEALEALGRHAESRPLRERALAVDLKAFGPE
                     HPETATDLALLGALALREGKARDAADYARRSIAAYEAFQKDHPDVAAPLTTLGQALHA
                     LGRSREARPLLERALALRTTHPGPAEDLASTRFALAQALVKQDGPRARGLATQALRFY
                     TAEEPVYATEASHVRDWLQDLRRRRR"
     misc_feature    317655..318467
                     /locus_tag="LILAB_01330"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    317673..318305
                     /locus_tag="LILAB_01330"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(317673..317687,317697..317699,317736..317738,
                     317742..317744,317844..317846,317892..317903,
                     317913..317915,317919..317921,318027..318029,
                     318033..318035,318039..318044,318048..318050,
                     318081..318083,318090..318092,318213..318224)
                     /locus_tag="LILAB_01330"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(317673..317687,317697..317699,317736..317738,
                     317742..317744,317844..317846,317892..317903,
                     317913..317915,318027..318029,318033..318035,
                     318039..318044,318048..318050,318081..318083)
                     /locus_tag="LILAB_01330"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(317685..317687,317913..317915,317919..317921,
                     318027..318029,318033..318035,318039..318041,
                     318090..318092,318213..318224)
                     /locus_tag="LILAB_01330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(318078..318098,318213..318224)
                     /locus_tag="LILAB_01330"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    319389..319613
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    319407..319739
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(319410..319412,319446..319448,319458..319460,
                     319473..319475,319536..319538,319572..319574,
                     319584..319586,319593..319595,319653..319655,
                     319698..319700,319710..319712,319719..319721)
                     /locus_tag="LILAB_01330"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(319413..319418,319527..319532,319536..319541,
                     319548..319553,319644..319649,319656..319661,
                     319668..319673)
                     /locus_tag="LILAB_01330"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    319503..319739
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    319629..319865
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    319647..>319865
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(319647..319649,319653..319658,319665..319670,
                     319779..319784,319788..319793,319800..319805)
                     /locus_tag="LILAB_01330"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(319662..319664,319698..319700,319710..319712,
                     319719..319721,319788..319790,319824..319826,
                     319836..319838,319845..319847)
                     /locus_tag="LILAB_01330"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    319881..320108
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    319974..320222
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(319983..319985,319992..319994,320037..320039,
                     320073..320075,320085..320087,320094..320096,
                     320160..320162,320193..320195,320205..320207,
                     320214..320216)
                     /locus_tag="LILAB_01330"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    320004..320234
                     /locus_tag="LILAB_01330"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    order(320028..320033,320037..320042,320049..320054,
                     320151..320156,320163..320168,320175..320180)
                     /locus_tag="LILAB_01330"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            320380..322020
                     /locus_tag="LILAB_01335"
                     /db_xref="GeneID:10874732"
     CDS             320380..322020
                     /locus_tag="LILAB_01335"
                     /note="COG0595 Predicted hydrolase of the
                     metallo-beta-lactamase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase family protein"
                     /protein_id="YP_004663277.1"
                     /db_xref="GI:338529943"
                     /db_xref="GeneID:10874732"
                     /translation="MLQVIPLGGLGEIGLNSMVIACRGELLLIDAGLMFPSSGMPGVD
                     IIIPDFSHLKQNAAQLKGVLLTHGHEDHLGALPYLLNEVPVPVYGTRFTLAMARHRLE
                     ELGIEADLREIEPREPFTVGTAFRVEASRVTHTVPDAVGFILRTPEGTLIHTGDFKLD
                     PDPIDGLRTDLERWGEAGEEGVLCLLSDSTNSEVTEETGSERVVEQTFERLFQGATGR
                     IIVALFSSNLHRVRHLLALAERLGRKVALQGRSMLRNVEMARALGYLDVPDSLFVHVD
                     TVPALPAQRVLVLTTGAQGEPRAGLSQLASGDGPVRLNPGDLVVLSSRPIPGNERSVG
                     ALIDALQWRGAKVAYAQVEPGIHVSGHASQPQQRRVLDLVRPAHFIPVHGEGRHLHKH
                     LLTAREAGLEPAQCLLAQDGDIITFEEGRGRFTGSVPSGRVLKDRFGPGRVTPDTLQE
                     RIRLSETGIVAAVVVLQRDSQKVVAGPQLSGQGLSLDEQVLLPRVAQDARVFFEELSP
                     VLRGDDALVREELTRAVRRAFKAHTAKRALVVPLVVRV"
     misc_feature    320383..322008
                     /locus_tag="LILAB_01335"
                     /note="mRNA degradation ribonucleases J1/J2
                     (metallo-beta-lactamase superfamily) [Translation,
                     ribosomal structure and biogenesis; Replication,
                     recombination and repair]; Region: COG0595"
                     /db_xref="CDD:223668"
     misc_feature    320425..320868
                     /locus_tag="LILAB_01335"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    321427..321534
                     /locus_tag="LILAB_01335"
                     /note="RNA-metabolizing metallo-beta-lactamase; Region:
                     RMMBL; pfam07521"
                     /db_xref="CDD:254257"
     gene            322042..322539
                     /locus_tag="LILAB_01340"
                     /db_xref="GeneID:10874733"
     CDS             322042..322539
                     /locus_tag="LILAB_01340"
                     /note="COG1666 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleotide-binding protein"
                     /protein_id="YP_004663278.1"
                     /db_xref="GI:338529944"
                     /db_xref="GeneID:10874733"
                     /translation="MPSFDVVSKIDLAELDNAVNQTKKELSTRYDFQGTHADVVLAPD
                     HTAITVKANSEDRVQAAKEVLLAKLAKRNISLFALEYGDIEKTGLHNVKQTIKLQQGI
                     PVDKSKELVKLLKESKMKVQGSIQADQLRVTGKNRDDLQAAIALFRKEQDRLKLDMQF
                     TNFRD"
     misc_feature    322045..322533
                     /locus_tag="LILAB_01340"
                     /note="Proteins similar to Escherichia coli YajQ; Region:
                     YajQ_like; cd11740"
                     /db_xref="CDD:213038"
     gene            322548..323651
                     /locus_tag="LILAB_01345"
                     /db_xref="GeneID:10874734"
     CDS             322548..323651
                     /locus_tag="LILAB_01345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663279.1"
                     /db_xref="GI:338529945"
                     /db_xref="GeneID:10874734"
                     /translation="MRATALSFCLLFCAPGVASAQAERASKPVPSLSRPPRIQGGLKA
                     FASPLVLKPVVPEGATASFTAKVGARKDTLYVGVEATDDQLQAGDLLTLSLYFPGTGP
                     TSTGYTWRFAFDGKRASGADSGTPQFAQDLVTAAVQRQGNKLRMMASVPVRAFPRFPA
                     VDPLVMDLCLTYEDRDSADGKAASISNCQSGTMVGDALRLPDEPRKGLKLKPPESVST
                     LEPRQDGWLGWDYMSYPAWAQADGELTPSLLRGLVAPDAIIPSTADLNVPDTLSLPDG
                     GRVVTVVTGKNPYAVAGQCDADDELRLGIYLVDGKTARRVLEWPAATCALGRTSSVEL
                     DEEGVLSIRYSNGTSMTFAWSGTHFSRTELGKR"
     gene            323657..325087
                     /locus_tag="LILAB_01350"
                     /db_xref="GeneID:10874735"
     CDS             323657..325087
                     /locus_tag="LILAB_01350"
                     /note="COG0621 2-methylthioadenine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA modifying protein"
                     /protein_id="YP_004663280.1"
                     /db_xref="GI:338529946"
                     /db_xref="GeneID:10874735"
                     /translation="METTTPKSLYMMTLGCPKNRVDSEVMLGTLRHRGYTLVQEASDA
                     EVIVVNTCAFIGPAKQESVDSILEMAELKKSGACQTLVVTGCLSQRYGEELAKEMPEV
                     DHFLGTSAYAQIGDLLAAEASPRQVIPDPDYIHDANTPRINSMPKYTAYLKISEGCDN
                     ACAFCIIPTLRGGQRSRTIDDIVAEAKQLADSGVQELNLVAQDLTAYGHDLPGRPKLH
                     DLLKALVQVDVKWIRLHYAYPRIFPDELIDVMASEPKIARYLDMPVQHVSDKLLLSMK
                     RGRNSEFLKGLLTKLRERVPGLVMRTSLIVGLPGETEEDFEMLKEFVKTQRFERLGVF
                     QYSDEEGTAAYDLPDKVPQKTIERRWREVMAIQKRINREQNKKLVGKRLEVLVEGPAP
                     ETEHLLVGRHQGQAPDIDGMVYINDGLAYPGELVTVEVTEAHDYDLVARVVERPDPKQ
                     REHTARDAHPAPLPLSVMQRPAPRAE"
     misc_feature    323681..323977
                     /locus_tag="LILAB_01350"
                     /note="Uncharacterized protein family UPF0004; Region:
                     UPF0004; pfam00919"
                     /db_xref="CDD:250224"
     misc_feature    323696..324973
                     /locus_tag="LILAB_01350"
                     /note="ribosomal protein S12 methylthiotransferase RimO;
                     Region: TIGR01125"
                     /db_xref="CDD:233279"
     misc_feature    324110..324733
                     /locus_tag="LILAB_01350"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(324128..324130,324134..324136,324140..324142,
                     324146..324154,324254..324256,324260..324265,
                     324359..324367,324443..324445,324569..324571,
                     324659..324664)
                     /locus_tag="LILAB_01350"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    324782..324985
                     /locus_tag="LILAB_01350"
                     /note="TRAM domain; Region: TRAM; pfam01938"
                     /db_xref="CDD:110897"
     gene            complement(325121..326110)
                     /locus_tag="LILAB_01355"
                     /db_xref="GeneID:10874736"
     CDS             complement(325121..326110)
                     /locus_tag="LILAB_01355"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663281.1"
                     /db_xref="GI:338529947"
                     /db_xref="GeneID:10874736"
                     /translation="MLRSPLAHMRPSPTEFDRQYTEQRRSIELARRYLEKEGVTRMYD
                     ALTKEVERGRLSVQDASGAIRFGLLALIERVAERVGHTRYVDMLKDEEMLAALRSLLD
                     DLCRRKGVDTFEFRQQWAHTNLQAVLRDWHLVVHEERGRQRYEVAADLARRLVAETPG
                     TVLAETLKLPTDAFVLLASPEAGLVGRGPDGAPAPITEIYVVESPAPEGKAWFLWLSM
                     RDAENRAARALINVYLQDGKTLDDAIAFTREQGGPQQDAGWEDCCRLLAGVARHLAEG
                     GPVREHWYDATARELHEKLAATPKSAKADREKLRERLRAVSPGRTRVLEEPSR"
     gene            complement(326133..327557)
                     /locus_tag="LILAB_01360"
                     /db_xref="GeneID:10874737"
     CDS             complement(326133..327557)
                     /locus_tag="LILAB_01360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663282.1"
                     /db_xref="GI:338529948"
                     /db_xref="GeneID:10874737"
                     /translation="MRRAFLLMGLMGLAASGCHREPAAHAASPKGFLGQTLPLLASPA
                     LRLTVAGRLGTRPVPVVLDVARPLSLVSKGCFDGELPAPEGTIRAPEPAGGFRSWPVV
                     PLPAFSVGPVRSPVRTAGLSGEKACAVTLGADVLEFYALTVDPLRREVTFTASRPRVD
                     YAAEAAATEASREVHVVELDREPLGDWPLLAARMTQGGAELTGPFVLGSREPFSRVSA
                     RLAQARGLQPLETVANLPPRTFALDAVEVAEGVGARPLVVEAAGRWDSPSSLGRLGPD
                     VWGRFTATLDAKGGALVLRRPRVRHSEGATASHCAAPDGTFREEACYGLHVRREPDGS
                     VSVSGAVYRDLPEGGRLHLEPLGPDGQKLLSGCGVGLSFPATSRGLTTQHRLPWRSLA
                     QALPACHAALSTARDFTLGLFEEGRQPECPTACAFVTQAASRRTVCECQPTPLGEGVA
                     MPARGAPSREPPPEERELEPEDPR"
     gene            complement(327568..328302)
                     /locus_tag="LILAB_01365"
                     /db_xref="GeneID:10874738"
     CDS             complement(327568..328302)
                     /locus_tag="LILAB_01365"
                     /note="COG2834 Outer membrane lipoprotein-sorting protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein carrier protein LolA"
                     /protein_id="YP_004663283.1"
                     /db_xref="GI:338529949"
                     /db_xref="GeneID:10874738"
                     /translation="MFLEALLATLLSAPATPAAAQAKPPPAAQTAPAASAPAAPAAAK
                     PMTPEVKSLVDRMQDFYEKTGDFRAGFRQDYKYKTFRRTQTSEGTVTYKKPGLMRWEY
                     LKPSPRTFVLAGNKVYAYDPAAQSLTVANVDTSQLSASVTFLFGKGKLADEFNITKGT
                     CKDCKGTLLVLDPLKNEPRFRQVRLEVDPSTAQVLKSTVVDPDGSENAITFLDLKTNV
                     GIDTDSFKLDVPDDTRVDDFTKAKKQ"
     misc_feature    complement(327586..328143)
                     /locus_tag="LILAB_01365"
                     /note="Outer membrane lipoprotein-sorting protein [Cell
                     envelope biogenesis, outer membrane]; Region: LolA;
                     COG2834"
                     /db_xref="CDD:225390"
     gene            complement(328377..329054)
                     /locus_tag="LILAB_01370"
                     /db_xref="GeneID:10874739"
     CDS             complement(328377..329054)
                     /locus_tag="LILAB_01370"
                     /note="COG0566 rRNA methylases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA
                     (guanosine-2'-O-)-methyltransferase"
                     /protein_id="YP_004663284.1"
                     /db_xref="GI:338529950"
                     /db_xref="GeneID:10874739"
                     /translation="MSGGGARYERYEREQFEPEQFLLDVRKEKIDRVVSHRTRNFTVV
                     LDRLEDSFNMAAVLRTCESMGVQEVHIVINPEAPFVPNSRVAQGCDKWLDVKLYKSFA
                     ECREHLKSRGFSLYASAIQDGATSLYTLRFDGKMALVFGNERHGVSDEVLAGVDGTFW
                     IPMKGFSQSLNISAAASACISRAIAWRDEHLGQSGDLSPEDAQALRERFYVLAIKQRK
                     RLFKKAP"
     misc_feature    complement(328515..328937)
                     /locus_tag="LILAB_01370"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            complement(329059..331098)
                     /locus_tag="LILAB_01375"
                     /db_xref="GeneID:10874740"
     CDS             complement(329059..331098)
                     /locus_tag="LILAB_01375"
                     /note="COG0536 Predicted GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase ObgE"
                     /protein_id="YP_004663285.1"
                     /db_xref="GI:338529951"
                     /db_xref="GeneID:10874740"
                     /translation="MKFVDEVRIFVKAGDGGNGAVSFRREKYIERGGPNGGDGGNGGS
                     VVFVADPQLTTLLDYRYQQHHRAKNGEHGMGSDCNGRAADDMVLKVPVGTLVKDANTE
                     ELLVDLSEAGQRWVAAKGGRGGLGNMNFATSTRQTPRFAQDGTKGEEITLRLELKLLA
                     DVGLLGFPNAGKSTFISRVSRARPKIADYPFTTLVPNLGMVQYKDGLSFVMADIPGII
                     EGASEGVGLGHQFLRHVERCKVLIHLIDMGAEGEGRAPLQDFDVLNAELEKYSPELAS
                     KPQVVAANKLDLPDAQARLEDFTEALRERGIRVYPVSCATGEGMQPLMDSVAEVLFTG
                     RTEKLHVEVPAKAARARKAREGSKAKAPVARTREDLEFEAEFAALEAAEAQASKALEE
                     GASPGAPAPSRKQGTAAAKKAAAGRTGTAAAAKKASAGKAGAAAAKKAVAGKAGTAAA
                     KKAAGGRAVAAAKKAAAGKAGTAAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAGGRAV
                     AAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAAGKAGTKQGTSARNA
                     GTAATKKGTSARKAGAAATKKGASARKAGAAAAKKGASARKAAAKSSARKSGAVAAKK
                     AAAVKSPARKSGASAAKKASARKSGSVGKAATKKPSASKSATKRAPARRSAGGRS"
     misc_feature    complement(330106..331092)
                     /locus_tag="LILAB_01375"
                     /note="Obg family GTPase CgtA; Region: Obg_CgtA;
                     TIGR02729"
                     /db_xref="CDD:233986"
     misc_feature    complement(330625..331092)
                     /locus_tag="LILAB_01375"
                     /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
                     /db_xref="CDD:110047"
     misc_feature    complement(330106..330621)
                     /locus_tag="LILAB_01375"
                     /note="Obg GTPase; Region: Obg; cd01898"
                     /db_xref="CDD:206685"
     misc_feature    complement(330580..330603)
                     /locus_tag="LILAB_01375"
                     /note="G1 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(order(330157..330162,330238..330240,
                     330244..330249,330577..330594))
                     /locus_tag="LILAB_01375"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206685"
     misc_feature    complement(330511..330558)
                     /locus_tag="LILAB_01375"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(330520..330522)
                     /locus_tag="LILAB_01375"
                     /note="G2 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(330451..330462)
                     /locus_tag="LILAB_01375"
                     /note="G3 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(order(330385..330423,330430..330453))
                     /locus_tag="LILAB_01375"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(330238..330249)
                     /locus_tag="LILAB_01375"
                     /note="G4 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(330154..330162)
                     /locus_tag="LILAB_01375"
                     /note="G5 box; other site"
                     /db_xref="CDD:206685"
     gene            complement(331225..331434)
                     /gene="rpmA"
                     /locus_tag="LILAB_01380"
                     /db_xref="GeneID:10874741"
     CDS             complement(331225..331434)
                     /gene="rpmA"
                     /locus_tag="LILAB_01380"
                     /note="COG0211 Ribosomal protein L27"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="YP_004663286.1"
                     /db_xref="GI:338529952"
                     /db_xref="GeneID:10874741"
                     /translation="MKVYGGETVSAGSILVRQLGTVIHAGANVKLGRDFTLYSVVDGV
                     VKYERLGRDRKKVSVYPAAAEQASA"
     misc_feature    complement(331255..>331431)
                     /gene="rpmA"
                     /locus_tag="LILAB_01380"
                     /note="Ribosomal L27 protein; Region: Ribosomal_L27;
                     cl00359"
                     /db_xref="CDD:260380"
     gene            complement(331540..331848)
                     /gene="rplU"
                     /locus_tag="LILAB_01385"
                     /db_xref="GeneID:10874742"
     CDS             complement(331540..331848)
                     /gene="rplU"
                     /locus_tag="LILAB_01385"
                     /note="COG0261 Ribosomal protein L21"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="YP_004663287.1"
                     /db_xref="GI:338529953"
                     /db_xref="GeneID:10874742"
                     /translation="MYAVIRTGGKQYRVAEGDVVRIEKIAGDVGAEVTFTEILMLGGS
                     DSPKVGQPTVAGAKVVGKVLAQDKHRRVLHFRKEKEGWTRRRGHRQPYTEVKVTSIAG
                     "
     misc_feature    complement(331543..331848)
                     /gene="rplU"
                     /locus_tag="LILAB_01385"
                     /note="50S ribosomal protein L21; Validated; Region: rplU;
                     PRK05573"
                     /db_xref="CDD:235510"
     gene            332106..332486
                     /locus_tag="LILAB_01390"
                     /db_xref="GeneID:10874743"
     CDS             332106..332486
                     /locus_tag="LILAB_01390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663288.1"
                     /db_xref="GI:338529954"
                     /db_xref="GeneID:10874743"
                     /translation="MKKLLIGLVASSALVFGTGCGDSTEPEDVCERFFSAMIDIDQKA
                     CGEVSEGPTDQERNEAIQQCSTQIERCTEDDREKMNRIADCINDIDDCREGREDEFAG
                     AFLACLIQEGSFSESCNISADIED"
     gene            complement(332514..334586)
                     /locus_tag="LILAB_01395"
                     /db_xref="GeneID:10874744"
     CDS             complement(332514..334586)
                     /locus_tag="LILAB_01395"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase Pkn1"
                     /protein_id="YP_004663289.1"
                     /db_xref="GI:338529955"
                     /db_xref="GeneID:10874744"
                     /translation="MAEVSSGGGCAVCGRRHGTEASCPTLVRADVGGGGTARPRCAPT
                     VEAQDPLVGTRCGSFRLTRRLGRGGMGSVYLGEHVSIGSRVAVKVLHAHLTMYPELVQ
                     RFHAEARAVNLIGHENIVSIFDMDAAPPRPYLIMELLDGSPLSAWVGTPLAAGAVVSV
                     LSQVCDALQAAHARGIVHRDLKPDNIFLVRRKRSAPFVKVLDFGIAKLADAHMPQTHA
                     GIIVGTPEYMAPEQSLGRGVDGRADLYALGVIAYQLLTGRLPFNDEGLTAQLVAHQLR
                     PPPPPSSVYPAVSAALEHVILRALAKKPEDRYPSIAAFRDALQVALVEHQRVSARKTR
                     PGGHPVLEQAPVASMARVQARLPSGSRAGPLPSLLAGAPLRRPSSAAPTASPRASNVE
                     VPVQVVLRPGESPVRLRGSGLSRGGLFLHGGRFLPPLCARLPVVLELASGPLSVMCEV
                     VRLVPPAQARVWGMPTGFGVQFVEATAVLKAAVDALLQGDPVREAPSAPSAEDPAVAR
                     LLEAWRQRSAGDAYAVLALDQDSDMVTVRLRTREAWRSLESLEQHPLTPPQRAQVDAL
                     RVRVREAAEALGATAHRALYDAWRGNHRGVAKCLEAGLTAEQLESLRREFLARRPQAM
                     GSARIHFQSGGALEREGRLSQALEQYERGLRLAPLEVDMLQRYRRLRRVLGGRSPVMT
                     THGRARTP"
     misc_feature    complement(333651..334412)
                     /locus_tag="LILAB_01395"
                     /note="Protein kinase domain; Region: Pkinase; pfam00069"
                     /db_xref="CDD:249558"
     misc_feature    complement(333825..334394)
                     /locus_tag="LILAB_01395"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(333909..333920,333972..333974,
                     333981..333983,334026..334028,334032..334037,
                     334041..334043,334047..334049,334152..334154,
                     334158..334160,334170..334181,334227..334229,
                     334323..334325,334329..334331,334368..334370,
                     334380..334394))
                     /locus_tag="LILAB_01395"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(333981..333983,334026..334028,
                     334032..334037,334041..334043,334047..334049,
                     334158..334160,334170..334181,334227..334229,
                     334323..334325,334329..334331,334368..334370,
                     334380..334394))
                     /locus_tag="LILAB_01395"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(333909..333920,333972..333974,
                     334035..334037,334041..334043,334047..334049,
                     334152..334154,334158..334160,334380..334382))
                     /locus_tag="LILAB_01395"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(333909..333920,333966..333986))
                     /locus_tag="LILAB_01395"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(333120..333416)
                     /locus_tag="LILAB_01395"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            334761..335723
                     /locus_tag="LILAB_01400"
                     /db_xref="GeneID:10874745"
     CDS             334761..335723
                     /locus_tag="LILAB_01400"
                     /note="COG3491 Isopenicillin N synthase and related
                     dioxygenases"
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase family oxidoreductase"
                     /protein_id="YP_004663290.1"
                     /db_xref="GI:338529956"
                     /db_xref="GeneID:10874745"
                     /translation="MSPSPRRIPIVNLSHYRTGAPQERARFVQVFGDGIKEFGFVTVE
                     GHGIDDGLIRRTYTDVERFFSLPEATKAQYAQAAHGGQRGYIGYGQEHAKNRQVGDLK
                     EFWHVGRELPPEHRYRERYGPNVWPTEVPTFREHTLSLFNALDGAAGVMLQALAEYFG
                     VARDTFSGMATDGNSVLRLIHYPPLKERFIPGGVRAAEHEDINLITLLCEGTAGGLEL
                     LTRDGEWLPVDTLRGQIVVDSGDMLSRVTNEIIPATTHRVVNPRGKEEDTVRYSMPFF
                     VHPYADCVLQALPCTQTADSPARHAPITADAFLKQRLRENGLLK"
     misc_feature    334770..335717
                     /locus_tag="LILAB_01400"
                     /note="Isopenicillin N synthase and related dioxygenases
                     [General function prediction only]; Region: PcbC; COG3491"
                     /db_xref="CDD:226022"
     misc_feature    334782..335144
                     /locus_tag="LILAB_01400"
                     /note="non-haem dioxygenase in morphine synthesis
                     N-terminal; Region: DIOX_N; pfam14226"
                     /db_xref="CDD:258418"
     misc_feature    335283..335597
                     /locus_tag="LILAB_01400"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy; pfam03171"
                     /db_xref="CDD:251775"
     gene            335730..336785
                     /locus_tag="LILAB_01405"
                     /db_xref="GeneID:10874746"
     CDS             335730..336785
                     /locus_tag="LILAB_01405"
                     /note="COG0388 Predicted amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663291.1"
                     /db_xref="GI:338529957"
                     /db_xref="GeneID:10874746"
                     /translation="MAPSADTVELFALQPRVSLEDYASPSAFAARHRALAAKVDALRS
                     RDAEGRPRHPALAVWPEWVGAPLLFTGHVALVRRATSVQGALKRVALAEPWDTWNAWS
                     AFHPPSLLECVYAARAPRVHRALWETFSGIARDFGLWVVAGSALLPASQRGQDTPDFR
                     PYGARTYNTSYTFSPEGRCVAAVRKANLVPTREDALHLSPGRPEDLALLQTPFGRLGT
                     LIGYDGFLKPHTSQEPWFVPCAQYLDALGADVLAQPSANPWPWEAPSPFNASQRRGEQ
                     WREEGLQAQLRMLKRVRYVVSAQLVGSVLGTPFEAPSSILERTDAGEVRVLAEAPSRS
                     EEDVVHATVPTAARGTP"
     misc_feature    336033..336770
                     /locus_tag="LILAB_01405"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cd07197"
                     /db_xref="CDD:143587"
     misc_feature    order(336282..336284,336294..336296,336306..336308,
                     336390..336395,336399..336401,336432..336434,
                     336495..336497)
                     /locus_tag="LILAB_01405"
                     /note="active site"
                     /db_xref="CDD:143587"
     misc_feature    order(336282..336284,336390..336392)
                     /locus_tag="LILAB_01405"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143587"
     misc_feature    order(336285..336296,336303..336305,336327..336332,
                     336339..336341,336393..336395,336399..336401,
                     336432..336443,336450..336455,336564..336569,
                     336600..336608,336660..336665)
                     /locus_tag="LILAB_01405"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143587"
     gene            complement(336782..338221)
                     /gene="gatB"
                     /locus_tag="LILAB_01410"
                     /db_xref="GeneID:10874747"
     CDS             complement(336782..338221)
                     /gene="gatB"
                     /locus_tag="LILAB_01410"
                     /EC_number="6.3.5.-"
                     /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
                     subunit (PET112 homolog)"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="YP_004663292.1"
                     /db_xref="GI:338529958"
                     /db_xref="GeneID:10874747"
                     /translation="MPVSDFQPVIGLEVHAQLLTQSKIFCGCSTAFGAEPNRNTCPVC
                     LGMPGVLPVLNQRVAEFAVRTGLALECTIRPTSVWSRKNYFYPDLPKGYQITQYDQPI
                     CEHGRLVIDTPRGEKTIRVLRIHMEEDAGKSVHDAGGGQSLVDLNRAGVPLLEIVSQP
                     DLRDADEAVEYLKAMRDVLVYLGVNDGNLEEGSFRCDANVSVMPKGSTTFGQRCELKN
                     LNSFRFLKQAIEYEIARQVDVIESGGKVVQETRLWDVSKGVTRSMRSKEEAHDYRYFP
                     EPDLPPLHVSAEAIDAAAQALPELPRAKLQRFTSQYGLPAYDARILTADRPLADYFEA
                     CAGHYKDYKKLSNWFLGELMRLLKEEGTPLSALRFTPAQLGELLGAVDQGTVSANAGK
                     DVLGEMFRTGKAPADIIAEKGLAQVSDTGAIEAVVDDILAKNAGEIEKYRAGKKQVFG
                     FFVGQVMRAMKGKGNPALVNELLKKKLGD"
     misc_feature    complement(336791..338215)
                     /gene="gatB"
                     /locus_tag="LILAB_01410"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit B;
                     Validated; Region: gatB; PRK05477"
                     /db_xref="CDD:235489"
     misc_feature    complement(337364..338203)
                     /gene="gatB"
                     /locus_tag="LILAB_01410"
                     /note="GatB/GatE catalytic domain; Region: GatB_N;
                     pfam02934"
                     /db_xref="CDD:251629"
     misc_feature    complement(336791..337231)
                     /gene="gatB"
                     /locus_tag="LILAB_01410"
                     /note="GatB domain; Region: GatB_Yqey; smart00845"
                     /db_xref="CDD:197913"
     gene            complement(338254..339714)
                     /gene="gatA"
                     /locus_tag="LILAB_01415"
                     /db_xref="GeneID:10874748"
     CDS             complement(338254..339714)
                     /gene="gatA"
                     /locus_tag="LILAB_01415"
                     /EC_number="6.3.5.-"
                     /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
                     subunit and related amidases"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="YP_004663293.1"
                     /db_xref="GI:338529959"
                     /db_xref="GeneID:10874748"
                     /translation="MQLTDLTMLELAAKLAAGEVSSEEATRASLARIQQVDAKVRAFL
                     RVDEAGALAAARASDARRKAGSPASALDGVPLGLKDLFLTEGVETTAGSRILEGFVPP
                     YDATVVRLLKEAGLPLVGKLNLDEFAMGSSNESSAFFPSHNPWDVSRTPGGSSGGSAA
                     AVAAREVFGALGTDTGGSIRQPAALTNTVGLKPTYGRVSRFGVIAFASSLDQPGPMTR
                     TVADAAALLQVIARPDARDATSADAPVPDYSADLEAGVRGLKLGVPREYFTEGMDPEV
                     EAAVREALREYERLGATLVDVSLPHTKYALATYYLIAPAEASSNLARYDGVRFGLRAK
                     DARSLRDVYALTREQGFGAEVKRRIMLGTYALSSGYYDAYYLRAQKVRTLIREDFTRA
                     FAQVDALLSPTSPVPAFKLGEKVEDPLSMYLMDIYTLPCNLAGLPGLSVPCGFTKAGL
                     PVGLQILGRPFDEAGLLRIARAYEREHDFFRRAAPL"
     misc_feature    complement(338293..339672)
                     /gene="gatA"
                     /locus_tag="LILAB_01415"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit A;
                     Reviewed; Region: gatA; PRK00012"
                     /db_xref="CDD:234572"
     gene            complement(339733..340020)
                     /locus_tag="LILAB_01420"
                     /db_xref="GeneID:10874749"
     CDS             complement(339733..340020)
                     /locus_tag="LILAB_01420"
                     /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit C"
                     /protein_id="YP_004663294.1"
                     /db_xref="GI:338529960"
                     /db_xref="GeneID:10874749"
                     /translation="MALTLEQVRHVATLARLSLTPEEEQRFTTQLSAVLDAVEQLQAL
                     DVEAVEPTSHATLMSSRLREDVTRPSLPPEKSLANAPAKSDTSFAVPKIIE"
     misc_feature    complement(339736..340020)
                     /locus_tag="LILAB_01420"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit C;
                     Reviewed; Region: gatC; PRK00034"
                     /db_xref="CDD:178810"
     gene            complement(340027..340362)
                     /locus_tag="LILAB_01425"
                     /db_xref="GeneID:10874750"
     CDS             complement(340027..340362)
                     /locus_tag="LILAB_01425"
                     /note="COG3809 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663295.1"
                     /db_xref="GI:338529961"
                     /db_xref="GeneID:10874750"
                     /translation="MADARTDKPSSTEEEYFAREEIEKKRKLALEQAAANAAQQREEL
                     KKLHWMKCPKCGMDLQTLKQGNVEIETCFNCHGVFLDAGELDQLVAQHGHEGSGKVMG
                     AILNLFKKK"
     misc_feature    complement(340090..340212)
                     /locus_tag="LILAB_01425"
                     /note="Transcription factor zinc-finger; Region: zf-TFIIB;
                     pfam13453"
                     /db_xref="CDD:205631"
     gene            340577..343633
                     /locus_tag="LILAB_01430"
                     /db_xref="GeneID:10874751"
     CDS             340577..343633
                     /locus_tag="LILAB_01430"
                     /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
                     related proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsK/SpoIIIE family protein"
                     /protein_id="YP_004663296.1"
                     /db_xref="GI:338529962"
                     /db_xref="GeneID:10874751"
                     /translation="MTAKKGRAEKAVLSRQEIATRRRALADKRMKAGKGGDVATRAIT
                     GVFLLAASLIALLAVATFDAKDRVGPGFNNAVGPMGHLIAESLRGLLGVCAYLIPVGG
                     IYTAMVLFVGSRDRKRGPQIISLALLTVSVSVLAQLMFAGDKGWDHPPGGALGASLGG
                     IMSGLFSTVGTVILVTAISAAALIVGTQYTFLKVCSLAWAGMCVLGRRFQESFNTFWE
                     AQKVAYQERQERAAQEKLEEAAFLAQLEADEEELAEAERLAEEAEAAEAEAMAEEAFR
                     LAKQQEKEQAAAAKLALKESREREKAEKKLLPPAREADSLPPAPAPVLALPEKAPAKV
                     EKRPGISADPAWAASFLPPSPNLVPADGAESSEPPRSRRKPNIVTGPAPAPVAEEETP
                     EPVAPVSTAPVAPVAPAPAPAAPADIVPAKPAALARMPLIVEPKAPPKPTAKKSQDQF
                     EFVGDRKSFSLPPLDVLECDKKERSALDQDAYLATAEKLRAKLADFGIVGEVVEIRPG
                     PVVTMYEFLPGPGIKVSKIAALADDLAMAMEAMRVRIVAPIPGKGVVGIEVPNKDRET
                     VYLKEIAEQDAFNKGASKLTMCVGKDIEGMPYVLDLAKAPHLLIAGTTGSGKSVAVNS
                     MIMSILLKATPEEVRFIMVDPKMLELSVYEGIPHLLLPVVTDPKKAALALRWAVEEME
                     RRYQMLSEAGVRNIAGFNKLVESTAVEVKTTESAPKKKAKPKNVLVLDGESPRSSMPT
                     GGESLGVAAPRDDEDDLLEAQSPEAEVPELEAEPEDTEAMEASEPAEPAKKQLQKLPY
                     IVVIIDELADLMMVASREVETYVARLAQMARAAGIHLMVATQRPSTDVVTGVIKANFP
                     TRVSFMLRSKPDSMTILGTVGAEALLGMGDMLIMPPTSAHLQRVHGAFVSENEIKKAV
                     DHLKAQGKPVYDESILKPRDEDVEGGGEEDELSDELYDQALATVSEMRAVSISMLQRK
                     MRIGYNRAARMIERMERDGVVGAADGAKPREVLIRGLGDMPGAGAM"
     misc_feature    340757..341161
                     /locus_tag="LILAB_01430"
                     /note="Domain of unknown function (DUF4117); Region:
                     DUF4117; pfam13491"
                     /db_xref="CDD:257815"
     misc_feature    <341630..343594
                     /locus_tag="LILAB_01430"
                     /note="DNA segregation ATPase FtsK/SpoIIIE and related
                     proteins [Cell division and chromosome partitioning];
                     Region: FtsK; COG1674"
                     /db_xref="CDD:224588"
     misc_feature    342278..343108
                     /locus_tag="LILAB_01430"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     misc_feature    342389..343180
                     /locus_tag="LILAB_01430"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    343403..343597
                     /locus_tag="LILAB_01430"
                     /note="Ftsk gamma domain; Region: Ftsk_gamma; pfam09397"
                     /db_xref="CDD:255339"
     gene            343748..344032
                     /locus_tag="LILAB_01435"
                     /db_xref="GeneID:10874752"
     CDS             343748..344032
                     /locus_tag="LILAB_01435"
                     /note="COG2329 Uncharacterized enzyme involved in
                     biosynthesis of extracellular polysaccharides"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase family
                     protein"
                     /protein_id="YP_004663297.1"
                     /db_xref="GI:338529963"
                     /db_xref="GeneID:10874752"
                     /translation="MIVAISRFRPAPEEADRLVARFQARTRAVDGYPGFLGLEVLRSF
                     EPAPELMLVTRWRDKAAMRAYFQSEDFQRAREASAQQEDATFALYEVVGT"
     misc_feature    343748..343978
                     /locus_tag="LILAB_01435"
                     /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
                     pfam03992"
                     /db_xref="CDD:252300"
     gene            344265..345410
                     /locus_tag="LILAB_01440"
                     /db_xref="GeneID:10874753"
     CDS             344265..345410
                     /locus_tag="LILAB_01440"
                     /note="COG0116 Predicted N6-adenine-specific DNA
                     methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="THUMP domain/methyltransferase domain-containing
                     protein"
                     /protein_id="YP_004663298.1"
                     /db_xref="GI:338529964"
                     /db_xref="GeneID:10874753"
                     /translation="MRFMATLDEALMVALWSRIAMRVLYPLGAFEARGAEGLYEAAAS
                     IPWEEHLTPEHTFAVDATLKDSEHSHSGFVALKVKDAIVDRMRDTQGARPDVNTRDPD
                     IRVVAHLARETLSLSLDLCGEPLHRRGYRVRPTPAPLKETLAAAVLRAANYTGTEGLV
                     DPMCGSGTLLIEAGLIARCRAPGLNRDFAVERWPELGARARELLADMRADARRNERKV
                     EVPLLGFDKDPEALEAAHRNVRAARLTEELQLAEGDATRMPPLPETGGLIVTNPPYGD
                     RIGTGGQKGMKSFYFKLGESLRVPGWRVWVICGNPAFESAFHARPSAKRDLWNGPIAC
                     ALLGYRPPDGGSARGDTETGSEAPLGAPRQPVDVAPVRPQHEGEEEG"
     misc_feature    <344268..344630
                     /locus_tag="LILAB_01440"
                     /note="THUMP domain associated with
                     S-adenosylmethionine-dependent methyltransferases; Region:
                     THUMP_AdoMetMT; cd11715"
                     /db_xref="CDD:212584"
     misc_feature    344646..345266
                     /locus_tag="LILAB_01440"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            complement(345327..345905)
                     /locus_tag="LILAB_01445"
                     /db_xref="GeneID:10874754"
     CDS             complement(345327..345905)
                     /locus_tag="LILAB_01445"
                     /note="COG0344 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_004663299.1"
                     /db_xref="GI:338529965"
                     /db_xref="GeneID:10874754"
                     /translation="MTSALVLLGYLAGSIPFGVLLTRWLRGVDVRKGGSGNIGATNVT
                     RVAGKKLGAVVLLLDAVKGALPVLLAVRLLPDAPAVHVAVGLAAVLGHIYPVWLKLQG
                     GKGVATALGVLLVLAPQAALAAALVYVAVFAVSRVSSLGSLAAGATAVGTSALTARAL
                     EYAGLSALLFALMLWTHRGNIHRLARRTERRF"
     misc_feature    complement(345330..345905)
                     /locus_tag="LILAB_01445"
                     /note="Glycerol-3-phosphate acyltransferase; Region:
                     G3P_acyltransf; cl00410"
                     /db_xref="CDD:260409"
     misc_feature    345628..345879
                     /note="potential protein location (hypothetical protein)
                     that overlaps protein (membrane protein)"
     gene            complement(345916..346347)
                     /locus_tag="LILAB_01455"
                     /db_xref="GeneID:10874755"
     CDS             complement(345916..346347)
                     /locus_tag="LILAB_01455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663300.1"
                     /db_xref="GI:338529966"
                     /db_xref="GeneID:10874755"
                     /translation="MKVIIPPRNRRFSTVDALGLAGVVGLLVARYIPVARIVPFWGCV
                     LREQTGWPCLGCGLTRVADRVSHLNFAGAWEANPLGTVAALLFALAAVVMVLHLVFAM
                     PIPQVELSPREWSVLGVLAPIIILVNYAYVVVKTRFPHLLL"
     misc_feature    complement(<346108..346224)
                     /locus_tag="LILAB_01455"
                     /note="Protein of unknown function (DUF2752); Region:
                     DUF2752; pfam10825"
                     /db_xref="CDD:204556"
     gene            346436..347005
                     /locus_tag="LILAB_01460"
                     /db_xref="GeneID:10874756"
     CDS             346436..347005
                     /locus_tag="LILAB_01460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663301.1"
                     /db_xref="GI:338529967"
                     /db_xref="GeneID:10874756"
                     /translation="MNTLRTSLMLLVAVPLVALAGDKTSAKAGKAAEADCHHPPAPQA
                     AAKSEATPAAAADTGWKLTRGEPLKGAKAVKLADVLARPQAHDGKTVLLEGQVRKACE
                     RKGCWMELAASGQDKGPGVRVTFKDYGFFVPLDSAGSQARVEGVLKVAELSDSRAQHY
                     ESEGAIVPRGADGKPREVQLVATGVELRR"
     gene            347030..347599
                     /locus_tag="LILAB_01465"
                     /db_xref="GeneID:10874757"
     CDS             347030..347599
                     /locus_tag="LILAB_01465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663302.1"
                     /db_xref="GI:338529968"
                     /db_xref="GeneID:10874757"
                     /translation="MRGVQGAADRAVQHARAWMLETEPGSRVHDVQLDPRFQHRGVDL
                     LWELPSGEVRGIEVKGDRNATRRRYFFELVSNLEKDTPGCFLYSGADLLVYVFLSQGE
                     LHVVPLKAAREWFLPRAKEYPLKHAFTQTGAIRYTTVGAVVSVRDVAEGVPGVLRVPL
                     KRRGGAKNEVEDVPPTSESPRGQEPNGLE"
     gene            complement(347701..348615)
                     /locus_tag="LILAB_01470"
                     /db_xref="GeneID:10874758"
     CDS             complement(347701..348615)
                     /locus_tag="LILAB_01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663303.1"
                     /db_xref="GI:338529969"
                     /db_xref="GeneID:10874758"
                     /translation="MSTQRVDKSWQQKGLKEYSTEALLGTLGHYGIAVGEDDFRKLAE
                     SAFPLGIAQQWRPKWKGTGPFKDFMVAAAVELWSRWLPDRVAPMEMADTLANLMQQLS
                     FLLGGRQDAAVDAAFEKMNAVRAKMPLDEKGAPQERFMREALAPFTEKQAEIFDSLAE
                     ALASSGQVAHAEAFADLEEFLLPDRRGISKAIVRAAKGELQPATEDMVKLTEDTERSP
                     IARLLAVDGLIHIKAHGQAAAAARTLLAAAEQGGDLHLALDLVPRLEHVYKAQNDREA
                     LMELMGIAERLEAAHDKIHPGHRRHRHG"
     gene            complement(348712..350256)
                     /locus_tag="LILAB_01475"
                     /db_xref="GeneID:10874759"
     CDS             complement(348712..350256)
                     /locus_tag="LILAB_01475"
                     /note="COG1032 Fe-S oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_004663304.1"
                     /db_xref="GI:338529970"
                     /db_xref="GeneID:10874759"
                     /translation="MEGRYSLIERVRALLADEAGTLHKAAPYRVALCYPSPYHVGMSS
                     LGYQAIYREIHEHAGATAERVFLPDDVEAFKRTRTPLFTWESQSPVANFDMLAFSVAY
                     ELELTGLFSMLELTGVPLLAEERRDGRYPLVVGGGPLTFSNPDPLEPFVDVLVQGEAE
                     DLIHLLVDAAATMERDALLAHLARIPGFRVPGRGGARYHVAKATDARLPARSQIVTPH
                     TELRSMFLIEPERGCSRGCHYCVMRRTTNGGMRTVPPERVLSLIPEHARRVGLVGAAV
                     TDHPRIVELLRTIVESGREVGVSSLRADRLTQELVDQLRRGGATNLTVAADGPSQRLR
                     DMVDRKHSEEQIVRAATFARTAGMKQLKVYNVVGLPTEEDADIDELIRFTAELSRILP
                     VALGVAPFVAKRNTPLDGAPFTGIREVEGRLERLRKGLRGRAEVRPTSARWAWVEYML
                     AQCGPEAGLAAMDAWKAGGNFSAWKKAFEARGCEPYLARRVEDGRRNPVLWPTVPGTA
                     PPASAA"
     misc_feature    complement(349756..>349983)
                     /locus_tag="LILAB_01475"
                     /note="B12 binding domain (B12-BD). Most of the members
                     bind different cobalamid derivates, like B12
                     (adenosylcobamide) or methylcobalamin or methyl-Co(III)
                     5-hydroxybenzimidazolylcobamide. This domain is found in
                     several enzymes, such as glutamate mutase; Region:
                     B12-binding_like; cl00293"
                     /db_xref="CDD:260332"
     misc_feature    complement(349072..349578)
                     /locus_tag="LILAB_01475"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(349108..349578)
                     /locus_tag="LILAB_01475"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    complement(order(349159..349161,349282..349284,
                     349351..349359,349432..349437,349441..349443,
                     349534..349542,349546..349548,349552..349554,
                     349558..349560))
                     /locus_tag="LILAB_01475"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(350387..351109)
                     /locus_tag="LILAB_01480"
                     /db_xref="GeneID:10874760"
     CDS             complement(350387..351109)
                     /locus_tag="LILAB_01480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein MlpA"
                     /protein_id="YP_004663305.1"
                     /db_xref="GI:338529971"
                     /db_xref="GeneID:10874760"
                     /translation="MTKNIVNTALVLLGTGTLLTGCDFEQPATDCFVQGSTSWAMKYD
                     LVDEPRDANGDACEPGAPLAELVGVYKFVNPDTDTAQLALRPAGLVGSAAVADESSES
                     TDQTALGSLGEQDAEDFCTATNFNSAFVNVAASEGAPENTIRYEFSNVRVYSAPSAPG
                     TQIMGQFTYTNNGCTGTYVMRGLWPAVGCYTDSTDPLESCGEGSGMNPEAAVMCQPIH
                     PDDPEDPTYGYCVPAKEIPSFK"
     gene            complement(351146..354190)
                     /locus_tag="LILAB_01485"
                     /db_xref="GeneID:10874761"
     CDS             complement(351146..354190)
                     /locus_tag="LILAB_01485"
                     /note="COG4771 Outer membrane receptor for
                     ferrienterochelin and colicins"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_004663306.1"
                     /db_xref="GI:338529972"
                     /db_xref="GeneID:10874761"
                     /translation="MVTATSPNLQGEQTVVTDAQGNYRIPQLPPGDYTLRFEKEQFKP
                     YARSAIQLRLNRTIRVNVELLPEALGEDIVIVGAPPTIDVGSTTMGVNVDQEFIKRIA
                     VARPGGKAGGTRSFESLAELAPGAQNDDYGVSINGSTSPENGYVVDGLSTNDPAFGVN
                     ASPLSIEFVQDVNIITGGYMPEFGRSTGGVINAVTRSGSNEFHGSVFANWTPGSLEGT
                     RTEIRREGTVISGQNQLSNLGDFGATLGGPILKDKLWFFAGFAPSFTRYQHTRTLNAL
                     RVDDQGNTVTDESGFTLADAIPGSATNYFADSRSIQYMGKLTYLINQDHNVSFALNGT
                     PTSSGGLGKLSIDPRSGGLPGVLASRPGDFGLTETNANTTSLALKYAGAFADKKVLVD
                     ANLGWFHQTASTLPGDGSNLGDRTGLAGYSRMLYNTPRPLTFFEALPAGQENACGATD
                     EERMLRCPIQSYTVGGPGFMSEQTLDRYQANAKATYLLNALGTHVFKAGVDVEMLSFD
                     QVKAYGGGVYYQEYEGGWTGGQGPAVQDYRRYGYQTGPDSAVSQLTQIAKTTSTTVGG
                     FIQDSWSIANRVTLNLGVRYDVQALYGGNGDLSLLLGNQWSPRIGAVVDPFANGRAKL
                     FVNFARYYEQVPLNLMDRAFPGENRITSVQRMAAPGEGSATACDPSSYESQQATCGNG
                     NNLLEIPESSRNVNRLYTGGTVGGTPVDPDIKPQSSNEIVVGGEYEVLANTRLGASYT
                     HKNMNSVIEDMSRDAGATYFLGNPGSGFAQEFPTPVRNYDNVTVYLNRTFSDGWLAQA
                     NYTWSRLHGNYPGLFRPETGQLDPNILSDFDLIELLQNRTGLLPFDRTHQIKIFGAKE
                     FNISNALSASLGVSYRGNSGTPINYYGSHWGYGPDESFVLPRGAGGRTPWINTIDSNI
                     GVNYRVSKDSVVSFTLDVFNLFNFQGVTAVDQTYTLRNIKPIPNGTPADLENLPGRVE
                     FQDESPREAPFGSVDGDVNPNFKNPAGYQTPRQVRFGIRYTF"
     misc_feature    complement(353999..>354187)
                     /locus_tag="LILAB_01485"
                     /note="Carboxypeptidase regulatory-like domain; Region:
                     CarboxypepD_reg; pfam13620"
                     /db_xref="CDD:257932"
     misc_feature    complement(<352256..353818)
                     /locus_tag="LILAB_01485"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    complement(351380..353797)
                     /locus_tag="LILAB_01485"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            354647..355321
                     /locus_tag="LILAB_01490"
                     /db_xref="GeneID:10874762"
     CDS             354647..355321
                     /locus_tag="LILAB_01490"
                     /note="COG0810 Periplasmic protein TonB, links inner and
                     outer membranes"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TonB protein"
                     /protein_id="YP_004663307.1"
                     /db_xref="GI:338529973"
                     /db_xref="GeneID:10874762"
                     /translation="MALFGLSIWLSTRPPVEEEKEIEVTLKATMAPPPPPPPPPPPPA
                     SSSKPKTQPKKPKKPDAIVQPKEIPKEAPKEVEPSEEPPADEEEASEEAVEGGVEGGV
                     VGGVVGGVVGGVIGGVVGGQLGGTGTDVLPFGAGMTRPEKLSGPQPGYSREALEARVQ
                     GTMIVKCVVTVEGRVENCRIIKPLPHMDRSVLDALTSSRYKPVTFQGRPVQVDYTFTL
                     NFKLPR"
     misc_feature    <354824..355315
                     /locus_tag="LILAB_01490"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    355082..355312
                     /locus_tag="LILAB_01490"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     gene            355393..356076
                     /locus_tag="LILAB_01495"
                     /db_xref="GeneID:10874763"
     CDS             355393..356076
                     /locus_tag="LILAB_01495"
                     /note="COG0811 Biopolymer transport proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel family protein"
                     /protein_id="YP_004663308.1"
                     /db_xref="GI:338529974"
                     /db_xref="GeneID:10874763"
                     /translation="MQFTLAEIWAHTGLFARSVIFTLGIMSIASLVVMAERMIVFRKT
                     RSDSRNFAAKMGAILAKGDLNTAANTNLGKDVGHLGRVINSGLTAYRISPNNKDVAVE
                     SVARALERQAQREVQSMKRGLGLLATVGSTAPFVGLLGTTMGIVNAFQLMAAAGSGGL
                     GTISAGIAEALITTAFGLLVAIPAVMAYNFLQGWVDARSVDISESSNEFLDVVARHLG
                     GGAHSSNAA"
     misc_feature    355402..356037
                     /locus_tag="LILAB_01495"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:260505"
     gene            356202..356618
                     /locus_tag="LILAB_01500"
                     /db_xref="GeneID:10874764"
     CDS             356202..356618
                     /locus_tag="LILAB_01500"
                     /note="COG0848 Biopolymer transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transport protein ExbD/TolR"
                     /protein_id="YP_004663309.1"
                     /db_xref="GI:338529975"
                     /db_xref="GeneID:10874764"
                     /translation="MGMSAGPKGGVKSDINVTPLVDVVLVLLIIFMVVTPMLQRGKSV
                     ELPKATEIEKEGKKTEADPVILSITPDKKVFVENDQVDEKGLQEKLTEEMLKDPGRKI
                     LLKGDNALSVGDVRKVLDVARKSKAKQISLGVEEKK"
     misc_feature    356202..356615
                     /locus_tag="LILAB_01500"
                     /note="Biopolymer transport protein [Intracellular
                     trafficking and secretion]; Region: ExbD; COG0848"
                     /db_xref="CDD:223917"
     gene            356618..357118
                     /locus_tag="LILAB_01505"
                     /db_xref="GeneID:10874765"
     CDS             356618..357118
                     /locus_tag="LILAB_01505"
                     /note="COG0848 Biopolymer transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer ExbD/TolR family transporter"
                     /protein_id="YP_004663310.1"
                     /db_xref="GI:338529976"
                     /db_xref="GeneID:10874765"
                     /translation="MAGRKQRQWVKPQAQPNSEINVTPLVDVVLVLLIIFMVVTPLLE
                     KDIVVRVPDTEVEQEPTPPDPDDQQLVVQLDKDGGYSINTEKIPQADYVNRLKRMLAA
                     KKADDKVVFFMADDATNYGRLITALDGAKAAGAKVLGMATELPQNAIIQGTSVDTPTP
                     PPAPTP"
     misc_feature    356618..357058
                     /locus_tag="LILAB_01505"
                     /note="Biopolymer transport protein [Intracellular
                     trafficking and secretion]; Region: ExbD; COG0848"
                     /db_xref="CDD:223917"
     gene            357197..357820
                     /locus_tag="LILAB_01510"
                     /db_xref="GeneID:10874766"
     CDS             357197..357820
                     /locus_tag="LILAB_01510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663311.1"
                     /db_xref="GI:338529977"
                     /db_xref="GeneID:10874766"
                     /translation="MADELLIFEQTIEALFLRALHGRLTPECKARLRQAGLDLDQKLR
                     PAYAFDAWMTFLRIAAEELFPQLPLEQGTWKLGEAYIEGFRETMLGRAVLSLLRVLGP
                     RRTLMRATQNFRAGNNYTESKLRELGPCQFELWMNEVGPYPAFTAGIIHAGLKVAGAQ
                     DILIEMSGYDGHACVYRINWNEASVSSGVAGSGDSKAASRSGSINSL"
     misc_feature    357203..357739
                     /locus_tag="LILAB_01510"
                     /note="Myxococcales-restricted protein, TIGR02265 family;
                     Region: Mxa_TIGR02265"
                     /db_xref="CDD:131318"
     gene            complement(357721..358293)
                     /locus_tag="LILAB_01515"
                     /db_xref="GeneID:10874767"
     CDS             complement(357721..358293)
                     /locus_tag="LILAB_01515"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663312.1"
                     /db_xref="GI:338529978"
                     /db_xref="GeneID:10874767"
                     /translation="MKAAFAVFRFCLYGMVGLSAEIFFYNLVRIAQHVPLLEALFRFQ
                     WRVDDRLGLNAIWDTPIATAYGQCSLWMFAIYGVACFFFIEPLYRWMLYQHTGLRAAV
                     YGVVILLFEGFSGVMLERLTGYRIWYYADAGAILWEMTSLYILPIWMVTGLLAEFIYR
                     ELMDPDLLAALESPLPATPEETEASFQLIR"
     gene            358624..360555
                     /locus_tag="LILAB_01520"
                     /db_xref="GeneID:10874768"
     CDS             358624..360555
                     /locus_tag="LILAB_01520"
                     /note="COG0606 Predicted ATPase with chaperone activity"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg-chelatase subunits D/I family, ComM subfamily
                     protein"
                     /protein_id="YP_004663313.1"
                     /db_xref="GI:338529979"
                     /db_xref="GeneID:10874768"
                     /translation="MGIDVVVVECEVDMALGLPYFNVVGQAEGAVRESKVRVISALKN
                     TGFELPQKRITVNLAPADLKKEGAAFELPIALGVLAAAKLMDEAPLGRLLFGGELSLD
                     GGLRPIKGVLPLAVAALNGGFEGVMVPLANAAEAALVEGLRVFPVRTLREAVDHLTGA
                     CAITPYERQREPSLLPPTGQMPDMSDVRGQADLKLALEIAAAGGHNVLMSGPPGSGKT
                     MLARRLPGILPEMTFAEAMEVTKVYSVLGLLGEGHALMRERPFRAPHHTLSDAGLVGG
                     GPSARPGELSLAHNGVLFLDELPALRRNVLAGGHNVLMSGPPGSGKTMLARRLPGILP
                     EMTFAEAMEVTKVYSVLGLLGEGHALMRERPFRAPHHTLSDAGLVGGGPSARPGELSL
                     AHNGVLFLDELPEFRRNVLEVLRQPMEEGVIHLARANQNITYPCRVMLVAAMNPCPCG
                     YYNVPNRPCTCGEQRVFDYLTRVSGPLLDRIDISIQTRPVEYHHMARSTVQEPSSRYY
                     RERAQAARERQRARYRDEPGLHCNAQLPAHLLRRYCGMSERAEAMLQQAVRMYGLSAR
                     AHDRIVKLALTRADLEGHGRIEQSDMQLAINCRMLDRRGAAQGKLHGSRPAPPSGDAA
                     WRAVAGPSGRASPLEDLDG"
     misc_feature    358663..360435
                     /locus_tag="LILAB_01520"
                     /note="Predicted ATPase with chaperone activity
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0606"
                     /db_xref="CDD:223679"
     misc_feature    358672..359019
                     /locus_tag="LILAB_01520"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     misc_feature    359188..>359562
                     /locus_tag="LILAB_01520"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    359254..359277
                     /locus_tag="LILAB_01520"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(359257..359280,359509..359511)
                     /locus_tag="LILAB_01520"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    359497..359514
                     /locus_tag="LILAB_01520"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    359539..359949
                     /locus_tag="LILAB_01520"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    359569..359592
                     /locus_tag="LILAB_01520"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(359572..359595,359824..359826)
                     /locus_tag="LILAB_01520"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    359812..359829
                     /locus_tag="LILAB_01520"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    360133..360411
                     /locus_tag="LILAB_01520"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase_2; pfam13335"
                     /db_xref="CDD:257665"
     gene            complement(360572..361846)
                     /locus_tag="LILAB_01525"
                     /db_xref="GeneID:10874769"
     CDS             complement(360572..361846)
                     /locus_tag="LILAB_01525"
                     /note="COG1252 NADH dehydrogenase, FAD-containing subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADH dehydrogenase"
                     /protein_id="YP_004663314.1"
                     /db_xref="GI:338529980"
                     /db_xref="GeneID:10874769"
                     /translation="MVDRHNHHLFQPLLYQVATATLSPSEIAAPLRALLGRHDVSVVL
                     AEVTGVDTVGKRVLLSDGELKYDFLVIATGATHSYFGNDAWAQHAPGLKSIEDAVEIR
                     RRILVAFELAEREPDPEVRRALLNFIIIGAGPTGVELAGSLAEISRHSLPGDFRNIDP
                     REARIILIEGIDRVLPVYPDDLSQKACRTLEKLGVEVRTGARVTHINEQGIFIGTEFI
                     PARTVLWAAGVAASPVARSLGAQLDRAGRVLVTPELTVPGHDDVFVVGDLASLNDADG
                     KPVPGLAPAAMQEGKHAAHNIRRQLQGKPMEAFSYWDRGSYAVIGRGHAVGIAFRRFK
                     QSGFSAWMAWLLIHITFLIGFRSRLAVLLDWAYSYLTFGKSARIITGPSPRLDRLQPT
                     HALTEGGETSAAPESRFQATASHAEPASPVTH"
     misc_feature    complement(360734..361846)
                     /locus_tag="LILAB_01525"
                     /note="NADH dehydrogenase, FAD-containing subunit [Energy
                     production and conversion]; Region: Ndh; COG1252"
                     /db_xref="CDD:224172"
     misc_feature    complement(361217..361465)
                     /locus_tag="LILAB_01525"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            362263..363288
                     /locus_tag="LILAB_01530"
                     /db_xref="GeneID:10874770"
     CDS             362263..363288
                     /locus_tag="LILAB_01530"
                     /note="COG0468 RecA/RadA recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="recA protein"
                     /protein_id="YP_004663315.1"
                     /db_xref="GI:338529981"
                     /db_xref="GeneID:10874770"
                     /translation="MSKLAEKLKAVAAAVASIEKQFGRGSVMTLGGEAREQKVAVIPT
                     GSVGVDRALGVGGYPRGRVVEVFGNESSGKTTLTLHAIAQVQAAGGVAAFIDAEHALD
                     VSYARKLGVRVEELLVSQPDTGEQALEITEHLVRSGAVDLIVVDSVAALVPRAEIEGE
                     MGDAHMGVQARLMSQALRKLTGAVSRSGTCIIFINQIRMKIGVMFGNPETTTGGNALK
                     FYASVRMEIRRTGNIKDGDAVVGSRARVKVVKNKVAPPFQEAEFDLMYGSGIHRVGEV
                     LDLGVATGLIEKSGSHFSLRGERIGQGRERAAEWLREHPEVLESLGKELTGASPPSPP
                     AAVEAAA"
     misc_feature    362263..363285
                     /locus_tag="LILAB_01530"
                     /note="recombinase A; Provisional; Region: recA; PRK09354"
                     /db_xref="CDD:236476"
     misc_feature    362278..363237
                     /locus_tag="LILAB_01530"
                     /note="RecA is a  bacterial enzyme which has roles in
                     homologous recombination, DNA repair, and the induction of
                     the SOS response.  RecA couples ATP hydrolysis to DNA
                     strand exchange; Region: recA; cd00983"
                     /db_xref="CDD:238483"
     misc_feature    order(362302..362307,362311..362316,362323..362325,
                     362335..362349,362557..362562,362566..362586,
                     362599..362604,362905..362907,362917..362919,
                     363061..363063,363199..363201)
                     /locus_tag="LILAB_01530"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238483"
     misc_feature    362464..362487
                     /locus_tag="LILAB_01530"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238483"
     misc_feature    order(362470..362490,362554..362556,362566..362568,
                     362575..362577,362698..362700,362848..362850,
                     362947..362949,362986..362988,363052..363063)
                     /locus_tag="LILAB_01530"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238483"
     misc_feature    362686..362700
                     /locus_tag="LILAB_01530"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238483"
     gene            complement(363285..363785)
                     /locus_tag="LILAB_01535"
                     /db_xref="GeneID:10874771"
     CDS             complement(363285..363785)
                     /locus_tag="LILAB_01535"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663316.1"
                     /db_xref="GI:338529982"
                     /db_xref="GeneID:10874771"
                     /translation="MQPPTGQPPPGKRWHTREDSGIRLDATLRWWHDDEPILHPKIIE
                     LFNASLVLDEAGRYQLRIGNDWCFVQVDGAAYEVRTVDVTPDERVSVRLSDRTAEALD
                     VDSLHLDADGVLSCRVKQGRAQARLSRDAQYQLGQLLEEAPDGGLVLCVGQRKLAVPV
                     ALDASA"
     misc_feature    complement(363333..363722)
                     /locus_tag="LILAB_01535"
                     /note="Protein of unknown function (DUF1285); Region:
                     DUF1285; cl19847"
                     /db_xref="CDD:268200"
     gene            complement(363843..365285)
                     /locus_tag="LILAB_01540"
                     /db_xref="GeneID:10874772"
     CDS             complement(363843..365285)
                     /locus_tag="LILAB_01540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663317.1"
                     /db_xref="GI:338529983"
                     /db_xref="GeneID:10874772"
                     /translation="MAPVAAQPEEGAASTAAPPAAEPAPAPAPESAASAPGAPVSGGL
                     PLNAARVWLSAYRVEVGLFLVAFVVLASFSSQRFLRQSAAPHFVYQAQAWLEGRLDVD
                     PRVLPNMEDWACVRVVEGDKVRCAGRPLPTDRWYVSFPSFPAVAMLPFVALHGYQFND
                     TSFGVIVGALAVALFYSLLRFLAKEGETARNRNENVALALILAFGTLFFYCAIRGEVW
                     FSAEVMGVALTCLYVRNAVRAQRPLLAGLFFSMATLTRTPLLFTGLFFVLEALCPGPE
                     PRLAQLKALARDWKPAARKVGLFTLGAAPLAGLAAAYNVYRYGRLSEFGHAYLFNNRV
                     NVDIDRTGLFNWEYLPRNLEAAFFKLPTVSLSPLKLAYDPHGLTLLLTLPVLVFLLVP
                     KTRPRLHWPAWLTVAVCALPGLFYQNTGYMQFGFRFSLDYTPYLLLLFALGGWSLRNR
                     AVLAAVALGVLVNFWGAVAFRGYTELVRNW"
     gene            complement(365351..366616)
                     /locus_tag="LILAB_01545"
                     /db_xref="GeneID:10874773"
     CDS             complement(365351..366616)
                     /locus_tag="LILAB_01545"
                     /note="COG1058 Predicted nucleotide-utilizing enzyme
                     related to molybdopterin-biosynthesis enzyme MoeA"
                     /codon_start=1
                     /transl_table=11
                     /product="putative competence/damage-inducible protein
                     CinA"
                     /protein_id="YP_004663318.1"
                     /db_xref="GI:338529984"
                     /db_xref="GeneID:10874773"
                     /translation="MRVELLCTGDELVTGLITDTNSNYLEARLFDLGVKVERVVLVGD
                     VRPDITRALTEAASRADVVVVSGGLGPTADDFTLECAASAAGVPLEEDPRVLGWLHER
                     YAARGIPPNPSALRMARVPRGSEPVKNPEGSAPLVLMKLGGAQLFFLPGVPREFKALL
                     EAEVLPRIRATLDARPGRTYRAFRLLRTVGIPESELDLAVAPMAPRHPRVVFGFRTHA
                     PENHLKLMAEASSQSEADAALAAAEAECRQVLGPRIFGADAETYAAALLETLRRAGAT
                     LAVAESCTGGLIAQQLTAVPGSSDVFIGGAVVYSEKMKSAWVGVPPELLARHTAVSRE
                     TAVAMAEGVRAACATTFGLSVTGYAGPGGGTPEDPVGTVYCALAAPGLPTRVERISVT
                     GDRDRVRLFAASFTQEMLRQHLLAAPATP"
     misc_feature    complement(365372..366616)
                     /locus_tag="LILAB_01545"
                     /note="competence damage-inducible protein A; Provisional;
                     Region: PRK00549"
                     /db_xref="CDD:234789"
     misc_feature    complement(366107..366613)
                     /locus_tag="LILAB_01545"
                     /note="Competence-damaged protein. CinA is the first gene
                     in the competence- inducible (cin) operon and is thought
                     to be specifically required at some stage in the process
                     of transformation. This domain is closely related to a
                     domain, found in a variety of...; Region: cinA; cd00885"
                     /db_xref="CDD:238450"
     misc_feature    complement(order(366143..366145,366152..366154,
                     366164..366169,366407..366415))
                     /locus_tag="LILAB_01545"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238450"
     misc_feature    complement(365375..365839)
                     /locus_tag="LILAB_01545"
                     /note="Competence-damaged protein; Region: CinA;
                     pfam02464"
                     /db_xref="CDD:251312"
     gene            complement(366728..367594)
                     /locus_tag="LILAB_01550"
                     /db_xref="GeneID:10874774"
     CDS             complement(366728..367594)
                     /locus_tag="LILAB_01550"
                     /note="COG1183 Phosphatidylserine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="YP_004663319.1"
                     /db_xref="GI:338529985"
                     /db_xref="GeneID:10874774"
                     /translation="MMKLRKLMFVLPNLFTVTSIFCGFYAITLCTGDVAPVQLYQAAL
                     AIFFAMFFDGFDGRVARLTKTQSDFGVQLDSLADVISFGAAPSLLVYKWALEPLGFVG
                     LFIAFSFAACGALRLARFNVLAARNPHGGGGSFFVGLPIPVAAGMLVSVIISHHAATQ
                     GEPLAEGAIVPMAVAVAGLALLMVSTVRYRTFKDTRPNRKSALAFMLVVVGGTVIATQ
                     FHPAWVLVACCGAYLALGLVESAVLVRSRLAARKVAAPCAVAAVAVATVIDDEDEEEA
                     ESTPGSDGPAYL"
     misc_feature    complement(366887..367594)
                     /locus_tag="LILAB_01550"
                     /note="Phosphatidylserine synthase [Lipid metabolism];
                     Region: PssA; COG1183"
                     /db_xref="CDD:224104"
     misc_feature    complement(367028..367549)
                     /locus_tag="LILAB_01550"
                     /note="CDP-alcohol phosphatidyltransferase; Region:
                     CDP-OH_P_transf; cl00453"
                     /db_xref="CDD:260431"
     gene            367739..368851
                     /locus_tag="LILAB_01555"
                     /db_xref="GeneID:10874775"
     CDS             367739..368851
                     /locus_tag="LILAB_01555"
                     /note="COG0596 Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold family hydrolase"
                     /protein_id="YP_004663320.1"
                     /db_xref="GI:338529986"
                     /db_xref="GeneID:10874775"
                     /translation="MLWNVLWVASVRRWYRPRAELPQVLRARCEDGWELVVHVRRAAV
                     RRFEEPVLLCHGLAANRFTFDFEPPYSVAHYLAEAGFDCFSVEWRGTGHSRQPPRGRR
                     YTDFTIDDHILQDGPALLELALKETGAKRAFWLGHSLGGLVGYGVAQGPHGAKLAGLL
                     TLGAPVHFKSEPFLRTLISMGVRAAWPARFRQEWMSASLAPFLGYVTLPLSDLLVNPE
                     HIPPRIQRQVYANMMSSMSRKVLLQFQDWIEHDAFRSFDRGVDWRAGISKLQLPLLIM
                     GGSSDRLATAANVEAQFALATAPDRTLHIFGTDHGDKMNYGHGDLVFGTGAPTEVYPV
                     IREWLERHAAALPAAITEPAPEQVEEAPREPERSVP"
     misc_feature    367889..368668
                     /locus_tag="LILAB_01555"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    <367889..368068
                     /locus_tag="LILAB_01555"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(368900..370438)
                     /locus_tag="LILAB_01560"
                     /db_xref="GeneID:10874776"
     CDS             complement(368900..370438)
                     /locus_tag="LILAB_01560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663321.1"
                     /db_xref="GI:338529987"
                     /db_xref="GeneID:10874776"
                     /translation="MTVRLAPGRYAGPFVLPPGARLEGLGTGVVLHAGDDSHTVLKMD
                     EGGTLSGVVVQSGQWGLEVTGGSHVRLERVGFSGQRTGAVRVESGRLDVEASRFEAAP
                     KATVGILLESKSPLPPGSGAMATGAERLATAPAAPGTAPRQVAEARADAGADPGQVAE
                     ALADAGTVPRQVAEAPADAGADPGRPAGEAPPTGAEGTRAGPEFPRAAGEAHIRASTF
                     TGPYRRAVRLRGADMRARLEDVRFSGPATAVGVDGAHAEVLRSSAEGGQAAAFSVMSG
                     TLILDEVTVTGHEYGLSAMQALRLEVHRFTSVRAQRAGMGVSLSRARLRDIVVRESGS
                     YGGLQFLGGDLDVQGVRVEGAGEYGLMALRGKLRLRDADIRGVRTADNVTGDGLHLRQ
                     VEADVEGVVVREAQGACVLAAQAARVSLRGAKLEACGDVGLMTDTLARLDASSVKIDG
                     AASALKAQGGSELRVESLDARGLAKGFAQAECEGGTQVLLKDLRSEDTRGLPETPCVQ
                     VLSP"
     misc_feature    complement(369629..>370012)
                     /locus_tag="LILAB_01560"
                     /note="hypothetical protein; Provisional; Region:
                     PRK12495"
                     /db_xref="CDD:183558"
     gene            370959..371228
                     /locus_tag="LILAB_01565"
                     /db_xref="GeneID:10874777"
     CDS             370959..371228
                     /locus_tag="LILAB_01565"
                     /note="COG0776 Bacterial nucleoid DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein HU"
                     /protein_id="YP_004663322.1"
                     /db_xref="GI:338529988"
                     /db_xref="GeneID:10874777"
                     /translation="MTKAELVEVVAAQTRLTKKSAAQILDIVFTNIGKAVKKDARFSY
                     PGFGTWSVRSRKARKIRNPQTNEMMKLKASKTIGFRPAKELKNSL"
     misc_feature    370962..371216
                     /locus_tag="LILAB_01565"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(370974..370976,370983..370988,370995..370997,
                     371022..371033,371037..371045,371049..371057,
                     371061..371066,371076..371090,371097..371099,
                     371181..371189,371193..371195,371199..371201,
                     371211..371216)
                     /locus_tag="LILAB_01565"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(371115..371117,371121..371126,371130..371132,
                     371136..371147,371160..371165,371169..371171)
                     /locus_tag="LILAB_01565"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            complement(371251..372189)
                     /locus_tag="LILAB_01570"
                     /db_xref="GeneID:10874778"
     CDS             complement(371251..372189)
                     /locus_tag="LILAB_01570"
                     /note="COG0739 Membrane proteins related to
                     metalloendopeptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="M23 peptidase domain-containing protein"
                     /protein_id="YP_004663323.1"
                     /db_xref="GI:338529989"
                     /db_xref="GeneID:10874778"
                     /translation="MSFEELYATSAPRPRGPELAPAVTRARRPAPETAPELHAVLSAF
                     AARAQTLRQQVARGGVMPAAQVENWEQMTLALDGFLSRPAAPRVGSGDLLRAQSVLEA
                     ELERDGFTYGDMPASLAEAVVLRVGRLAVRTAELRRLEQPPEPDEDAPPRFSWPVDPV
                     SVTSLFGYRWHPVTGVHRRHLGVDLAATQGQPIYTAEKGVVLRAGRNGDHGLQVEVQH
                     EGRWVTRYSHLSRLLVAAGEVLERGIAVGLAGETGLATGVHLHFELWRDGEPMDPLEA
                     LADAEPPPEPTPPMARRPTGRSPAMQQGRPLAGERP"
     misc_feature    complement(371359..372132)
                     /locus_tag="LILAB_01570"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(371371..371658)
                     /locus_tag="LILAB_01570"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(372358..373383)
                     /locus_tag="LILAB_01575"
                     /db_xref="GeneID:10874779"
     CDS             complement(372358..373383)
                     /locus_tag="LILAB_01575"
                     /note="COG2008 Threonine aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-allo-threonine aldolase"
                     /protein_id="YP_004663324.1"
                     /db_xref="GI:338529990"
                     /db_xref="GeneID:10874779"
                     /translation="MKRIDFRSDTVTQPTAAMRRAIADAEVGDDVYGEDPTVLRLEAQ
                     VAERLGLEAAVFVPSGTQANQLAIGAHCRQGDEVLTEAGSHILHYEGGAVPALWGVQP
                     QPLPGERGLLSPEDVRAAVREDNIHNPRTRLLSLENTHNRGGGSVWPVARFRSVVEAA
                     RKAGLAVHLDGARLFNAGVALGVPVSAWASLTDSTAVCFSKGLGAPVGSALAGRADVI
                     REARRLRKRLGGGMRQAGILAAAALHALEHHVDRLADDHANARRLAAGLAEVPGVKVD
                     ASRVETNMVFAEFTRPALESLSLLERHGVLTNPAGAPRTLRFVTHLDVSAADIDEALE
                     RIRRAVS"
     misc_feature    complement(372370..373371)
                     /locus_tag="LILAB_01575"
                     /note="Low-specificity threonine aldolase (TA). This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I).  TA
                     catalyzes the conversion of L-threonine or
                     L-allo-threonine to glycine and acetaldehyde in a...;
                     Region: TA_like; cd06502"
                     /db_xref="CDD:99748"
     misc_feature    complement(372514..373371)
                     /locus_tag="LILAB_01575"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(372460..372462,372670..372675,
                     372703..372708,372715..372720,372763..372765,
                     372781..372786,373075..373083,373102..373125,
                     373177..373179,373198..373203,373210..373212,
                     373312..373320,373327..373329,373345..373356,
                     373363..373365))
                     /locus_tag="LILAB_01575"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99748"
     misc_feature    complement(order(372781..372783,372790..372792,
                     372865..372867,372874..372876,372973..372975,
                     373192..373194,373201..373206))
                     /locus_tag="LILAB_01575"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99748"
     misc_feature    complement(372781..372783)
                     /locus_tag="LILAB_01575"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99748"
     gene            373495..374160
                     /locus_tag="LILAB_01580"
                     /db_xref="GeneID:10874780"
     CDS             373495..374160
                     /locus_tag="LILAB_01580"
                     /note="COG0177 Predicted EndoIII-related endonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="YP_004663325.1"
                     /db_xref="GI:338529991"
                     /db_xref="GeneID:10874780"
                     /translation="MLVMDWLAADMPDARIELDYRTPLELLVAVILSAQCTDKRVNMV
                     TPALFQRFSDAQAYAEAEPPDVEPFIRTCGLYRAKAKNIVAAARALVQEHGGRIPLQR
                     DALEKLPGVGRKTAGVVCIHLGGDAAFPVDTHVKRLAFRLGFTTKADPDKVEADMQAV
                     LPSERWTLGHQLLVWHGRRTCFARSPACERCVVADLCPKKGVKAAAATETPGRPPRAR
                     AKT"
     misc_feature    373501..374109
                     /locus_tag="LILAB_01580"
                     /note="Predicted EndoIII-related endonuclease [DNA
                     replication, recombination, and repair]; Region: Nth;
                     COG0177"
                     /db_xref="CDD:223255"
     misc_feature    373567..374025
                     /locus_tag="LILAB_01580"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(373597..373605,373612..373614,373729..373731)
                     /locus_tag="LILAB_01580"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    373816..373839
                     /locus_tag="LILAB_01580"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(373846..373848,374002..374004,374014..374016)
                     /locus_tag="LILAB_01580"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    373888..373890
                     /locus_tag="LILAB_01580"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    374035..374085
                     /locus_tag="LILAB_01580"
                     /note="Iron-sulfur binding domain of endonuclease III;
                     Region: EndIII_4Fe-2S; pfam10576"
                     /db_xref="CDD:256069"
     gene            complement(374114..374647)
                     /locus_tag="LILAB_01585"
                     /db_xref="GeneID:10874781"
     CDS             complement(374114..374647)
                     /locus_tag="LILAB_01585"
                     /note="COG0242 N-formylmethionyl-tRNA deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_004663326.1"
                     /db_xref="GI:338529992"
                     /db_xref="GeneID:10874781"
                     /translation="MVREILIWPDPVLKQKAKPVAKVDDSIRTLVKDMFETMYSAEGV
                     GLAGPQIGVLQRVIVLDTTHSQPELKPIAMINPEIIAREGDTTYNEGCLSIPGESAEI
                     DRAAAITVKFLDPDGQEQTLRCDGLLSIAVQHEVDHLDGTVFVDHISSLKREFIRKRM
                     KRLKSSREREVGAPASP"
     misc_feature    complement(374216..374635)
                     /locus_tag="LILAB_01585"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(374234..374236,374243..374248,
                     374369..374377,374498..374500,374513..374521))
                     /locus_tag="LILAB_01585"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(374243..374245,374369..374371,
                     374498..374500,374513..374515))
                     /locus_tag="LILAB_01585"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(374234..374236,374246..374248,
                     374372..374374))
                     /locus_tag="LILAB_01585"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            complement(374737..380238)
                     /locus_tag="LILAB_01590"
                     /db_xref="GeneID:10874782"
     CDS             complement(374737..380238)
                     /locus_tag="LILAB_01590"
                     /note="COG0784 FOG: CheY-like receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver domain/DnaJ
                     domain-containing protein"
                     /protein_id="YP_004663327.1"
                     /db_xref="GI:338529993"
                     /db_xref="GeneID:10874782"
                     /translation="MGAPVLLVHDDIANIAAVRRLLTREGYEVILATSAADALIAYGH
                     HLPVLLVLAPGVESGRGHLVLEELLQHPDGKSARVLLLGEPIPGFSAPVAPLPLEGAA
                     FVALVDSLVKAPADADAWHVVENREPPPSSGGVSAAVGTETESWHATPPPSVAGDPAL
                     ANALFGDLAPLHQTDWELAAMTDAERSAHEAARHREHQSTRDLDTAMARAHLEAEAQA
                     MTSIDSALAPDSADGWGESSQEQDWGSAVEGDADARAPGEEAPPVGRLAWTEEPVSQA
                     SLRTAAPAPQLGDEGFFDVDTPEAPAGDALSAAEAELAAMRAAPSHEPAAPDGSPWTE
                     LPPDPEMEHAARLGTQSDGAASEAPGEASASEPEQASDSESDDAWGTEAALGESTDAA
                     AVSASNWELLEAELQAASTKSHADEEARPAPGDDWFDGEATGETGDAPAAEPSVGADW
                     FDSEAEAASPAPEAPVEAPAAAAGGFAVPALMAQWQAQQEEAERQLEEAHARVSAVTE
                     ALEREAALRRELEQQVQGLQERLAEEEEEHSRESLLRAEAEAALEGLRQRAAPSSTAT
                     SARAVLGDAEAAGDVAALRAELEAQVQLREEAETLTAEVEAQVRQFEDACAEAELRAI
                     DAEARAEAEAKAREEAELRAAASTQALQALEARLESEAAGRVVSEVRAESELKARQAA
                     ESRVESAEDLSSMSEARIDAEARAREAAEARADVEAQARLEADTRAQSLSQAFEEAEA
                     RAELATRSQAELEARAELATRAQVEAEARAESATRAQAEAEARAELAARALAEAEAQS
                     ALIARALAEAEARVQAEAEARVEADARVESVATALAEAEARAEIEAAARMDAEARLSS
                     SATTLAEASARGEVEASARAEADARMESVAAALAEAEARAEVESTARADAEARAKQAE
                     ARAQQEAEARANAEARASSDAAARTEAEARAEQEATARLEAEARAEHAAAALNDAEAK
                     AEQSAAALRDAEARAEIAALAQQDAESRAESEAAARREAEARVQSESEARAAAEARAE
                     AEAAARAEIEARAEREAKLRAAIEVRVESEANSRTQADTRASREAEARAEAEATAEAE
                     ATLRAEAEVRAKAEATARAEAEAQATAESERRAEAEARAEREAKLRAAIEVRVESEAN
                     SRTQADTRASREAESRAEAEARAEAEATLRAEAEVRAKAEATARAEAEAQATAESERR
                     AEAEARAEREATSRAEAEARAERETQTRAEAEARADREAQARAEAEARADREAQARAE
                     AEARAEQAARQLAEAEAQARAEADARAAEKTRAQTEEEQRATQSEAEAKARLEADARA
                     EAALKSAAEAEARAEAEAKHRAEAEARAQQAAQAEAEATARAKTESRHRTALEVRLDA
                     EAKQRATLESRLEEESRARNESESRLLAENARVSEELAELRLEHQQSREELAKEREAR
                     ESLEQSLEALRRESAEQRARAERERHELEERALRDAEEAAAQARASMLPLEAPPGRPE
                     LAVARSGSVTQDGLTKLVLRLCEARMEMRLELKVMNALRVLWLRDGALVGAVSSAQGE
                     SLVDRARADGLIDARQEGELRLVRSATTAALLDALRGRGYLRESEAVPLVQRYTEQVF
                     LDALAEPSTLYRLVPEPAPHEVALAAATRPPLHLLAEALRNTLTSESLLEAAGSLRAR
                     VTRGDLHLAPDDFGLPPRDLQLLSQVDGEHTLEALLLGAGLPQDSALKALAVARTLGL
                     VSLEPAADDDAGDLPPELDVRRLEAKFEEIQDADYFTVLGLARSAGGEEVKRAYELLA
                     AEFHPLRFAGHPDPALQHRAQQIRSVLAEAAQALGDDRLRAEYARSLLD"
     misc_feature    complement(<379993..380223)
                     /locus_tag="LILAB_01590"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(380056..380058,380080..380082,
                     380209..380214))
                     /locus_tag="LILAB_01590"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(380080..380082)
                     /locus_tag="LILAB_01590"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(380056..380058,380068..380073,
                     380077..380079))
                     /locus_tag="LILAB_01590"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(374779..374961)
                     /locus_tag="LILAB_01590"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(order(374800..374805,374824..374829,
                     374836..374838,374869..374877))
                     /locus_tag="LILAB_01590"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     gene            complement(380254..382506)
                     /locus_tag="LILAB_01595"
                     /db_xref="GeneID:10874783"
     CDS             complement(380254..382506)
                     /locus_tag="LILAB_01595"
                     /note="COG1198 Primosomal protein N' (replication factor
                     Y) - superfamily II helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="YP_004663328.1"
                     /db_xref="GI:338529994"
                     /db_xref="GeneID:10874783"
                     /translation="MRAEVSAPVLASIAVGRPVRGEFTYALPEELAGRLEPGQRVLVP
                     FGRGTALGFYLGPASPPPGDKVKLKAVQRVLEDSPSLPRDLIALLRFAAVHYRYPLGE
                     VIRGALPPGLSKAVEEKEAKPDVQHFAVALVNEVPPELSRAPAQSAALAYLLAVGGRA
                     PLEEVAHAIPGARETLKKLATRGFARLEEKTVEASVKEGLIQGRPDHLTPEQDAAGVV
                     LRGALDAATFQPFLLHGVTGSGKTEVYLRAAEHALSLGKGSLILVPEIALTPQLVGRF
                     RSRFGAEVAVLHSALKDRERLFHWQALRRGDVKIAVGVRSAVFAPVDNLGLIVVDEEH
                     DPSFKQEEKLRYQARDLAVVRGKQAGAVVVLGSATPALETLENVKRGRYQLLELKHRV
                     DDRPMPSIELVDLRVERPREGVVTEEAPILSPPLLEAMAETIGRGQQVILFLNRRGHS
                     TVLLCEVCGLSLKCSECDVCLTHHRSQNRVVCHYCGLAMPVPEQCLECTGPMLKLGIG
                     TERVEAEVLERIPTARVTRLDRDSASSAERLTELLASFARRELDVLVGTQMVAKGHDF
                     PGVTLVCVVMADTSLSIPDFRAAERTFHLLTQVAGRAGRGKDPGRVLVQTYNPDAEPV
                     RRVLAHDFDGFANQELEWRKALAYPPYSRMAAVRLEGEHPEQTASVARSLGNIVSRHM
                     PPASAGVRMLGPALAPISRIRGKTRWQLLLKGPTHTALAPLLARVEAALADVPSAVKV
                     VIDVDPGAML"
     misc_feature    complement(380269..382479)
                     /locus_tag="LILAB_01595"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(381397..381816)
                     /locus_tag="LILAB_01595"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(381781..381795)
                     /locus_tag="LILAB_01595"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(381505..381516)
                     /locus_tag="LILAB_01595"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(380692..380967)
                     /locus_tag="LILAB_01595"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            complement(382775..383401)
                     /locus_tag="LILAB_01600"
                     /db_xref="GeneID:10874784"
     CDS             complement(382775..383401)
                     /locus_tag="LILAB_01600"
                     /note="COG0625 Glutathione S-transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glutathione S-transferase"
                     /protein_id="YP_004663329.1"
                     /db_xref="GI:338529995"
                     /db_xref="GeneID:10874784"
                     /translation="MKVYGLPMSTATRMVLAALAEKGQAAELVSVDLTKGEHKASAHV
                     ERHPFGVIPVFEDDDGFRLYESRAIIRYLDRKLPGASLTPSDVHAYARMEQFISVEQS
                     YFSPAAMKVIWERLFKKFLGGGAPDEARIQEGLEGVERVFGIIEPVLGRQQYLAGDSF
                     SLAELTWMPYMEFFVAAGGAELVARHPNVAAWWERVRSRPSWKQVTGS"
     misc_feature    complement(382787..383401)
                     /locus_tag="LILAB_01600"
                     /note="glutathione S-transferase; Region: PLN02395"
                     /db_xref="CDD:166036"
     misc_feature    complement(383174..383401)
                     /locus_tag="LILAB_01600"
                     /note="GST_N family, Class Phi subfamily; composed of
                     plant-specific class Phi GSTs and related fungal and
                     bacterial proteins. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with a wide...; Region:
                     GST_N_Phi; cd03053"
                     /db_xref="CDD:239351"
     misc_feature    complement(order(383189..383194,383201..383203,
                     383339..383344,383351..383353,383360..383365,
                     383372..383374))
                     /locus_tag="LILAB_01600"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239351"
     misc_feature    complement(order(383204..383209,383243..383251,
                     383369..383371))
                     /locus_tag="LILAB_01600"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239351"
     misc_feature    complement(order(383177..383179,383189..383191,
                     383198..383203,383207..383212,383219..383221,
                     383249..383251,383255..383257))
                     /locus_tag="LILAB_01600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239351"
     misc_feature    complement(382787..383140)
                     /locus_tag="LILAB_01600"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    complement(order(382883..382885,382895..382897,
                     382904..382909,382916..382918,383099..383101,
                     383120..383122))
                     /locus_tag="LILAB_01600"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(382970..382972,383096..383098,
                     383105..383110,383117..383122))
                     /locus_tag="LILAB_01600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(382883..382885,382892..382894,
                     383084..383089,383099..383101))
                     /locus_tag="LILAB_01600"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            complement(383520..384275)
                     /locus_tag="LILAB_01605"
                     /db_xref="GeneID:10874785"
     CDS             complement(383520..384275)
                     /locus_tag="LILAB_01605"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663330.1"
                     /db_xref="GI:338529996"
                     /db_xref="GeneID:10874785"
                     /translation="MKRTVALLAVLVSFAAAAYVLPGSSIIRRMAAERAELRLSTLRV
                     EGSLSFGGPAVKEAGAALGTPTDRPEVQGDGVLSIRVPGRCRFEASAPGGSATSTVIQ
                     SGGRRRAQGTEIPAMSVLVAQVCPLLATGSGNVQDQKEAVLRHLQGLGIETGRTGLAR
                     LGGEVTYVLGELAEGRPQFWVYKDSFRPARLRYTDASGTAWDVRFLDYNSPATGEWMP
                     RTIEVWRGGQRSLRFTALKGDNRASVPDSLFTL"
     misc_feature    complement(383589..>383717)
                     /locus_tag="LILAB_01605"
                     /note="Outer membrane lipoprotein LolB; Region: LolB;
                     cl19307"
                     /db_xref="CDD:267660"
     gene            complement(384272..385174)
                     /locus_tag="LILAB_01610"
                     /db_xref="GeneID:10874786"
     CDS             complement(384272..385174)
                     /locus_tag="LILAB_01610"
                     /note="COG1210 UDP-glucose pyrophosphorylase"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_004663331.1"
                     /db_xref="GI:338529997"
                     /db_xref="GeneID:10874786"
                     /translation="MASKTPKVEPLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTP
                     TLQYIVEEAVSAGIEDVVLINGRGKGAIEDHFDIGFEIETTLRARGKEAEADRLRAIA
                     DLVRVVSIRQKEPKGLGHAVLCAKSVIGDEPFGVLLGDDMIDAEEPGIRQLARVYRQY
                     NQAVIALMEVPDNETHMYGIAAGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLP
                     PDIFPILENQTPGVGGEIQLTDGLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAY
                     ALKRPDLRDGLLAYLREVVKTEKP"
     misc_feature    complement(384338..385138)
                     /locus_tag="LILAB_01610"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    complement(384356..385138)
                     /locus_tag="LILAB_01610"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    complement(order(384458..384460,384542..384544,
                     384578..384583,384638..384643,384752..384757,
                     384761..384763,384821..384832,384839..384841,
                     385067..385072,385112..385123))
                     /locus_tag="LILAB_01610"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    complement(order(384338..384343,384350..384358,
                     384362..384370,384374..384382,384398..384400,
                     384470..384472,384644..384646,384830..384832,
                     384836..384838,384842..384847,384929..384934,
                     384944..384946,384950..384958,384962..384964,
                     385034..385036,385046..385054,385058..385066,
                     385076..385084,385088..385102,385109..385111))
                     /locus_tag="LILAB_01610"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            385235..386083
                     /locus_tag="LILAB_01615"
                     /db_xref="GeneID:10874787"
     CDS             385235..386083
                     /locus_tag="LILAB_01615"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663332.1"
                     /db_xref="GI:338529998"
                     /db_xref="GeneID:10874787"
                     /translation="MLLRALVLIALCVSTTALAQPAEDLRDVMSARAYGMGGAYRALG
                     LGVDAMMGNPAAMVLYPSYRMEGTGAWDSHRKEGLLGVSVIDAATSRLGMGMDYHWVS
                     VGRGGARASAHLSSLGVGLPISQSLMLGATVRYLRMSGQSRFANSVTGDAGIMLRLSQ
                     ALMAGFSAHNLVDTGNDELTRYYSAHVGVMTGLLTLAGDVRADFTTNDTTTFTYHGGL
                     EYILGQMFPVRAGYSYDGFTRTSQVSAGLGYMSEGGGGLDFGYRHDLGGPKGRMLALT
                     IKMNMN"
     gene            complement(386085..390602)
                     /locus_tag="LILAB_01620"
                     /db_xref="GeneID:10874788"
     CDS             complement(386085..390602)
                     /locus_tag="LILAB_01620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663333.1"
                     /db_xref="GI:338529999"
                     /db_xref="GeneID:10874788"
                     /translation="MGGVRNGKSAGTPEPAAVRQEALQSGASDVKPAEAVNDVVNRHL
                     RSAARLLREGAAARAFGELARASRTLPMTPRLAAGIVRMALLAGTEAAAITLLEVSPS
                     VVSSRRAVRRQLARVLRRVDQLPRAAAALEALLVEWPEDRGARRVLQVLRARIAGTAS
                     PGARPSAAPEGGGEAGVLAKRPARKDGVQDAVSWDDDGIYLIETVVGPPLAARPPPGA
                     TSTAGTAQARPRSSSSELPLVGGAGPAIASPGSEAGARVEAPAGLERLGAVSDGAAVP
                     SSERSHVESPAAEIRPSEGSAEPVPGATAVSARTGVAELPAVAPNVAAPPAESLKTVL
                     ELPAVEPSAVGLSPRASAPEAPRTLVELPAVVAQPPSLAFEARKTEVEMPALGADASP
                     PASGSVKTFVPGRAPLSVPWADASDDDAGAPAPPVRDVPPAPRREAVTFDDFREDEVT
                     SEAQPFHSTDAVSGQAPRPQAPAASQGPRRKTPVSSEALPPPATPRGAPEPDARAGTM
                     EVSLAELEAALAAASGDAPNARQAAAASPGAEDAEELTRSQKVEAQLIARRAWAELAQ
                     LYLKRADQAKDAALRADALARLAEVMENELHDPAGAARMYREIVALTGDRAALRDQVR
                     LLAARGDASIVRRALDEAIRRAPTARARAGALLTRGERWLHLGELEKARADFEAAESL
                     APGLLPVLAGLLRCVSDRERPAIAERLRVALAAAPRRAPDRVEALRVLAQVAEESLSD
                     LRLAQWAWSEVLAESPDSEQARVQLTTLTRQLGDTTVLSRLLRAQLARESRGPAARQA
                     RLELVTTLDAQGDAEAALEELRQAVRYEPGHKEAWLLLVDRLLARERLGEAAWALEHA
                     ATATEDEEERERTWDRLARLWREVMGNPERAQVYARRAEGLRQARAEREVPPPEPPRS
                     ATPRREPSGPRAPLIPAPPVLTQASANVASLANEETSTTDMGVAPAATEGVDAGGGAL
                     PNAASAPGHPASPGHAASRRRRKRGARSDSASPSHAGAEAQAEGRNPPSSPGNTTAPA
                     PRAPVESFPAPSSKAAGRNPPSSPGNAPAPRAPAEPREAALSKVQAAPKPSGSSRGDK
                     AAQRPAEAAPAPAARDADVRGRRTRATDLMTGELIELGDAPVPETRVISWEAPPGRMD
                     PVRRVVRARPEGTVSAPAPGRTFIAKPPASPEPARPVAGVMETREVPAPAYPASPDTE
                     PDAFRHIRERPLDAQPYRLLAEYFDQRGDPARASLMREIADALDGLETPAPKGQRPPL
                     TSDERAGLRHPGLRTPSGELLACTGIALCRLFPAEGRAAGSSELLRATAGPCAPAVLD
                     ALHTAARMLDVHLPELVLAEDDGPPFTAVHAGHPRLLVGRALLREPMPLPELRFHAGR
                     ALLSLSPDLLALRALKGGQLFRALALLTTVLKDPRAAGAEARVVRESLSPRALERALT
                     LLEPGTQNFKASALADAARDSANRAGLVACGGIGPALTVLRARRGNEAELVELLRFAA
                     SERYLPLRAPR"
     misc_feature    complement(389418..>389993)
                     /locus_tag="LILAB_01620"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK12323"
                     /db_xref="CDD:237057"
     misc_feature    complement(<387912..388694)
                     /locus_tag="LILAB_01620"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     misc_feature    complement(<387351..>387845)
                     /locus_tag="LILAB_01620"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07003"
                     /db_xref="CDD:235906"
     misc_feature    complement(<387066..>387548)
                     /locus_tag="LILAB_01620"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
     gene            390681..391646
                     /locus_tag="LILAB_01625"
                     /db_xref="GeneID:10874789"
     CDS             390681..391646
                     /locus_tag="LILAB_01625"
                     /note="COG0463 Glycosyltransferases involved in cell wall
                     biogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="group 2 family glycosyl transferase"
                     /protein_id="YP_004663334.1"
                     /db_xref="GI:338530000"
                     /db_xref="GeneID:10874789"
                     /translation="MARAVRSLLTGTVRDLRVLTVDDGSTDGTRRVLTDLAASDARVE
                     VLDGRGRGLVAALNLALGQATSPYVARMDADDEALPRRLEASLDALEAEPALAGVGTA
                     VELFRDDQPVSPSLQAYATWLNGLTSAEQLDRERFIESPLCHPSVCLRRDAVIAAGGW
                     RDGDFPEDYALWLELLDQGFALRNLPEVLLRWRDSDGRMTRTDPRYALKRFMWMKARY
                     LTRGRGPLADGRPCTVWGAGPSGKLLTAFLHQEGARVRRYVEVHPRKVGTHIHGIPVI
                     SPQELGAPGDGHLLVCVGVRWARAEIREDLIGWGWVEGRDFTCAA"
     misc_feature    390684..391283
                     /locus_tag="LILAB_01625"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    390687..391259
                     /locus_tag="LILAB_01625"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(390741..390743,390897..390899,390903..390905)
                     /locus_tag="LILAB_01625"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(391651..392595)
                     /locus_tag="LILAB_01630"
                     /db_xref="GeneID:10874790"
     CDS             complement(391651..392595)
                     /locus_tag="LILAB_01630"
                     /note="COG0564 Pseudouridylate synthases, 23S
                     RNA-specific"
                     /codon_start=1
                     /transl_table=11
                     /product="RluA family pseudouridine synthase"
                     /protein_id="YP_004663335.1"
                     /db_xref="GI:338530001"
                     /db_xref="GeneID:10874790"
                     /translation="MKRRTFRVEGGLVGKAVAHAVATELGLPEARARGLVDVGAVYVA
                     GKRSRDASARLAAGQVVTVVLEEGGQSPLAAPPPAPELPVLYEDADVIAVDKPAGVSA
                     QPTEGRVGDSLVDLVGAKLGRAAGLVHRLDRETSGVTVFGKTAEATSALAAAFREGRA
                     RKRYVAATGPGLPPSGTVDLPLSKDPSRPGRWRATRAANGVPALTDFHTLFAGPAFCV
                     VELLPHTGRTHQLRAHLTALGAPILGDARYGGAARAQGVEAARCLLHAQALELGHPRT
                     GKALRIEAPVPEDLMRFFLAAGVEPPQGAIRGAGSGPG"
     misc_feature    complement(391732..392532)
                     /locus_tag="LILAB_01630"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    complement(391783..392325)
                     /locus_tag="LILAB_01630"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    complement(order(391900..391902,392200..392211))
                     /locus_tag="LILAB_01630"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            392766..394286
                     /locus_tag="LILAB_01635"
                     /db_xref="GeneID:10874791"
     CDS             392766..394286
                     /locus_tag="LILAB_01635"
                     /note="COG1164 Oligoendopeptidase F"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663336.1"
                     /db_xref="GI:338530002"
                     /db_xref="GeneID:10874791"
                     /translation="MDRPLHSVRTRLDDFLAELATVHYRQGAGLALEVQPSQLLASFP
                     ELSSPDTFAAANEALAKARAKDDPLLVRRIQRVRELVASHVEDALAARHVDAIATLEA
                     QAKLTVDDQAYAFGEALGRIPHEPARGRRALLERATGEFLWQHRTRYGDRREAALHAA
                     EQLGAKDYPTLRQDVTGIDFAKLAESASTMLARTEDAYRDVLAYVLKKVDPLLRPLPG
                     GEARRHDLQAALQAPWMDGFFRREDAFPAVVRWLGEWGLTPNAGGRIRIDDEARPGKS
                     PRPFVAVVRVPDDIRLVLQPRGGLDGLASLLHELGHAQHRAHVSDTLPVELRRLGDAA
                     VTEAHAAVFERLLLSPDWLKRYLGLPTMAAKDAARLAAFQALTLLRRHAAKLSYELSL
                     TRRGASAERADEYADGQRHALFVEPHPGFFLHDVDPQLYVAHYLRSWALETQLTARLT
                     ERFNEDYWRNPAAAAWLKGLYARGGSDDAEGLATETSGTPLALPEAGERLVAILNR"
     misc_feature    392988..394277
                     /locus_tag="LILAB_01635"
                     /note="Peptidase M3-like family, a zincin
                     metallopeptidase, includes M3 and M32 families; Region:
                     M3_like; cd06258"
                     /db_xref="CDD:188993"
     misc_feature    order(393687..393692,393699..393701,393774..393776,
                     394038..394040,394059..394061,394068..394070)
                     /locus_tag="LILAB_01635"
                     /note="active site"
                     /db_xref="CDD:188993"
     misc_feature    order(393687..393689,393699..393701,393774..393776)
                     /locus_tag="LILAB_01635"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188993"
     gene            complement(394305..394652)
                     /locus_tag="LILAB_01640"
                     /db_xref="GeneID:10874792"
     CDS             complement(394305..394652)
                     /locus_tag="LILAB_01640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663337.1"
                     /db_xref="GI:338530003"
                     /db_xref="GeneID:10874792"
                     /translation="MERKVGSSTVTAKEVKAALEKTRTLSAEEEKVLRMRHGAGASST
                     RAPLPRAAGDNQELGDELLLIEMQLMKAMRARAGGKPVATASSKPVAATRARDAAANP
                     TKDKIVRALRKKK"
     gene            complement(394882..395916)
                     /locus_tag="LILAB_01645"
                     /db_xref="GeneID:10874793"
     CDS             complement(394882..395916)
                     /locus_tag="LILAB_01645"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663338.1"
                     /db_xref="GI:338530004"
                     /db_xref="GeneID:10874793"
                     /translation="MSRLKKSAFTLAVALAAAGCSDPVDKAAKARIFSPEDPPKAVAS
                     AKETLPPEDVADNPRVARRILGMDAAEVTERLGPHRYQATLGYEWTSEASIPVKLTET
                     RTFRAGPGGVGGDFHGVLENSRDQGLEVMRVGGQVFARNRYGPFRQRLRDRGMAERTR
                     AELTGAIRDFDSLFQGRIKLTPEGTVTHEGRTAWRYVVTLAPAGQADTSRPLPPMPQP
                     KKGGADETTVRRANFFAHRLPRSLDGEVLVDAATSVVLKARLDGRMGVPGDKTPEAAE
                     LRLTLEAALSEVGTDPRLQPPEDFLPDADKPQGIADALDTFGIQRKKAGESDSESSGA
                     APEPEDEEGT"
     gene            396022..396876
                     /locus_tag="LILAB_01650"
                     /db_xref="GeneID:10874794"
     CDS             396022..396876
                     /locus_tag="LILAB_01650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663339.1"
                     /db_xref="GI:338530005"
                     /db_xref="GeneID:10874794"
                     /translation="MQNLRDKLLKAGLVTEDQAKKVETKASQAEARRSGPQEGGRSGG
                     NRPPPRRDDNRTQGGPPRAEGGGRPGGPRDAGRREGGGRPGGFGGAPRHGGGPQQGRP
                     AAAPERAIPKLPPMPGSKAYQRAESKRQVELDRALRELVLGSQVPVEAGETAFYFMTR
                     KGKLRRLELSPAQAKQLEEGELGVVERPEPAQIEHSLVPAAAAEQMFALSKKSVRFLN
                     RKDNPVGFMNDEELKAQQAAEAAGTAPELPDEPEGEGEAPASEPPAEGEASTTEPTPA
                     HGDAPQNG"
     misc_feature    396031..>396138
                     /locus_tag="LILAB_01650"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2058); Region: DUF2058; cl01201"
                     /db_xref="CDD:260830"
     gene            397028..397855
                     /locus_tag="LILAB_01655"
                     /db_xref="GeneID:10874795"
     CDS             397028..397855
                     /locus_tag="LILAB_01655"
                     /note="COG3000 Sterol desaturase"
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase family protein"
                     /protein_id="YP_004663340.1"
                     /db_xref="GI:338530006"
                     /db_xref="GeneID:10874795"
                     /translation="MVQGFLKLLPVVFVVSGGLKAVILWAGWKLTHLKSAARLRVYRR
                     AFGKGQLRSEVRAALIVIGCDALLISAFRAFHDERFAPFRWTATLLTFAWMFVMFEAW
                     FYVTHRLMHTRALYWIHAQHHVAQVTNPITSLSFSVAERVVLLGGAFMLVTVAGHFMP
                     ITQAGLVLYILTNYSLNVLAHGNTEWVPGRFVSSWAGRLFFTTTFHAMHHARYQGHYG
                     LFTPVLDRWLGTAFADYPQVHARARAGQGLERLGERIRLDAPSPTVSAPAPGGLGTS"
     misc_feature    397034..397762
                     /locus_tag="LILAB_01655"
                     /note="Sterol desaturase [Lipid metabolism]; Region: ERG3;
                     COG3000"
                     /db_xref="CDD:225546"
     misc_feature    397310..397660
                     /locus_tag="LILAB_01655"
                     /note="Fatty acid hydroxylase superfamily; Region:
                     FA_hydroxylase; pfam04116"
                     /db_xref="CDD:252387"
     gene            397890..398651
                     /locus_tag="LILAB_01660"
                     /db_xref="GeneID:10874796"
     CDS             397890..398651
                     /locus_tag="LILAB_01660"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="YP_004663341.1"
                     /db_xref="GI:338530007"
                     /db_xref="GeneID:10874796"
                     /translation="MTTTSKTVVVTGASRGIGRAVALAFAKEGHDVWALARSKESLES
                     LRQEGGERIRPHAVDVADEAALVAASQRILAEGAPRVLVNNAGITVSAPLTKTRTEDL
                     ARVMAVNVTAPFLLCRELMPAMAQADGGRVINIGSMAAVRGVKYTSAYCASKHALLGL
                     TRALAVEYAKKQVTVNIVNPGWVETDMFAGATSAISASTGRSVEQARDALASMNAMGR
                     IITPEEVAALCLFLASDAAGGITGTAYAIDGGEPG"
     misc_feature    397923..398639
                     /locus_tag="LILAB_01660"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    397923..398633
                     /locus_tag="LILAB_01660"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(397923..397925,397929..397940,397995..398003,
                     398061..398069,398142..398150,398211..398213,
                     398292..398300,398337..398339,398349..398351,
                     398427..398438,398442..398447)
                     /locus_tag="LILAB_01660"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(398214..398216,398298..398300,398337..398339,
                     398349..398351)
                     /locus_tag="LILAB_01660"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            398938..400344
                     /locus_tag="LILAB_01665"
                     /db_xref="GeneID:10874797"
     CDS             398938..400344
                     /locus_tag="LILAB_01665"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663342.1"
                     /db_xref="GI:338530008"
                     /db_xref="GeneID:10874797"
                     /translation="MPATDSRVPPPETSAACSGPDGTARLAWSHDAAWNRTVDFRGLM
                     DADGNTYWTECESSYWVDKDPSLLACQLVSVTPEGTERYRRDLPPPGAWAAHTVEGDQ
                     LFVTGRLALLSARDVATGQERWSVSLGAVKDEDPAAHHALRIESLVRSPPYLVALVHD
                     TFGDVGAEDLLVAVRADTGAVAWKVPVPPVHAPLVVDAEGNVYGGASDVLAQRTALFS
                     YTVDGQLRWRTERTGVVEPTAVDGGTLLLGRAELVDAATGASLATLATASAESFYYSL
                     GRSSSPFGRAALQAGELLVLPDMRCATDGCPTTAHPGGTFLYGLDPESGAVRWHRAVG
                     TWPTAPLLTQRGALLLVDRPVNAPCGEYGCTGDDAAIGSFLRELGPDGRELSACALTG
                     KAPYITPPALHRGRVVLGAWTNWDASNDWTQRMSIRAFDLTTPDEPASGGWVSAGGGN
                     TRSGQTKPTGGAARAAGR"
     misc_feature    399172..399720
                     /locus_tag="LILAB_01665"
                     /note="PQQ-like domain; Region: PQQ_2; pfam13360"
                     /db_xref="CDD:257688"
     misc_feature    399229..>399927
                     /locus_tag="LILAB_01665"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    order(399277..399279,399283..399285,399292..399300,
                     399307..399309,399454..399456,399460..399462,
                     399469..399477,399484..399486,399589..399591,
                     399595..399597,399601..399609,399616..399618,
                     399892..399894,399898..399900,399907..399915,
                     399922..399924)
                     /locus_tag="LILAB_01665"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199833"
     misc_feature    399895..>400287
                     /locus_tag="LILAB_01665"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     gene            complement(400363..402186)
                     /locus_tag="LILAB_01670"
                     /db_xref="GeneID:10874798"
     CDS             complement(400363..402186)
                     /locus_tag="LILAB_01670"
                     /note="COG0840 Methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_004663343.1"
                     /db_xref="GI:338530009"
                     /db_xref="GeneID:10874798"
                     /translation="MTHSLAARLTVALSLVILCLSTLSVALTGVSLRTWSHETLTSRL
                     AQDEAAWSRVLSQESRALTALARVAAAESPLPAALASGAVAEQLEPALRAKQSLLGVE
                     LLVAVDLAAGVRAGTPGGALAGVERLLKQQGAQVVLVGNVPHLAVAQPLTHEGRAVGH
                     LVLGRILGEQELQALRDERGVEGLLTVGETPVAHALGAVPPDALLAALAGKGRPDMVK
                     VNGVSLRLRRVELGPGVELLLTRDGGKEAEQFRESMLLVVLLGVIVTVAAGAAIFLLV
                     RRMMEPLRELTRATARMVSEADFRGGLEVRSKDEIGQLASSFSELMSQLRELLMALRH
                     SAEQLETASTQLTESASVQNEAVSQQAVALHETQMAAQQLQEASRAAARRVEVILREA
                     DKASGFGEAGEAAVSGSVGGLTHIRSHVEQIGRTVAELNQRTRQVGDITRTVKDLADQ
                     SNVLALNASIEAARSGDSGRSFSVVARQMRSLADQSAGATTRVQSILGDIGRAISQAV
                     STSEGGAREVEGGLEQVRAAGESLRSLAGIIQNNGKTVRSIAEAVSQQDAGIAELFAA
                     LSSMADLADQIVDRMAASEQSAIQLSAASAELSAIVGRYRL"
     misc_feature    complement(401206..401352)
                     /locus_tag="LILAB_01670"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(401212..401217,401224..401229,
                     401233..401238,401245..401250,401254..401259,
                     401308..401310,401314..401319,401326..401331,
                     401335..401340,401347..401352))
                     /locus_tag="LILAB_01670"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(400369..401154)
                     /locus_tag="LILAB_01670"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(400474..401073)
                     /locus_tag="LILAB_01670"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(400477..400482,400489..400491,
                     400498..400503,400510..400512,400519..400524,
                     400528..400533,400540..400545,400549..400554,
                     400561..400563,400570..400575,400582..400584,
                     400591..400596,400603..400608,400612..400617,
                     400624..400626,400633..400638,400645..400647,
                     400654..400659,400696..400701,400708..400713,
                     400717..400722,400729..400734,400741..400743,
                     400750..400755,400762..400764,400771..400773,
                     400783..400785,400804..400806,400813..400815,
                     400825..400827,400834..400839,400846..400848,
                     400855..400857,400864..400869,400876..400881,
                     400888..400890,400897..400902,400906..400908,
                     400918..400923,400927..400932,400939..400941,
                     400948..400953,400960..400965,400972..400974,
                     400981..400986,400993..400995,401002..401007,
                     401011..401016,401023..401025,401032..401037,
                     401044..401049))
                     /locus_tag="LILAB_01670"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(400738..400839)
                     /locus_tag="LILAB_01670"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            402439..403038
                     /locus_tag="LILAB_01675"
                     /db_xref="GeneID:10874799"
     CDS             402439..403038
                     /locus_tag="LILAB_01675"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663344.1"
                     /db_xref="GI:338530010"
                     /db_xref="GeneID:10874799"
                     /translation="MRSPCVPAALALLALTPSLLRAEDVATEARAKAEPAPTTRNFGN
                     LRVGGSTANGNGRPELCLELSPVAFLSVESCGTGSGFLHGDPEPEVAHFRAKLRLASF
                     EVERWGTFQPFLAGGFAEAQVGRDDPGFQFSGTDKRRVATTGPEGGLGLRFLRPLAGG
                     FELVGDFNFSLAWLPHAPELIQPGSTWLPSASLSFGVGF"
     gene            complement(403045..403782)
                     /locus_tag="LILAB_01680"
                     /db_xref="GeneID:10874800"
     CDS             complement(403045..403782)
                     /locus_tag="LILAB_01680"
                     /note="COG0631 Serine/threonine protein phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="YP_004663345.1"
                     /db_xref="GI:338530011"
                     /db_xref="GeneID:10874800"
                     /translation="MDSAGQSHIGRRPHNEDAFCVAPELGLFVVADGLGGQEGGEVAS
                     RCVVDTFVGFGLRLGQDQDSTWPTVPDPRRSREENLLAACSALAQRNLQAQRVGRLRE
                     MASTVVALAVSEHGAAVAHVGDSRLYRLRAGKLESLTRDHSLIEELRDAGMEPPGGSG
                     NLRHLITRALGTDNAEPTVQRLQAEPGDVFLLCSDGLYEPLGTEGLMKRLTLSSAQEA
                     CDALVADAYEAGGKDNITAVVLRVAEA"
     misc_feature    complement(403057..403764)
                     /locus_tag="LILAB_01680"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    complement(order(403084..403086,403198..403200,
                     403681..403689,403732..403737,403747..403749))
                     /locus_tag="LILAB_01680"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            404171..405310
                     /locus_tag="LILAB_01685"
                     /db_xref="GeneID:10874801"
     CDS             404171..405310
                     /locus_tag="LILAB_01685"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663346.1"
                     /db_xref="GI:338530012"
                     /db_xref="GeneID:10874801"
                     /translation="MSTIRRITASISSARLDTNLESVSPLVPREPLQPVPAVRRGFAD
                     ESEFQAEVDDLDTSLTAHAPKLAGLDGAQVDAEAPEHLRVFAGESSFESAPPRYSQLL
                     GSQLPASLGAPRESVSGAAHRPSSRGPGAQDMGSDLLSPDAAAWELQHRDTSMAPTPV
                     EAEDVLFMLDGPGAAADLEPAVELGLEDLFEEAPRLRAAEDALFSAGAEDVPAARADT
                     EAARLAGLAPTRFDAPVNFATEAAGIDAVPADLATAAAGDARVDDAPAGFALGSAYAA
                     TYGQQFAARQALDAAVSPAGPDAFLADPLDLGTLAPDEPTLDDAAVAGVLGPISANPA
                     AASAPVAAAFASQGVEVVAEALEPEPRPDANPGAAEALAPEEPQG"
     gene            complement(405316..406491)
                     /locus_tag="LILAB_01690"
                     /db_xref="GeneID:10874802"
     CDS             complement(405316..406491)
                     /locus_tag="LILAB_01690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663347.1"
                     /db_xref="GI:338530013"
                     /db_xref="GeneID:10874802"
                     /translation="MDSEAGAEPPGEDAVMEASSPSAMAAPRKPGGALDAPPAGPPPG
                     VAAPAPAHGPEEAERDARRELWERRLARAKETLAAYMKATRYPPESRPASEHPDQMEL
                     AEPERTHPLNMDGSDIQLRLKQDRVFVVGDEVVHFFVGCEDARRVPRPCQVVSALAHE
                     AEHMPGAGGVPAVPLVFTDDGASGDALAGDGTFTGRFQPSKQGFPIYSGTLRVDVQVR
                     SGSAEGAASFDIMYTPSPPALFTGGVREVLSPEGSLQLYLGIQVQKAGRYVVAGRVDD
                     ESGMPFAHVSFNEELKRGEQEVKLTIAGNLVLDEVPTFPLKLRDVEGFLLKERGDPDR
                     ELMTSLRGYVHTTKDYPFESFSPAEWQGEERQRYLDEMNREIIEIQRYIEQDEPPPP"
     misc_feature    complement(<405784..>406005)
                     /locus_tag="LILAB_01690"
                     /note="TIGR03503 family protein; Region: TIGR03503"
                     /db_xref="CDD:234235"
     misc_feature    complement(405319..405729)
                     /locus_tag="LILAB_01690"
                     /note="CRISPR/Cas system-associated protein Cas4; Region:
                     Cas4_I-A_I-B_I-C_I-D_II-B; cl00641"
                     /db_xref="CDD:260548"
     gene            complement(406621..407508)
                     /locus_tag="LILAB_01695"
                     /db_xref="GeneID:10874803"
     CDS             complement(406621..407508)
                     /locus_tag="LILAB_01695"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663348.1"
                     /db_xref="GI:338530014"
                     /db_xref="GeneID:10874803"
                     /translation="MKKLFGMVLAAATMLAGTEAAAARYTLWIHGRNSGTTQPGNYND
                     FSYWGPASAQAGVNKKAVNWDGRQRIGTQNERIRDALDCFCTGSNQCYIAAHSAGNLQ
                     IGYALSLYGGSTRQVKNASPNASGVCGNVSGGATQKGWNILWVGVASGAAGGSELADI
                     GEWATSDALVTDLKTTNARAMYNHNETRGKAFYMFAASKGTAYSFVLPGQDDEAVAYH
                     STGGVSGSAGSSQCNPGDWFCGATLNMLTQPSSDGRAKWANHSLVLRDDREAYNHYAG
                     GNWGGIIAPLRQYMADYAY"
     misc_feature    complement(407694..409085)
                     /note="potential frameshift: common BLAST hit:
                     gi|108756883|ref|YP_629664.1| class I/II aminotransferase"
     gene            409201..409674
                     /locus_tag="LILAB_01710"
                     /db_xref="GeneID:10874804"
     CDS             409201..409674
                     /locus_tag="LILAB_01710"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663349.1"
                     /db_xref="GI:338530015"
                     /db_xref="GeneID:10874804"
                     /translation="MPTLDIPITLLDPDGGWINTPVHVSELDELPVLLHFFSVKQRGG
                     DEDIDAVKRLIAEFAPRGLKVISVDVTHSAKELRDTNAVEAFARRHGLYHPIAVDDGS
                     MARAYDVADTPAWLVFDADAGRLRHHFSGRNASRHVRQVLERFVQAGAAAPSPAL"
     misc_feature    409219..409593
                     /locus_tag="LILAB_01710"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     gene            409689..410735
                     /locus_tag="LILAB_01715"
                     /db_xref="GeneID:10874805"
     CDS             409689..410735
                     /locus_tag="LILAB_01715"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_004663350.1"
                     /db_xref="GI:338530016"
                     /db_xref="GeneID:10874805"
                     /translation="MATRRKDSDSSRFSLGTVAAAGIGAALGLRRILRSRFQFKDRTV
                     LITGGSRGLGLVLARQFVKEEARVAICGRDELTLERAREELERAGGEVFAIPCDVRDP
                     VQVEAMVSAIHERWGAVDVLVNNAGVIQVGPLESMTLEDFQEAVDTHLWAPLYTTLAV
                     LPEMKRRGQGRIVNIASVGGKVSIPHLLPYSASKFALVGLSDGLRAELRQDGILVTTV
                     CPGLMRTGSPRNAYFKGNHEAEYAWFSTGDSLPVTSLSAEQSARRILAACRRGDAEAL
                     LGAPAKLAAVGRALAPGLTATLTAWVNHFMPQDSSQDRYTGSQSETPLTQSWLTELTR
                     RAAERNNETEVPLH"
     misc_feature    409797..410606
                     /locus_tag="LILAB_01715"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    409818..>410363
                     /locus_tag="LILAB_01715"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(409830..409832,409836..409847,409902..409910,
                     409977..409985,410061..410069,410130..410132,
                     410211..410219,410256..410258,410268..410270,
                     410346..410357,410361..410363)
                     /locus_tag="LILAB_01715"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(410133..410135,410217..410219,410256..410258,
                     410268..410270)
                     /locus_tag="LILAB_01715"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(410752..411861)
                     /locus_tag="LILAB_01720"
                     /db_xref="GeneID:10874806"
     CDS             complement(410752..411861)
                     /locus_tag="LILAB_01720"
                     /note="COG1819 Glycosyl transferases, related to
                     UDP-glucuronosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663351.1"
                     /db_xref="GI:338530017"
                     /db_xref="GeneID:10874806"
                     /translation="MLAGMRILYGVVGEGMGHATRSRVLLEALTQEHEVHIVVSGRAQ
                     DYLARRFQNVHGIWGLTLAYEGNSVKKWQTVLRNLTGAVKGWPQNIRQYFELVDAFRP
                     DVVVSDFESFSYMFARNHRLPVISVDNMQVINRCKHEPALLAGHEDSFETSRAIVKAK
                     LPGAFHYLVTTFFYPELRKRRTTLAPSILRPEIIEAKSEPGEHLLVYQTATTNTALPD
                     ILKAAGIPCRVYGLRRDITEDLVDGNLTYRPFSEQGFIDDLRTARGVVASGGYTLMSE
                     AVYLRKPVLSVPLVGQFEQVINALYLEQLGYGMYVKALTVDALKEFLTRVPRCQQALQ
                     GYEQDGNTRMLAALREQLALAYEHRGHWAMEMARD"
     misc_feature    complement(410881..411849)
                     /locus_tag="LILAB_01720"
                     /note="Glycosyl transferase family 1; Region:
                     Glyco_trans_1_3; pfam13528"
                     /db_xref="CDD:257847"
     gene            411920..412228
                     /locus_tag="LILAB_01725"
                     /db_xref="GeneID:10874807"
     CDS             411920..412228
                     /locus_tag="LILAB_01725"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663352.1"
                     /db_xref="GI:338530018"
                     /db_xref="GeneID:10874807"
                     /translation="MPAPPEPSPPQRSSLGRSAATGLLGGLLLGGLGLLAVGLKNSFI
                     APGCDGLSSPECQLLTDATREVGRVQTLGGGALTALAASLFVLFRPRPPAPPEGPEGS
                     "
     gene            412365..413270
                     /locus_tag="LILAB_01730"
                     /db_xref="GeneID:10874808"
     CDS             412365..413270
                     /locus_tag="LILAB_01730"
                     /note="COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004663353.1"
                     /db_xref="GI:338530019"
                     /db_xref="GeneID:10874808"
                     /translation="MQLESLKMFCDVVETGSFSRAAQLNHVTQSAVSQQIRALENRYE
                     QKLLSRSARQVTPTPAGERLFRGCKEILARFSEVEQEIREQATEVAGTTTVSTIYSVG
                     LHELNAVQKQLLKSHPKVNMRLNYRRNDQVYDDVILGAAEIGIVAYPQPRAGVDILSF
                     RDDKLAVVCAPGHSFATKQKVSLTALSGVPFIAFDREAPTRKALDRLFREKNIDINPV
                     MEMDNVETIKRAVEMGLGVAILPMATAMGEVKGGSLVAKPFAEGPVSRPIGLLIRKGK
                     YLDRASAAVLEAFKAAANLPTSDEA"
     misc_feature    412365..413243
                     /locus_tag="LILAB_01730"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    412371..412550
                     /locus_tag="LILAB_01730"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    412644..413231
                     /locus_tag="LILAB_01730"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(412683..412688,412692..412697,412704..412706,
                     412716..412718,412722..412742,413016..413033,
                     413049..413054,413058..413063)
                     /locus_tag="LILAB_01730"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(413278..414594)
                     /locus_tag="LILAB_01735"
                     /db_xref="GeneID:10874809"
     CDS             complement(413278..414594)
                     /locus_tag="LILAB_01735"
                     /note="COG0144 tRNA and rRNA cytosine-C5-methylases"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="YP_004663354.1"
                     /db_xref="GI:338530020"
                     /db_xref="GeneID:10874809"
                     /translation="MNARALAITVLARVRATDAYLNVVLDTQLSESPPKDPRDAALVT
                     ELAYGATRRQLALDYAIARFADRKLDALEDKVLAALRIGAYQIFHTRVPARAAVAETV
                     QALKEVGLTRAAGFTNAILRKLADLPAPPLPPASDVALHLSVRESHPQWLVERWLRQF
                     GRERAEAMLVADNQAPAVVVRANTAKVTRDALLTQLQEMGVDAKATTVSPVGITLPPV
                     GRVEDVYGYAEGLWQVQDEAAQLVGVYGAIPESARVLDACAAPGGKSCHQAQSHDVVA
                     VDLHAHKLRKIDAEAKRLGLQPRLKAYAHDAAEPFPEEWGEFHAFLVDAPCSGLGTLR
                     RHPELRYRRKEEDISRLATLQRRILENCQEAVPAGGLLVYAVCTMEPQEGQDQVEMFL
                     RSHPEWTAEPPVLPGLKLPLSQAYLRTLPGPEGFDGFFAARLRKLY"
     misc_feature    complement(413287..414594)
                     /locus_tag="LILAB_01735"
                     /note="16S rRNA methyltransferase B; Provisional; Region:
                     PRK14902"
                     /db_xref="CDD:237857"
     misc_feature    complement(414226..414594)
                     /locus_tag="LILAB_01735"
                     /note="NusB family; Region: NusB; pfam01029"
                     /db_xref="CDD:250306"
     misc_feature    complement(414583..414591)
                     /locus_tag="LILAB_01735"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238253"
     misc_feature    complement(<413512..>413775)
                     /locus_tag="LILAB_01735"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            complement(414591..415517)
                     /locus_tag="LILAB_01740"
                     /db_xref="GeneID:10874810"
     CDS             complement(414591..415517)
                     /locus_tag="LILAB_01740"
                     /note="COG0757 3-dehydroquinate dehydratase II"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 3-dehydroquinate dehydratase"
                     /protein_id="YP_004663355.1"
                     /db_xref="GI:338530021"
                     /db_xref="GeneID:10874810"
                     /translation="MGMRLLVLHGPNLNLLGVRDDTSGGRLEDLDAAMQARAEALGLE
                     LTVVQSNHEGDLLDTLGAELEELDGIIINPAGLFGSYCLKEGLEAAGLPAIEVLLKPP
                     ARESVVGEACVLQIHGGPGFEPYLQALETFGSGVFTTAQPEPKKPLGKKKGSATRGAK
                     VTPITVLKRAPRREGSSETAKSLARAVKAAGPTKTLGRKLAPVEDLRAARQAKTLGRG
                     GKGLTPAADLLTRALVRQKISDRLAGRLSAAELATWARSQYQAVQRGAPAEHGHRELL
                     EESLQSLTLSNLPATRLSDEQLVDLLTRLDEG"
     misc_feature    complement(415122..415511)
                     /locus_tag="LILAB_01740"
                     /note="Dehydroquinase class II; Region: DHquinase_II;
                     pfam01220"
                     /db_xref="CDD:250454"
     misc_feature    complement(order(415251..415253,415260..415265,
                     415272..415274,415290..415292,415335..415337,
                     415344..415346,415353..415367,415476..415478,
                     415482..415484))
                     /locus_tag="LILAB_01740"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(415221..415226,415263..415265,
                     415284..415286,415290..415295,415299..415301,
                     415449..415451,415461..415463))
                     /locus_tag="LILAB_01740"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(415137..415139,415149..415151,
                     415158..415166,415173..415184,415188..415193,
                     415209..415214,415218..415220))
                     /locus_tag="LILAB_01740"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            complement(415533..416447)
                     /locus_tag="LILAB_01745"
                     /db_xref="GeneID:10874811"
     CDS             complement(415533..416447)
                     /locus_tag="LILAB_01745"
                     /note="COG0223 Methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_004663356.1"
                     /db_xref="GI:338530022"
                     /db_xref="GeneID:10874811"
                     /translation="MGTPDFAVASLAACFDLGEVVAVVTQPDKPKGRGNTVTAPPVKE
                     LALSRGVPVLQPTKLRTPPFSEELRQYAPDICVVTAYGRILPKDLLELPTHGCVNVHG
                     SLLPRFRGAAPIQWAIAHGDAETGVSLMVMDEGLDTGPVLAMKRMPIAPDDTSATLYP
                     KLAALGGEVLREFLPAYLRGELKPVPQPSEGMVLAPIIEKDQGRLDFTRPAVELERRL
                     RAFTPWPGAFTTLGGKLLKVHRATARGGSGAPGTVLAAGPDGIEVACGEGSLVLLDLQ
                     PEGKRVMRAADFLQGHKLAPGSQPFVAG"
     misc_feature    complement(415551..416447)
                     /locus_tag="LILAB_01745"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    complement(415854..416447)
                     /locus_tag="LILAB_01745"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(416037..416042,416049..416054,
                     416058..416060,416118..416120,416142..416153,
                     416178..416180,416193..416216,416427..416432,
                     416442..416444))
                     /locus_tag="LILAB_01745"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(415857..415859,416112..416120,
                     416142..416147,416151..416153,416202..416213,
                     416343..416354,416358..416360,416370..416372,
                     416430..416432,416436..416441))
                     /locus_tag="LILAB_01745"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(416037..416042,416049..416054,
                     416151..416153,416178..416180,416193..416201,
                     416205..416207,416214..416216))
                     /locus_tag="LILAB_01745"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(416037..416039,416145..416147,
                     416151..416153))
                     /locus_tag="LILAB_01745"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(415593..415847)
                     /locus_tag="LILAB_01745"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(415599..415601,415605..415610,
                     415614..415616,415620..415622,415737..415739,
                     415743..415745,415776..415778))
                     /locus_tag="LILAB_01745"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(416501..417058)
                     /locus_tag="LILAB_01750"
                     /db_xref="GeneID:10874812"
     CDS             complement(416501..417058)
                     /locus_tag="LILAB_01750"
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="YP_004663357.1"
                     /db_xref="GI:338530023"
                     /db_xref="GeneID:10874812"
                     /translation="MRPSHIRRTYILDRPFQLKYILLLAGIGAGGIGVFGLLAHRVHV
                     SSVASGVDGGQTLLWLTGLGTLGAAVALGLFGLVFTHRVAGPVHVMSLYVAALAAGRY
                     PRLRPLRRGDELKLFFDRFSEAVTRIREREADEAYALETVLEALRPVATTPEALEALG
                     TLSALHTRKRQAVDTPTGSTFKSVA"
     gene            417186..418781
                     /locus_tag="LILAB_01755"
                     /db_xref="GeneID:10874813"
     CDS             417186..418781
                     /locus_tag="LILAB_01755"
                     /note="COG1413 FOG: HEAT repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="HEAT repeat-containing PBS lyase"
                     /protein_id="YP_004663358.1"
                     /db_xref="GI:338530024"
                     /db_xref="GeneID:10874813"
                     /translation="MTRSLTALCVALSFLTLAGCKGDPATPEYWESNIQQSRRAEDRI
                     RMVEAMRASGKLNEGFLPMLHEQLDTERKPEVRAALARALGDLKHASSVEPLTKALDP
                     AAGDMPAQLANKAIVATLGTIGDRRAIPALVPLLRAKDNYTRIEATQVLGDMKAKEAV
                     EPLIALATDDTVEPFLNKKAIEALGDIGDARAAPALVRMLTKERKGKSFYVESSFALY
                     QLGAPAADALLPALEGQDAELLKWARSNGVNPASYAMKAATVLGDLREKRAVAALLKQ
                     LAFTNADPQIQALVRMQAADALARMRAPEAVKPLAGLVTETDPTVRDAYVRALTRLGG
                     RDALPALEKAAGTGDWYARESAVKGLAMLGDARELPVLQKLAAAEPARTAADCKQADD
                     DGCDDPAALGKQRADQISGQAKLLEAAQACAGNAGCWVQRMEKADPVLLERAALEVGR
                     AGTAEHAVALAARLGERDTEARLALVLAVGWLVEGSRDTAKKLRQAALPTLRKQLADE
                     QGNTRFVSVNEDLRRLVATLDRT"
     misc_feature    417366..417641
                     /locus_tag="LILAB_01755"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    417570..417794
                     /locus_tag="LILAB_01755"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    417999..418268
                     /locus_tag="LILAB_01755"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            complement(418735..420900)
                     /locus_tag="LILAB_01760"
                     /db_xref="GeneID:10874814"
     CDS             complement(418735..420900)
                     /locus_tag="LILAB_01760"
                     /note="COG1289 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663359.1"
                     /db_xref="GI:338530025"
                     /db_xref="GeneID:10874814"
                     /translation="MGSLRHHLQAFLRVEPGRPAYGAGLRAALAVGAPLAAAALLHLP
                     AATWVGLSALFVALVDRGGPYGYRARTMGAMTLMGAVVGLAAALHLPAWAAVIVTLLW
                     VTACGFARSYGDTPGLMGVVLANYFVVSLALPARDVSDALLRSGLFLVGGAWAMFLAL
                     LLWPLFPYRPARMAIARCYDALAEHAEEVGRWPLEGLPVAAGVLPVAPWQARMRQLIE
                     QARTVLASTRMGRAGESGRGEHLLVLLEGADAMMVTLIALTEMLEVAPAEPRYHALRS
                     EVQRALAELAADLRRVRLALEKEGGGSGPPAWSAERVKRALAAAGDLPEQARAGYQYV
                     YSLLDRLRDYAHATVDVAARLEDSAPVPDTPSLPSRPASKAPPSSPLEPLRENLNVRS
                     VIFRHALRLGVAASLAMALVSALDLNHGYWVIITVTVVLQPYAGLTFQRSLQRIAGTL
                     LGAGLAAGLVALVRDPAIILLAIVVLFAVAMSLQPLSLAAFQVLLTPALVLLAELQTG
                     DWELAGVRIVNTLLGGLIALAGMRLLWPSPEHLRLPEQVASALRADRDYVMAVASASS
                     DAEAPVREARRRMGLALLSAEASFQRLLGEWRGPARELEPVMALLVYARRFTSAVTTL
                     AASRSERAAPRELADVVRFVVCVLEDLAAAVEQQRRPAPMPTPAPKGGAEPLVRTHVE
                     RLLRQLTVLHHAAERVPPLLFKEGLRSGPASPPAAAGPR"
     misc_feature    complement(420028..>420489)
                     /locus_tag="LILAB_01760"
                     /note="FUSC-like inner membrane protein yccS; Region:
                     FUSC-like; pfam12805"
                     /db_xref="CDD:257312"
     misc_feature    complement(418825..420462)
                     /locus_tag="LILAB_01760"
                     /note="integral membrane protein, YccS/YhfK family;
                     Region: YCCS_YHJK; TIGR01667"
                     /db_xref="CDD:130728"
     misc_feature    complement(419311..419682)
                     /locus_tag="LILAB_01760"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            complement(421197..421952)
                     /locus_tag="LILAB_01765"
                     /db_xref="GeneID:10874815"
     CDS             complement(421197..421952)
                     /locus_tag="LILAB_01765"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663360.1"
                     /db_xref="GI:338530026"
                     /db_xref="GeneID:10874815"
                     /translation="MTSQNRIVLTVYAPALIGDDERPLAVVHGMEKALPGLRLEWRVT
                     GSRRLAALPQRDAWLVEKIKDGGFPLVCNGDESYPVTVMGRGSSGLFSPGGQALFEVH
                     AKLPLDAAVVAAAAAMLERVAEGTRAFWGRATPHDAAVDIAYQTAPTLEGPPSPRRGL
                     PALKLFEHIRAPEIPYYLGWLNYWSAAAAQAIGFPDPTRDAELLSRARRTASGGWVVQ
                     LTDAPLDLDDPTHLDTLKRTYERFPEIGGRAAP"
     gene            complement(421949..422221)
                     /locus_tag="LILAB_01770"
                     /db_xref="GeneID:10874816"
     CDS             complement(421949..422221)
                     /locus_tag="LILAB_01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663361.1"
                     /db_xref="GI:338530027"
                     /db_xref="GeneID:10874816"
                     /translation="MDVFVGGERFDALQVGVRVLWEIKTHRFDTYPDFIQEREIEKEL
                     EQIERERKAAAACGYGFIMGVSTQAHKDALLAVVPSLRIVVTGCKR"
     gene            complement(423073..424449)
                     /locus_tag="LILAB_01775"
                     /db_xref="GeneID:10874817"
     CDS             complement(423073..424449)
                     /locus_tag="LILAB_01775"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663362.1"
                     /db_xref="GI:338530028"
                     /db_xref="GeneID:10874817"
                     /translation="MLDFTKAGWLLPLLTETVAFEAGAPAPSVPPLGSGRARARAHLR
                     RTLRATGLLYGTPADAPSAAELAPPTESQARLLEDQLFHAVVRTLALMALELGRLVGT
                     PTAVRTEQLLVLFAVLAGELELARTLEVTIASGRPVSRRLAAKVEASLVKRSPVLAGD
                     PVYGLVLHNGAQYADAQLFCRQAIDYFSRGTLHRERAQRRLDFAARQKALLVDVLTGL
                     ACVDRVPGLSARRAILRQVESLRLPAAMTSELKAAVKQSFARRRPVRDVVRQVRSVDV
                     RHFLLEQTLLAALVDGRKTRRERVFIRELAQALQVSDTELHRLELEMAEFYARHRAIV
                     DVFTVSDAAGAMGDDLVAGIQETLEKNFYRLIQEVRETGDLAVLLTKAARRQPLTGDE
                     RQRMRAQLIDVAKAIPALAIFAAPGGVLLLAALAKVLPFSLLPSAFQEAAPVEEDLED
                     VGPEREAG"
     gene            complement(424620..425456)
                     /locus_tag="LILAB_01780"
                     /db_xref="GeneID:10874818"
     CDS             complement(424620..425456)
                     /locus_tag="LILAB_01780"
                     /note="COG2220 Predicted Zn-dependent hydrolases of the
                     beta-lactamase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase family protein"
                     /protein_id="YP_004663363.1"
                     /db_xref="GI:338530029"
                     /db_xref="GeneID:10874818"
                     /translation="MRTKLMAVVAGAAMAFGGTAAAQGTPAPVKPAATTKAPTAAARG
                     KAEVTWWGHAAFVIRSPGGAVIAIDPWLTNPKAPKGAAQPEALDAILLTHGHFDHVGE
                     AKALAEKTGAKVYGSFELINLLGLPEAQAVGANAGGTFRVKDVTLHLVEAVHSSSYAA
                     DPKSPAQYAGAPLGYVLKIDKGPTLYHAGDTGAFEGMSLIATQFKPTVALLPVGGHFT
                     MGPAEAAQAVRLLKVKSVIPMHYGTFPLLQGTPDALTGELKKLRSTARVVTPEPGVTT
                     AL"
     misc_feature    complement(424638..425318)
                     /locus_tag="LILAB_01780"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; cl00446"
                     /db_xref="CDD:260426"
     gene            425649..427517
                     /locus_tag="LILAB_01785"
                     /db_xref="GeneID:10874819"
     CDS             425649..427517
                     /locus_tag="LILAB_01785"
                     /note="COG0326 Molecular chaperone, HSP90 family"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP90 family protein"
                     /protein_id="YP_004663364.1"
                     /db_xref="GI:338530030"
                     /db_xref="GeneID:10874819"
                     /translation="MDHRFQVSLRGVIDLLSHHLYSSPGVYVRELLQNATDAIRARQL
                     LEPGHAGTVRLELMEKQDGSPPTLLFTDDGVGLTEDEIHRFLATIGESSKREALEARR
                     NDFIGQFGIGLLSCFMVCDELLVVTRSARGDGRTLEWRGRHDGTYAVRPSEHPLAQPG
                     TQVFLVARPDMTHWFTAQRLRNLASHYGGLLPFPVHLTTPEGTERLDTSGVPWRREYD
                     SAGERRKALLAYGRELFDTDFVDCIPLRSTAGDVDGVAYVLPASPHFNSRQKHRVYLK
                     HMLLSESAENLLPDWAFFVKCVVNANALRPTASRESFYEDEALAAARESLGQSLRGYL
                     MELAREDPRALQRLIALHGLSVKALALDDDDFYRLIIHWLPFETSMGMMTLADYRRAH
                     PVVRYTSTLDGFRQIAQVASAQGLCIINAAYTHDTSLLEKLPHAVPDVQVEPFSSADL
                     PQSFEELTLDEREATFPLLRMAERVLAPFRCGAVVKKFYPAEVPTLYSADAEGAFRRD
                     VERAREESDDLFAGVLDSVVAAAGGEPAQLCFNLHNPVVRRLAAVADRDMLKLSVEML
                     YVQALLLGHHPLNAQELVLLNQGLLGLISAHLGGEGGRRPPAAPDAATPPGPPARG"
     misc_feature    425649..427463
                     /locus_tag="LILAB_01785"
                     /note="HSP90 family protein; Provisional; Region:
                     PRK14083"
                     /db_xref="CDD:237603"
     misc_feature    425730..426044
                     /locus_tag="LILAB_01785"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(425736..425738,425748..425750,425757..425759,
                     425856..425858,425862..425864,425868..425870,
                     425874..425879,425976..425987,426021..426023,
                     426027..426029,426042..426044)
                     /locus_tag="LILAB_01785"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    425748..425750
                     /locus_tag="LILAB_01785"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(425868..425870,425874..425876,425976..425978,
                     425982..425984)
                     /locus_tag="LILAB_01785"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    <426387..>426626
                     /locus_tag="LILAB_01785"
                     /note="Hsp90 protein; Region: HSP90; pfam00183"
                     /db_xref="CDD:249661"
     gene            complement(427426..427722)
                     /locus_tag="LILAB_01790"
                     /db_xref="GeneID:10874820"
     CDS             complement(427426..427722)
                     /locus_tag="LILAB_01790"
                     /note="COG2135 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663365.1"
                     /db_xref="GI:338530031"
                     /db_xref="GeneID:10874820"
                     /translation="MVDGWYEWKQSTKPKTPYYFHRKDGQLLTLAGLWEEWTAPDTGE
                     VLNTCTLITTGPNALMAPIHDRMPVILAPEAQEVWLRPEPQEACARPPRPGARR"
     misc_feature    complement(427462..>427719)
                     /locus_tag="LILAB_01790"
                     /note="Uncharacterized ACR, COG2135; Region: DUF159;
                     pfam02586"
                     /db_xref="CDD:251395"
     gene            427763..428890
                     /locus_tag="LILAB_01795"
                     /db_xref="GeneID:10874821"
     CDS             427763..428890
                     /locus_tag="LILAB_01795"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663366.1"
                     /db_xref="GI:338530032"
                     /db_xref="GeneID:10874821"
                     /translation="MSGDWREQVKALFNQAGALGEGEGKVRLLEEAVRLADTHKDVGL
                     GYRMRDALIDAATFGGFPDKALVAFAWCRGQQKKDPKRFEPEDMFWKQKWVVARIKEF
                     PHITRKQIADALDDVEQCFKATDSGTRAVLKLRYQAAREMGDAAEEVERLWNAWLEAR
                     RDHLTDCRVCELDDELDHHADKGEWQQVLRKAKPILDGRKACAEIPHLTLGTVLYPLF
                     KLGELEQARELHRRGYALVAKNREFLSTVGEHLEFLALTDNLSRGLTLLEKHLGWALD
                     HPSYRDRFTFYAAAAFLLERVLTAGERDVVSLRLPKTFPHHQADGGYDVRALHAWTLE
                     QARDIANRFDTRNGTDRFARLLARNQVLAGEVRPFPVDAKP"
     gene            complement(428903..431242)
                     /locus_tag="LILAB_01800"
                     /db_xref="GeneID:10874822"
     CDS             complement(428903..431242)
                     /locus_tag="LILAB_01800"
                     /note="COG2183 Transcriptional accessory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="S1 RNA-binding domain-containing protein"
                     /protein_id="YP_004663367.1"
                     /db_xref="GI:338530033"
                     /db_xref="GeneID:10874822"
                     /translation="MHAYAAELSQELGLRPEQVDRTLALQEDGATVPFIARYRKEVTG
                     GLDEVQIQTILDRATERAELDARRDTILRTIEEQGKLTPELTRALKAAKTRTELEDLY
                     LPYKPKRRTRAAIARERGLEPLADLLWKQDGRRGEDAAARVRPFINPEKDVQDQAAAL
                     AGARDICAERVAEDAGLRREAREVSARRGTLCSNVVAAKKGEPTKFENYYGHEEPLSQ
                     APSHRVLALLRGEEEGVLKVKLSLPDDEVKGLLAGRVVTKPQSLFAQELRAAVEDGWD
                     RLMGPSLEAELRAELKERADRQAIGVFGENLRHLLLTPPAGARAVLALDPGLRTGTKL
                     AMMDVTGKVVETLTLYSERGADERARAAKLLAAVVQKHKPELIAVGNGTGSREAELFV
                     RDTLKALGSQVPVVSVSEQGASIYSASEVARDEFPDLDVSLRGAVSIGRRLQDPLAEL
                     VKIDPKSIGVGQYQHDVDQGLLKKKLGEVVDSCVNAVGVDVNTASPQLLEHVSGVGPS
                     LAKKLVAHRAAKGRFTTRRELLKVSGLGPKTFEQAAGFLRVRGTEPLDASAVHPERYG
                     VVERMARDLGVAVSALVGNAELVRKIDPRRYLGPDLGELTLKDILAELEKPSRDPRGD
                     FTAPQHREDLRSLEDVKEGMVLQGVVTNVTAFGAFVDVGVHQDGLVHVSQISTRFVKD
                     PSEVVKVGDRLTVRVLTVDLARKRLALSVRAVQEGGAPQPSGRPHVGGATGPGRMTER
                     GGGPPRQGARPPSSSGPQSKPAEKKGPEPFNNPFSKLKR"
     misc_feature    complement(428957..431230)
                     /locus_tag="LILAB_01800"
                     /note="Transcriptional accessory protein [Transcription];
                     Region: Tex; COG2183"
                     /db_xref="CDD:225094"
     misc_feature    complement(430637..431221)
                     /locus_tag="LILAB_01800"
                     /note="Tex-like protein N-terminal domain; Region: Tex_N;
                     pfam09371"
                     /db_xref="CDD:255322"
     misc_feature    complement(429992..430288)
                     /locus_tag="LILAB_01800"
                     /note="Likely ribonuclease with RNase H fold; Region:
                     YqgFc; smart00732"
                     /db_xref="CDD:128971"
     misc_feature    complement(429599..429793)
                     /locus_tag="LILAB_01800"
                     /note="Helix-hairpin-helix motif; Region: HHH_3;
                     pfam12836"
                     /db_xref="CDD:257337"
     misc_feature    complement(429113..429316)
                     /locus_tag="LILAB_01800"
                     /note="S1_Tex: The C-terminal S1 domain of a transcription
                     accessory factor called Tex, which has been characterized
                     in Bordetella pertussis and Pseudomonas aeruginosa. The
                     tex gene is essential in Bortella pertusis and is named
                     for its role in toxin expression; Region: S1_Tex; cd05685"
                     /db_xref="CDD:240190"
     misc_feature    complement(order(429230..429232,429236..429238,
                     429266..429268,429290..429292))
                     /locus_tag="LILAB_01800"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240190"
     gene            complement(431337..431831)
                     /locus_tag="LILAB_01805"
                     /db_xref="GeneID:10874823"
     CDS             complement(431337..431831)
                     /locus_tag="LILAB_01805"
                     /note="COG1670 Acetyltransferases, including N-acetylases
                     of ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_004663368.1"
                     /db_xref="GI:338530034"
                     /db_xref="GeneID:10874823"
                     /translation="MDFWLEMRAAPGARRFVETGEDSRELLLRRILEAGALGRPGARS
                     FRWFVEADGQLAGTVSARELSRAHGRAELGYMMADAYHGRGLGTRAVGLMLEELFTLP
                     FLQRVWLTTLAENAASRGVARKLGFTLEGTLRGHCLFQGQRRDQQLWGLLRDEWASSR
                     ASRG"
     misc_feature    complement(431448..431828)
                     /locus_tag="LILAB_01805"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(431502..431693)
                     /locus_tag="LILAB_01805"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(431568..431573,431601..431606))
                     /locus_tag="LILAB_01805"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            432009..432419
                     /locus_tag="LILAB_01810"
                     /db_xref="GeneID:10874824"
     CDS             432009..432419
                     /locus_tag="LILAB_01810"
                     /note="COG0768 Cell division protein
                     FtsI/penicillin-binding protein 2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663369.1"
                     /db_xref="GI:338530035"
                     /db_xref="GeneID:10874824"
                     /translation="MGLPERRAQKAYETNVFPQQKQRIDEAAHFEVPVEVQWETLMED
                     DYSHLFESAWTTVYIDPLVEAFKGICIDDMGQEALKEKLKKVVIQNKAENASASRIAR
                     FEDGVLTLDHKPFTNIDDEKDRTQAIQKTLEAAL"
     gene            432522..432863
                     /locus_tag="LILAB_01815"
                     /db_xref="GeneID:10874825"
     CDS             432522..432863
                     /locus_tag="LILAB_01815"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663370.1"
                     /db_xref="GI:338530036"
                     /db_xref="GeneID:10874825"
                     /translation="MEKGAPPGEGRREVTRMLKNTWPRDRHVGPGGGLYTGPGGGLYT
                     GPGGGMSTGPGGGLYRGLGGGLYTGPGGGLYTGHCEQPYRSNLPPREALLEYLARNRL
                     EHLLCLLLQCG"
     gene            complement(433078..435105)
                     /locus_tag="LILAB_01820"
                     /db_xref="GeneID:10874826"
     CDS             complement(433078..435105)
                     /locus_tag="LILAB_01820"
                     /note="COG3540 Phosphodiesterase/alkaline phosphatase D"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alkaline phosphatase"
                     /protein_id="YP_004663371.1"
                     /db_xref="GI:338530037"
                     /db_xref="GeneID:10874826"
                     /translation="MCSGDPRPDSVVLWVRAVDPDNAGGNTQVRLEVSTSEDFSSLVL
                     DQTFTALAASDHALKVKVTNLSARTTYYYRFSIDAGGQKHSTVTGRTRTAPAPTDTVP
                     VKFVFASCQDYIGRYYNAWQHLLQLDEDLDFVVFLGDYIYETTGDASFQSVDGRGVIF
                     SEPEKALRQGTGLTAFYAANSLSNYRDLYKNLRKDKVIQRVHERYPFIVTWDDHEFSD
                     DCWGDVATYTDEKTNEKQTERRRNAEQAFFEYIPMEHGESAAGAIDINAVVSQPTRIY
                     RDFEFGQNLKLLVTDTRTYRPDHLIPEDAYPGKVAVPAEQLALVLPTLPEPVQAQLQS
                     DMFAYVDIDAEELAPYKQVLTGVYVQQAVAAGLTAEEAATKAATWITGGQALLYVNQV
                     LNAVNQARVAAGEDAIPAIPVDGTPRGLAFAHMGKTGLFGIQGSRYVVVKPIFDLYAA
                     IKYMGSAGASEGIFGNEQQAWLQESVAQATNAWKIIVSSISLTTMVFKLSDKADVPDP
                     TLRQDFYFNVDQWDGFPTKKQEFLKYLRDSNVQNALFISGDIHASFASVESGIPALTA
                     PAISSGSIKELAGLAVIGAGFSTGSTVYRYIVAELDKSLKEAHPGMEFVDGDAHGFVV
                     LEVGASEAKAAFHLIPSTEIAKDYSLRQPSELTAKFTRRDFVIKDGTITAA"
     misc_feature    complement(433198..435099)
                     /locus_tag="LILAB_01820"
                     /note="PhoD-like phosphatase; Region: PhoD; pfam09423"
                     /db_xref="CDD:255356"
     misc_feature    complement(<434185..434796)
                     /locus_tag="LILAB_01820"
                     /note="Bacillus subtilis PhoD and related proteins,
                     metallophosphatase domain; Region: MPP_PhoD; cd07389"
                     /db_xref="CDD:163632"
     misc_feature    complement(order(434227..434229,434464..434469,
                     434689..434691,434770..434772,434776..434778))
                     /locus_tag="LILAB_01820"
                     /note="putative active site [active]"
                     /db_xref="CDD:163632"
     misc_feature    complement(order(434227..434229,434467..434469,
                     434689..434691,434770..434772,434776..434778))
                     /locus_tag="LILAB_01820"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163632"
     misc_feature    complement(433384..>433551)
                     /locus_tag="LILAB_01820"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(435473..436667)
                     /note="potential frameshift: common BLAST hit:
                     gi|108759616|ref|YP_629645.1| recA protein"
     gene            complement(436786..437688)
                     /locus_tag="LILAB_01835"
                     /db_xref="GeneID:10874827"
     CDS             complement(436786..437688)
                     /locus_tag="LILAB_01835"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663372.1"
                     /db_xref="GI:338530038"
                     /db_xref="GeneID:10874827"
                     /translation="MDGEAEAPREDVAPWAPLTDTLAREDAAPWVPSLEDVAPQAPPT
                     AAAAGEAVAPRAPLVAMPGEAVSPRGPPGATSREAPSPSPRSGKPTPPLDLPLPVLVL
                     TEQAQRAPEAERPLIAARLNLQLARMARTGGDRLVADTFLRLLESGRLTGLVDARGRT
                     CRAAAVEALLSLGFPYALEVHPEDLAHLRANAQQRKKRRGKPGTSVAVLVGGLSAQGA
                     HEALFPFRDASLLTSQVGLSLLAMTALWLARPGTPVYRVGLLMLALVSLGGVALALVG
                     AAHTGVWVGLGGLVAALLAALREG"
     gene            437816..438421
                     /locus_tag="LILAB_01840"
                     /db_xref="GeneID:10874828"
     CDS             437816..438421
                     /locus_tag="LILAB_01840"
                     /note="COG1595 DNA-directed RNA polymerase specialized
                     sigma subunit, sigma24 homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-70 factor"
                     /protein_id="YP_004663373.1"
                     /db_xref="GI:338530039"
                     /db_xref="GeneID:10874828"
                     /translation="MDDADSDAQAMLRVAAGDRRAFARLFDRHHASVARFAFRFVGNR
                     ERAEELTQDIFVKLYRNARAYQPTARFKTFLFRVATNHCLNEVRRGEYRTPRASAAAP
                     DGDDRDGWDREGPQGDRPDAALEGRELERAVGEALADMSARERAAFTMCRFEGMAYRD
                     IADALEASESAVKSLIHRATLAVARRIEALQTGTVPARSRA"
     misc_feature    437846..438388
                     /locus_tag="LILAB_01840"
                     /note="RNA polymerase sigma factor RpoE; Provisional;
                     Region: PRK09652"
                     /db_xref="CDD:236608"
     misc_feature    437888..438082
                     /locus_tag="LILAB_01840"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    438206..438352
                     /locus_tag="LILAB_01840"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(438236..438238,438266..438268,438284..438289,
                     438317..438319,438323..438328,438332..438340,
                     438344..438349)
                     /locus_tag="LILAB_01840"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            438418..438894
                     /locus_tag="LILAB_01845"
                     /db_xref="GeneID:10874829"
     CDS             438418..438894
                     /locus_tag="LILAB_01845"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663374.1"
                     /db_xref="GI:338530040"
                     /db_xref="GeneID:10874829"
                     /translation="MSCDYEEDLTAYVDGELPPARGARLRVHLDTCADCRATEALLRT
                     TVARVAALPAFEPSPASRRAVMAELDALPAPWWARLKTWPRPAVLVPAAGLVAVLAVS
                     LLLTRAGPGAPLALEDASVMELAANLELAEDYELLGLDDMDDLEVVANLHELEVTR"
     misc_feature    438427..438528
                     /locus_tag="LILAB_01845"
                     /note="Putative zinc-finger; Region: zf-HC2; pfam13490"
                     /db_xref="CDD:257814"
     misc_feature    438436..438633
                     /locus_tag="LILAB_01845"
                     /note="mycothiol system anti-sigma-R factor; Region:
                     antisig_RsrA; cl15806"
                     /db_xref="CDD:247078"
     misc_feature    438586..>438795
                     /locus_tag="LILAB_01845"
                     /note="Anti-sigma-K factor rskA; Region: RskA; pfam10099"
                     /db_xref="CDD:255753"
     gene            438891..439388
                     /locus_tag="LILAB_01850"
                     /db_xref="GeneID:10874830"
     CDS             438891..439388
                     /locus_tag="LILAB_01850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663375.1"
                     /db_xref="GI:338530041"
                     /db_xref="GeneID:10874830"
                     /translation="MRTGNLAAALVLGVALLTGAPARAQAPTPRTAAERFEQMTPEQK
                     EALRAKLREFKAMPPAEQARIRANLRRWRQLPPEERERIRANLRELERLTPAERQALR
                     ERARDLRQLDPAQRAELRQRMRRYLKENPERREQMLENLRRWRRLSPEQRQEVRERLR
                     ERRRR"
     misc_feature    438987..439259
                     /locus_tag="LILAB_01850"
                     /note="Protein of unknown function (DUF3106); Region:
                     DUF3106; pfam11304"
                     /db_xref="CDD:256404"
     gene            439385..439630
                     /locus_tag="LILAB_01855"
                     /db_xref="GeneID:10874831"
     CDS             439385..439630
                     /locus_tag="LILAB_01855"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663376.1"
                     /db_xref="GI:338530042"
                     /db_xref="GeneID:10874831"
                     /translation="MRGALPAALCLLLGATSAAAQEPPAPPPPGVPAKPPPPGEPPRP
                     RAPPSDEDQEVVEHLELLESLDAAEDLDLLLELSQED"
     gene            complement(439717..441552)
                     /locus_tag="LILAB_01860"
                     /db_xref="GeneID:10874832"
     CDS             complement(439717..441552)
                     /locus_tag="LILAB_01860"
                     /note="COG0449 Glucosamine 6-phosphate synthetase,
                     contains amidotransferase and phosphosugar isomerase
                     domains"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine/fructose-6-phosphate
                     aminotransferase"
                     /protein_id="YP_004663377.1"
                     /db_xref="GI:338530043"
                     /db_xref="GeneID:10874832"
                     /translation="MCGIVGYVGDKESAPILVSGLKRLEYRGYDSAGVAVLNQRKLNV
                     VRATGKLRNLENRVVADQPPGNIGIGHTRWATHGRPSDENAHPHTYKDVAVVHNGIIE
                     NHLALKEQLRSRGHVFSSETDSEVFAHLIAEELERGLELPDAVRAAITQVKGTYALAV
                     LTASDPSRIVCTKDASPMVLGLGQGQNFLASDVPALLEHTRDFVYMEEGDLAVITAAA
                     VDIFNRQGQKVNRPTRRIDWTPMMAEKGGHKHFMHKEIWEQPRAIADTLRGRMLLSEG
                     DVHFEGWNLSAEKVRSLTKVTILACGTSWHSGVAGKHMIESLARLPVEVELASEFRYR
                     DPIVDGTHLAIAISQSGETADTLAAFKEAKARGATAMAICNVIGSAMTREADFSVLTN
                     AGPEIGVASTKAFTTQLVALYLLAVKLGRMRGTLSVPAAQEHLTHLTQVPKMIEDVLK
                     CEPAVTRVSREFMNAQDFLFLGRGPMHPVALEGALKLKEISYIHAEGYAGGEMKHGPI
                     ALIDDKMPVVVIAPKQPHVAYEKIIGNIEEVRARGGKVIAIIDEDDEHVTTLADHVIR
                     IPAACALLAPVVATIPLQLLAYHVADLRGNDVDQPRNLAKSVTVE"
     misc_feature    complement(439720..441552)
                     /locus_tag="LILAB_01860"
                     /note="glucosamine--fructose-6-phosphate aminotransferase;
                     Reviewed; Region: PRK00331"
                     /db_xref="CDD:234729"
     misc_feature    complement(440911..441549)
                     /locus_tag="LILAB_01860"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_GFAT-type. This domain is found at the N-terminus
                     of glucosamine-6P synthase (GlmS, or GFAT in humans).  The
                     glutaminase domain catalyzes amide nitrogen transfer from
                     glutamine to the appropriate substrate. In...; Region:
                     GFAT; cd00714"
                     /db_xref="CDD:238366"
     misc_feature    complement(order(441181..441186,441256..441261,
                     441295..441297,441322..441327,441331..441336,
                     441472..441474,441547..441549))
                     /locus_tag="LILAB_01860"
                     /note="glutaminase active site [active]"
                     /db_xref="CDD:238366"
     misc_feature    complement(440293..440670)
                     /locus_tag="LILAB_01860"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(440488..440490,440554..440556,
                     440563..440565,440575..440577,440581..440583,
                     440602..440607,440614..440619,440647..440652))
                     /locus_tag="LILAB_01860"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(440503..440511,440641..440646))
                     /locus_tag="LILAB_01860"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    complement(439726..440196)
                     /locus_tag="LILAB_01860"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(439729..439731,439744..439749,
                     439939..439944,439948..439950,439960..439965,
                     440020..440031,440035..440043,440047..440049,
                     440059..440061,440065..440067,440071..440073,
                     440077..440079,440089..440091,440131..440133))
                     /locus_tag="LILAB_01860"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(440086..440088,440095..440097))
                     /locus_tag="LILAB_01860"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            complement(441660..443060)
                     /locus_tag="LILAB_01865"
                     /db_xref="GeneID:10874833"
     CDS             complement(441660..443060)
                     /locus_tag="LILAB_01865"
                     /note="COG1207 N-acetylglucosamine-1-phosphate
                     uridyltransferase (contains nucleotidyltransferase and
                     I-patch acetyltransferase domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine pyrophosphorylase"
                     /protein_id="YP_004663378.1"
                     /db_xref="GI:338530044"
                     /db_xref="GeneID:10874833"
                     /translation="MSVLAAVVLCAGKGTRMKSEKAKVLHPILGRPLCAYPLKRALEL
                     GATSVVPVVGHQAEAVEKAVRALFPEAPLRFALQREQRGTADAVRSAEEALKGYSGRV
                     LILYGDVPLLRRETLEALLAAHDQAGGKLAMVSTTLEDPTGYGRVLREGGQVTRIVEH
                     KDCTPAQRQVRECNAGIYSVDADFLWKALADIKPQNAQGEYYLTDLVEMAAKLGPVGS
                     VEADATETAGVNDRVELAARARVMQQRINEAHMRAGVSLVDPATAYIEEGVTVGPDTE
                     IGPSVTLAAGTVVGRGCVIGQGSVLQASTVADDTVIKPYSVLEEARVGARNVIGPFSR
                     LRPGTELAEDVHLGNFVETKKARIGKGSKANHLTYLGDAVIGSGCNVGAGTITCNYDG
                     VNKHLTELGDGVFIGSDTQLVAPVKVGDGSYVGAGTTVTKNVPPGSLAVSRTPQVTKE
                     GWVATKKARQAKARAG"
     misc_feature    complement(441684..443051)
                     /locus_tag="LILAB_01865"
                     /note="N-acetylglucosamine-1-phosphate uridyltransferase
                     (contains nucleotidyltransferase and I-patch
                     acetyltransferase domains) [Cell envelope biogenesis,
                     outer membrane]; Region: GlmU; COG1207"
                     /db_xref="CDD:224128"
     misc_feature    complement(442356..443045)
                     /locus_tag="LILAB_01865"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(442737..442739,442743..442745,
                     442800..442802,442809..442811,442905..442907,
                     443028..443036))
                     /locus_tag="LILAB_01865"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(442371..442373,442737..442739))
                     /locus_tag="LILAB_01865"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    complement(441723..442301)
                     /locus_tag="LILAB_01865"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(441732..441734,441783..441788,
                     441837..441842,441846..441848,441876..441878,
                     441891..441899,441912..441923,441954..441956,
                     441963..441965,441999..442001,442005..442007,
                     442053..442055))
                     /locus_tag="LILAB_01865"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(441876..441878,441894..441896,
                     441915..441923,441954..441956,441963..441965,
                     441999..442001,442005..442007,442053..442055))
                     /locus_tag="LILAB_01865"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(441732..441734,441783..441788,
                     441837..441842,441891..441893,441897..441899,
                     441912..441914))
                     /locus_tag="LILAB_01865"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            complement(443072..443278)
                     /locus_tag="LILAB_01870"
                     /db_xref="GeneID:10874834"
     CDS             complement(443072..443278)
                     /locus_tag="LILAB_01870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663379.1"
                     /db_xref="GI:338530045"
                     /db_xref="GeneID:10874834"
                     /translation="MSTPAIPENKALPGAAPTAAEVTVFLKPSFGITVQRNTLCVSVS
                     AKARPVDTPPPSDPRAVDDSIPCP"
     gene            443529..445301
                     /locus_tag="LILAB_01875"
                     /db_xref="GeneID:10874835"
     CDS             443529..445301
                     /locus_tag="LILAB_01875"
                     /note="COG0405 Gamma-glutamyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="YP_004663380.1"
                     /db_xref="GI:338530046"
                     /db_xref="GeneID:10874835"
                     /translation="MKEMSFRGAVLKRGLLTAVMLVACVAQAARPYRGGAVATAYPQA
                     SAAALEMLEKGGNATDAAVAAAFVAAVVGPYHSGIGGGGFALVHDAKRGDTKVLDFRE
                     VAPKAATRDMYVKDGKVVPGLSTDGALSVAVPGAVAGYLELLKAHGKLKPAVVLAPAI
                     AAAKRGMWVTPRYRTMAEGRLACLRRDAEASRVFLVKDAQGQWEAPPVGHLIRQPDLA
                     RTLTAISKQGAKAFYAGPVAKAIATSVQAGGGILTQEDLAAYKTRGATPLAGSYRGHR
                     VLTMPPPSAGGVAVIQVLTALEQLRPQGLAFRDAEALHLYVEAVRRAYVDRAKHLGDP
                     AFVDVPLARLVSAGHVADLAGSIDPKKATPSASLLAPKEGVRGSTLTDEPTTLTPEPE
                     KKNTTHISVIDKDGNAVAMTTTVNYGFGSCMVAKGTGVLLNDEMDDFAAQPGVPNAYG
                     LVTGEPNAIAPGKVPLSSMSPTLVFSKEDPKRVMLAVGSPGGSTIPTTVIQVISNVVD
                     HGMDVARAVNEGRVHHQYLPDEVWVDRWGLEPATLSALEAKGHKIRRVEQWGDAEAVY
                     SDPKTGLRFSASDPRNEGAALGQD"
     misc_feature    443625..445292
                     /locus_tag="LILAB_01875"
                     /note="Gamma-glutamyltransferase [Amino acid transport and
                     metabolism]; Region: Ggt; COG0405"
                     /db_xref="CDD:223482"
     gene            445305..446087
                     /locus_tag="LILAB_01880"
                     /db_xref="GeneID:10874836"
     CDS             445305..446087
                     /locus_tag="LILAB_01880"
                     /note="COG1099 Predicted metal-dependent hydrolases with
                     the TIM-barrel fold"
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="YP_004663381.1"
                     /db_xref="GI:338530047"
                     /db_xref="GeneID:10874836"
                     /translation="MPTPPPIFDAHLHPEGLSDQDLESMRFFGVERALVVAHHFPEPT
                     SKALLRHFDDLVERQLPRLERLGIRAYAALGVHPRCIPRRGLSEVLSALPGYFQGGRV
                     VALGETGLHAGGEEEEEAFLEQLALARGLKLRVVVHTPTADKERHTRRILTLLRQSGL
                     LPSRALVDHANARTVRTILEVGHWAGLTLHPEALKAERAVALVRRLGSERLMLDSDAG
                     DGAGDILGLARAANLLAKASLSERIVRRITHENAARFFQVSG"
     misc_feature    445326..446081
                     /locus_tag="LILAB_01880"
                     /note="Predicted metal-dependent hydrolases with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1099"
                     /db_xref="CDD:224024"
     misc_feature    445326..446075
                     /locus_tag="LILAB_01880"
                     /note="TatD related DNase; Region: TatD_DNase; pfam01026"
                     /db_xref="CDD:250303"
     misc_feature    order(445335..445337,445341..445343,445716..445718,
                     445809..445811,445950..445952)
                     /locus_tag="LILAB_01880"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            446264..448315
                     /locus_tag="LILAB_01885"
                     /db_xref="GeneID:10874837"
     CDS             446264..448315
                     /locus_tag="LILAB_01885"
                     /note="COG0339 Zn-dependent oligopeptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="M3 family peptidase"
                     /protein_id="YP_004663382.1"
                     /db_xref="GI:338530048"
                     /db_xref="GeneID:10874837"
                     /translation="MHRLVVFVVSLALAGCTGPSSAQRLASSGEPLAAPRPPEPDAGR
                     QLTFTPERFLAACLRDVRQAEARIQAMLALPTPRDVDAALTAYDDAMALLDDAHGRGN
                     LGANTHPDAAFRAAAERCAQATDGKRTDVSLNPRVYAALAALELSGQDAATRRWVDLV
                     LRGFRRAGVNRDAATRARLRELNDTLTRLGQAFSQHIREDVRYVDVAPDALEGLPDDY
                     IRDHPPGPDGRVRITTDPSDTLPFLTYARDGRAREALWRAGQQRGHPRNLETLSRLLQ
                     ARHDLATLLGYPSWAAYASEDKMVRHQHVAEAFIEQLATATATRVKDDYAALLARKRR
                     EVPGAARVEPWEQTYLKEQVRAERHQLDSRELRPFFEYTRVKQGVLDITSRLFGLTYR
                     RVTDAPAWHPDIETWDIYEGPTRLGRFYLDMHPRPDKYAHPAQWDLATGRAGRTLPEG
                     VLTANFPRPGAHPALLQHAQVQTFFHEFGHLLHHVLGGRARWASLSGSRTERDFVEAP
                     AQVLEEWAWRPESLRTFARHVDTGEPLPTDTILRMRRAEAFGKGLWLRQQLFYAAVSL
                     QLHASDPAGVDTTARVYALQERYMPFPALDDTYAHLSFVQLDGYYSSAYYAYLWSLVI
                     ARDLLTPFLEHGLMDPATAQRFRDTVLGPGGSRDAADLVRSFLGRDYGFEAYTRWLDD
                     A"
     misc_feature    446354..448288
                     /locus_tag="LILAB_01885"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    446423..448303
                     /locus_tag="LILAB_01885"
                     /note="Peptidase M3 Thimet oligopeptidase (TOP) also
                     includes neurolysin; Region: M3A_TOP; cd06455"
                     /db_xref="CDD:188994"
     misc_feature    order(447689..447694,447701..447703,447779..447781,
                     448079..448081,448106..448108,448115..448117)
                     /locus_tag="LILAB_01885"
                     /note="active site"
                     /db_xref="CDD:188994"
     misc_feature    order(447689..447691,447701..447703,447779..447781)
                     /locus_tag="LILAB_01885"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188994"
     gene            complement(448427..448705)
                     /locus_tag="LILAB_01890"
                     /db_xref="GeneID:10874838"
     CDS             complement(448427..448705)
                     /locus_tag="LILAB_01890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663383.1"
                     /db_xref="GI:338530049"
                     /db_xref="GeneID:10874838"
                     /translation="MAYDGELVKMENGRWARFQRCQVYRPGVEDAGETMLLIAVELEE
                     RFQRQLDAAADSLAQYRYQGVPVQVRFDADAQGITLQPEQSVSAPAVH"
     misc_feature    complement(<448442..>448627)
                     /locus_tag="LILAB_01890"
                     /note="preprotein translocase subunit SecD; Reviewed;
                     Region: secD; PRK12933"
                     /db_xref="CDD:183831"
     gene            448956..449183
                     /locus_tag="LILAB_01895"
                     /db_xref="GeneID:10874839"
     CDS             448956..449183
                     /locus_tag="LILAB_01895"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663384.1"
                     /db_xref="GI:338530050"
                     /db_xref="GeneID:10874839"
                     /translation="MKLPGLFRKERTTIQAADAQDHAERLLAESLRMLGQVCGKVADA
                     IEAQRLSRQGYPHNTYLRRTDGDEDDSAKKA"
     gene            449199..450146
                     /locus_tag="LILAB_01900"
                     /db_xref="GeneID:10874840"
     CDS             449199..450146
                     /locus_tag="LILAB_01900"
                     /note="COG2159 Predicted metal-dependent hydrolase of the
                     TIM-barrel fold"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein"
                     /protein_id="YP_004663385.1"
                     /db_xref="GI:338530051"
                     /db_xref="GeneID:10874840"
                     /translation="MATDSDADVPVPCLATAPTWRDAGITLPMPGLHDSEGPRLPDSL
                     PPVVDAHVHLFPDRVFEAVWRWFDRYGWPIRYKLHTRQVVSFLLSRGVQRVVALHYAH
                     RPGMARALNAYVAEVAREEPRVLGLATVLPGEPEATAVLEEAFAAGLRGVKIHCHVQC
                     FAPDAPHLHEVYAACAKAGRPLVMHAGREPSSPHYNCDTYALCAAERVERVLKDHPTL
                     KLCVPHLGADEFDAYARLLERHDNLWLDTTMALAGYFPVPLPRRALEVRPERILYGTD
                     FPNLPYAWDRELRTLLGMKLDDAVLAGILGQNALQLYGA"
     misc_feature    449340..450074
                     /locus_tag="LILAB_01900"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cd01292"
                     /db_xref="CDD:238617"
     misc_feature    order(449349..449351,449355..449357,449751..449753,
                     449868..449870,450024..450026)
                     /locus_tag="LILAB_01900"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            450305..450682
                     /locus_tag="LILAB_01905"
                     /db_xref="GeneID:10874841"
     CDS             450305..450682
                     /locus_tag="LILAB_01905"
                     /note="COG0784 FOG: CheY-like receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_004663386.1"
                     /db_xref="GI:338530052"
                     /db_xref="GeneID:10874841"
                     /translation="MSHILVVDDDASHRTLICDALEEMGYPTVQAANGREALDLLEGD
                     MPSAVLLDLRMPVMSGWGLLDALKKMPRARGLPIIIISGYGFEWEAELVGAAGYISKP
                     VDLDKVRMTVQQIAGPPEMSLVH"
     misc_feature    450317..450652
                     /locus_tag="LILAB_01905"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(450326..450331,450458..450460,450482..450484,
                     450548..450550,450596..450598,450605..450610)
                     /locus_tag="LILAB_01905"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    450458..450460
                     /locus_tag="LILAB_01905"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(450467..450472,450476..450484)
                     /locus_tag="LILAB_01905"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    450605..450613
                     /locus_tag="LILAB_01905"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            450773..451594
                     /locus_tag="LILAB_01910"
                     /db_xref="GeneID:10874842"
     CDS             450773..451594
                     /locus_tag="LILAB_01910"
                     /note="COG1131 ABC-type multidrug transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004663387.1"
                     /db_xref="GI:338530053"
                     /db_xref="GeneID:10874842"
                     /translation="MTPSPTDDLAVDARGLQKRFGGFSALNGLDLQIPRGAFYAYLGP
                     NGAGKSTSIALLTGVYGPDAGTIRMLGVDAVARPMEVKRRVGVVPEELSLFERLTGRQ
                     YLTFCARMYGLDGDEAAARAAELLELTELTYKAGALVAEYSKGMRRRLAIAAALIHAP
                     ELVLLDEPFEGIDVLAAGVIRELLRELSRRGVTLLLTTHVLEIAERLATHAGIIRGGR
                     MLDQGPVGSLLSRYECPSLEAVFEKLISVPASRNARLSFYGEAPASVTPLRRETA"
     misc_feature    450803..451495
                     /locus_tag="LILAB_01910"
                     /note="ABC-type Na+ transport system, ATPase component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatA; COG4555"
                     /db_xref="CDD:226927"
     misc_feature    450803..451429
                     /locus_tag="LILAB_01910"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    450899..450922
                     /locus_tag="LILAB_01910"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(450908..450913,450917..450925,451040..451042,
                     451268..451273,451367..451369)
                     /locus_tag="LILAB_01910"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    451031..451042
                     /locus_tag="LILAB_01910"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    451196..451225
                     /locus_tag="LILAB_01910"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    451256..451273
                     /locus_tag="LILAB_01910"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    451280..451291
                     /locus_tag="LILAB_01910"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    451355..451375
                     /locus_tag="LILAB_01910"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            451591..453246
                     /locus_tag="LILAB_01915"
                     /db_xref="GeneID:10874843"
     CDS             451591..453246
                     /locus_tag="LILAB_01915"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663388.1"
                     /db_xref="GI:338530054"
                     /db_xref="GeneID:10874843"
                     /translation="MSRPAVPGFFRHLWLLWGLRFDIGLNQGPGRSRLLAVAAFAASS
                     APGALLGLTFFALMRLKPIAQSEVWPFFILNLLCFVTFSVWVTWPLLSAGVDDHSELS
                     RYAAFPISPFRLLIASTVASLFEPRALVFYAPLTGAALGFASVYVLYMPWLAVVLYVL
                     FALLCAAWSRVALYAVINVLREKHSAEIMGGGLALFLLGASFIPPIDTSWLTAVGEAG
                     VDALDMSLIINAAVALGRVPPGLFGDALAQLAWHRPRVAMAEAAALLFFTAVGMAVAY
                     ALLMRFHRQAGRAGGSRKDSGDSNPFATTKTRYTTLVTREALDLWRNPRARLLASVPF
                     ILAILLKLLSGRDLFVFVLGASADAWLMGGLCIYGAVVIASTFSQNTFAYDGQGFAAF
                     LAAPLDLADVLRAKNQVQGAAALAMAALVALFYRVYFGFGTALDMLCAMAAVATVVPM
                     LLAAGNFLSLYFPVKFHASLKRRDKVPLTASMLGILAASAGCMPFGWALKLAGKDGPT
                     WHTAAMILLAAALNVALYRGVLPLALRLLERRREVVLQAVTRE"
     gene            complement(453386..454645)
                     /locus_tag="LILAB_01920"
                     /db_xref="GeneID:10874844"
     CDS             complement(453386..454645)
                     /locus_tag="LILAB_01920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663389.1"
                     /db_xref="GI:338530055"
                     /db_xref="GeneID:10874844"
                     /translation="MDRKFLSRAALSAAVVTALSAALALATESPIFKPVEKPASAKAA
                     TPAAQAQPAASQKPAPAPPSQQQKPVTARPEIEVVFVLDTTGSMSGLLEGAKQKIYSI
                     ASRIAQGRPTPRLKVGLVAYRDVGDEYVTKRFDLSDDLDTVFANLRKFEAGGGGDTPE
                     HVGRGLGEAVSKLSWSQNREVMKAIFLVGDAPPARRNDDWDFNFWAKKAREKHIVVNT
                     VRCGGDAKTAVAWRAVAKLTDGTFDSIDQSGGMVAVATPYDEALAKVNAELSTKTLYT
                     GRREVQAENKARAASMARLAPEAAAERISYMKKTRGAGAGGAPASSAPKAVGGAVDLV
                     EAPSALAGVSQDELPAELKGLSAEAQAAKVKTLSEEKKALEKKAETLAAEREAWLTKN
                     APAKEDAFDANVMKGVKAQAAKHGIAY"
     misc_feature    complement(453926..454420)
                     /locus_tag="LILAB_01920"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(454076..454078,454172..454174,
                     454397..454399))
                     /locus_tag="LILAB_01920"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            454808..455707
                     /locus_tag="LILAB_01925"
                     /db_xref="GeneID:10874845"
     CDS             454808..455707
                     /locus_tag="LILAB_01925"
                     /note="COG0123 Deacetylases, including yeast histone
                     deacetylase and acetoin utilization protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase family protein"
                     /protein_id="YP_004663390.1"
                     /db_xref="GI:338530056"
                     /db_xref="GeneID:10874845"
                     /translation="MRVFHSDSYEVPLPPGHRFPMEKYRLLREALLARGVLPPESLTE
                     STPSPREDLARVHTPRYLDALFQGTLTEAEQRRLGFPWSPELVRRFAAAVAGTVDAAR
                     AALQDGIGGNLSGGTHHGFPDHGEGFCVFNDIAVAIRALQASRDIRRAVVVDLDVHQG
                     NGTAAVFAGDDSVFTFSMHGENNFPFRKQPSQLDVGLPDGTGDAAYLDALALYLPEVL
                     DRAGACILFYQAGVDPLTEDALGRLSLTHAGLRARDRLVLEAARQRGLPAVLTLGGGY
                     AKPLSATIDAHAGTYEVARALFR"
     misc_feature    454856..455680
                     /locus_tag="LILAB_01925"
                     /note="Histone deacetylase class IV also known as histone
                     deacetylase 11; Region: HDAC_classIV; cd09993"
                     /db_xref="CDD:212519"
     misc_feature    order(454874..454876,455153..455164,455186..455194,
                     455273..455275,455279..455281,455492..455494,
                     455504..455506,455624..455629,455633..455635)
                     /locus_tag="LILAB_01925"
                     /note="putative active site [active]"
                     /db_xref="CDD:212519"
     misc_feature    order(455273..455275,455279..455281,455504..455506)
                     /locus_tag="LILAB_01925"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212519"
     gene            455783..456499
                     /locus_tag="LILAB_01930"
                     /db_xref="GeneID:10874846"
     CDS             455783..456499
                     /locus_tag="LILAB_01930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663391.1"
                     /db_xref="GI:338530057"
                     /db_xref="GeneID:10874846"
                     /translation="MTPSLRRPLLGGLFLACCALALSCGNDGPFFRLAFSLPDTLTAA
                     PGESFPVEFTVLREGDDQSAFRVDLQSAPEGVTLTPEFVLPENEASVTATATFAVAQD
                     TQFRGMTRALLTATNAAETFATSANLFLVILQPPVAQPDFSIAVEPRQVDLFAGQNEK
                     VRITVTRAEGFTGPVTLSLETPTRRIGMQEVTIPAGETFVEPYINTDRGMTRVPVAAS
                     LIATSEDGRQASTGISVNVR"
     gene            456671..457048
                     /locus_tag="LILAB_01935"
                     /db_xref="GeneID:10874847"
     CDS             456671..457048
                     /locus_tag="LILAB_01935"
                     /note="COG0216 Protein chain release factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase domain-containing
                     protein"
                     /protein_id="YP_004663392.1"
                     /db_xref="GI:338530058"
                     /db_xref="GeneID:10874847"
                     /translation="MSISPTRRQAALDALALDDEALLKACEVDYFIASGPGGQHRNTT
                     ASGVRLTHAPTELSVSATERRSQVQNKGVALERLREGLKALTFVPKVRRATKPTAGAK
                     RRRLEGKKRTSEKKALRSSKSGW"
     misc_feature    456746..457003
                     /locus_tag="LILAB_01935"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            457289..457699
                     /locus_tag="LILAB_01940"
                     /db_xref="GeneID:10874848"
     CDS             457289..457699
                     /locus_tag="LILAB_01940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663393.1"
                     /db_xref="GI:338530059"
                     /db_xref="GeneID:10874848"
                     /translation="MPLLTAFPSPSPSSRSRARRWRLWAPLALTLATPAAWAQDTDAA
                     PAPGAAPELDYATEAKSAEPSGLVVRVAPLEQTQFIVENAERVRVQAPAVVEVSLGEP
                     NQLAVQGLSPGVSEVLVWRQGIKRPLSVRLEVAK"
     misc_feature    457490..457693
                     /locus_tag="LILAB_01940"
                     /note="Pilus formation protein N terminal region; Region:
                     T2SS-T3SS_pil_N; pfam13629"
                     /db_xref="CDD:257939"
     gene            457696..458400
                     /locus_tag="LILAB_01945"
                     /db_xref="GeneID:10874849"
     CDS             457696..458400
                     /locus_tag="LILAB_01945"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="YP_004663394.1"
                     /db_xref="GI:338530060"
                     /db_xref="GeneID:10874849"
                     /translation="MSRRDARGATLLEVSIVLAIIAVLAALAYAGYAQLSARTSPQNA
                     AADLSGALAEARARAVDRQADVWLIVYPDLDPAGQAGGHGAWFLVEDRLRNFGDAAAP
                     AGQLTFSTFSPPLDIHPTADQGRLMDSMYMDRYTQRTVRFGATGNLAWTGIFEGLPVS
                     DCSFCSGAPRRGAIVFRGDGSARFVDGAGQPVIPAGNGALNRAASLALTSTDGQREYL
                     FAISAPVGFVDTRTNR"
     gene            458433..458951
                     /locus_tag="LILAB_01950"
                     /db_xref="GeneID:10874850"
     CDS             458433..458951
                     /locus_tag="LILAB_01950"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="YP_004663395.1"
                     /db_xref="GI:338530061"
                     /db_xref="GeneID:10874850"
                     /translation="MRGATLIEGMAAAAILAMGISGVFGGLIFASQQNAAANRLSQAS
                     AIAAQVRSGLQLQGRARLFAGTGPLSAARCAGAAETLELAGGLSTLPDACVVDLDAFD
                     SATGDPLLKVVPGYSTEESEDYRRVLVWTPAQAIDSVAVVVSFRSAGQRRYVKQFVAL
                     YNPAENGAGVEL"
     gene            458948..460135
                     /locus_tag="LILAB_01955"
                     /db_xref="GeneID:10874851"
     CDS             458948..460135
                     /locus_tag="LILAB_01955"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilW"
                     /protein_id="YP_004663396.1"
                     /db_xref="GI:338530062"
                     /db_xref="GeneID:10874851"
                     /translation="MSTPRTPARRGFTLIELLVGITVSSVVLLAVAATIIAVNDIFQK
                     NTVSKTAVEGSRVGMDYLNRTLRYAGYGLDPAIAFDFGTDGLPEDRKDNYTEEVEDWG
                     SFVTDDLAFRYRDPMYLRRGQLDGTGAPPFQLTLEPAANFGQPLRQGQAVLVACPGGQ
                     DYFLGRLAADVTADGTTASLETALAAGIPGDVPKGCMTDSTRMPFVMLVQEKRLRVEA
                     HGGRPYLVVKHGWAEDADFDPIAADVESFQVSYQMNRPPANSACCAGQAAPDGAVGSG
                     MAWVLGDEDAVMLPKYDADVPPPTYSTPYDDALRYNMNTANIRSVGVGLTVRSVRPMP
                     SGKKNQARRLFNAEPVNGEDTFFRTTVETSVRIPNMTSRAFFIPELRAAGVAGDLKNV
                     WGG"
     misc_feature    458972..459043
                     /locus_tag="LILAB_01955"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     gene            460141..460638
                     /locus_tag="LILAB_01960"
                     /db_xref="GeneID:10874852"
     CDS             460141..460638
                     /locus_tag="LILAB_01960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663397.1"
                     /db_xref="GI:338530063"
                     /db_xref="GeneID:10874852"
                     /translation="MTHFASRRGSALAITLIALTVLLLLVVGAITFTGRNQSAAVSKT
                     RSDRVEACAETARRYLLSRLKVFGTGAVPVTSISLEQVLQDDQVVADSSTMRTAHMGD
                     TESAPTAAVLATSSFSSGKDQVSDAANTLREGTAGGSYYRVVVMCDEPGGRQAETEFV
                     FRFGI"
     gene            460671..465155
                     /locus_tag="LILAB_01965"
                     /db_xref="GeneID:10874853"
     CDS             460671..465155
                     /locus_tag="LILAB_01965"
                     /note="COG3419 Tfp pilus assembly protein, tip-associated
                     adhesin PilY1"
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein tip-associated
                     adhesin PilY1-like protein"
                     /protein_id="YP_004663398.1"
                     /db_xref="GI:338530064"
                     /db_xref="GeneID:10874853"
                     /translation="MKALLSSLTALAALLMAPAALAQDPASCSLQSTSRLDALLNPAR
                     GSDERFFTSPSGPPNILLILDTSGSMAYWPIAWSNNDYYSYIDNRNGASPGCRQENID
                     ALNYDASVEYPRMWLSLTNQDSPWFVPTSYYRFDGNGSGTQESFGMGNNPVRFDQPPP
                     NTTISDSAATACANIVDTGNNSTRAAARAACAQCLTTKGYFQYRKNERIASGNFLNFY
                     SPRGHSAVNVISQVLKDSERTRFGVVTFSASRDATGTVKWSGQDVVRFEQFGPRCDQS
                     LNQTERNNHRNNLLVKMNRGLQFNTGTPLTQVMWGASTYFRSSEDDPFPGWFGSGYMR
                     DSDFDDEAEPGRAATCFTCGFNAMILLTDGEPNEPGNHDDQIPSQVRDLDVPCSNCTA
                     ANQGGYSGGTASHIHRIAKWMWTHDMRPELDGSQQVATYTVGFALTNTRALNLLRTTA
                     DAGGGRFYAATNSSQLKTALQSIVDDVQNRNIAFAAAAISSFQTGSSTLSALMPRMSP
                     ASGDSAWRGDLWRFNQFNEFVEGVDKNADGDMDDIFVVDRDGDIVVEDTSGNFVKDGG
                     STPANQFWEARRALLARSLDSRKIYTVTDSNQDGRLTAADNAATPIEFTVANRETLKS
                     YFGILGTPVCPTVESVSPLEIDPGKLLTGLGLTPQQAAAAMSVTVPTFSGMTQAQNWV
                     NDICVRTLIQYVRGQDLADEDGNGNRTEVRRSVLGDIFHSAPVLVDPPMDKFLCNLGM
                     SNQCTRTLYSQQLGVSPTPLATEDINRCGDTVEVDAYDAYLHRYRRRDKLVLVGANDG
                     MLHAFRDSTAGSDNCEGGMPMIEYTPSTGEEEWAFIPPDLLSRLHEMANGHQYYVDGD
                     IMVRDVWADGSDGSQPDGIKQSTEYHTMAVISEGRGGVHYLALELRADAGTGRFGAPR
                     MQWMYPQPDSAEAALFGKTLFSLSPKPPPIGPVLVEAGTAPGGVSRYEVNTQERWVVA
                     LSGGWSPGQEKGRGIYVVDAWSPEVNGRTDNLWWKFEFDPNATSEQHGPARHLTHSVA
                     APVALVDYGVAGSVQQDGFFDTAVFGDMRGQLWVARMSVPGALDPSTGLIRNWSAARA
                     FQMDRDSVGPNGVQGNSLTRTWPFYYVPSIGIQPGTGAMRALVGTGDRYALLDDQAGI
                     CRFDNPQACARYGCGNVEVDYQVDRIGENITEARHQWTQRGLAQTTLTRGTVSQPACG
                     EPGQTVVSARFSRYEARTCPGAPQDYTSMSPARVECGKDAAGNFRCHDVSNVAPNFAD
                     LELTRTTNAIGKNRFYGVRVYGVSGQTFAEDATAVSADGPMTASQFDAARLSDRTSDN
                     DTSGDLVNVTDITCDASGACSDTGAAPESPGWMLEYSDDITHKTAGGAATVASCTLWN
                     VIYPSQDGEVCSSTAARARFYQADFLSGLPNCAASFDNARFQERSVLSPPPEPATAVM
                     ISPTGSVKYSAVMQEPGQRQATSVDVSENSEVLQNVYELPLTQEQHACRHEDAARCLP
                     "
     misc_feature    463047..>463373
                     /locus_tag="LILAB_01965"
                     /note="Neisseria PilC beta-propeller domain; Region:
                     Neisseria_PilC; pfam05567"
                     /db_xref="CDD:253258"
     gene            465224..465646
                     /locus_tag="LILAB_01970"
                     /db_xref="GeneID:10874854"
     CDS             465224..465646
                     /locus_tag="LILAB_01970"
                     /note="COG0317 Guanosine polyphosphate
                     pyrophosphohydrolases/synthetases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663399.1"
                     /db_xref="GI:338530065"
                     /db_xref="GeneID:10874854"
                     /translation="MPALEDAIALAVAAHHGQRDKAGQTYILHPLRVMMRLDTDEERT
                     VAILHDVVEDTPYTLERLRELGYPEGVLAALDALTRRQGESYEAFIERLRPLPLARRV
                     KLADLEDNMDVRRLAAVTPKDAERLARYRAAWARLREP"
     misc_feature    465242..465637
                     /locus_tag="LILAB_01970"
                     /note="HD domain; Region: HD_4; pfam13328"
                     /db_xref="CDD:257658"
     gene            complement(465743..468457)
                     /locus_tag="LILAB_01975"
                     /db_xref="GeneID:10874855"
     CDS             complement(465743..468457)
                     /locus_tag="LILAB_01975"
                     /note="COG1048 Aconitase A"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="YP_004663400.1"
                     /db_xref="GI:338530066"
                     /db_xref="GeneID:10874855"
                     /translation="MTDSFGTKSQLKVGSATYDLFSLGKLAKSHPAVNRLPFSLKVLL
                     ENLLRHEDGRVVKREHVEKMLAWDPKATPDVEISFHPARVLLQDFTGVPAVVDLAAMR
                     EALASMGGNPDKINPRNPADLVIDHSVQIDSFATSAAFKENAELEFERNRERYAFLRW
                     GQSAFKGFGVVPPDIGICHQVNLEFLAHVTFRQGSTVYPDTLVGTDSHTTMINGLGVV
                     GWGVGGIEAEAALLGQPITMLIPQVVGFKLNGKLPAGATATDLVLTVTQMLRKKGVVG
                     KFVEFYGSGLKNLSLPDRATIANMAPEYGATIGFFPVDEESLNYLRFTGRPDDLVALT
                     EAYAKEQGLWRRDDAEDPVFSDTLELDLSTVVPSLAGPKRPQDRVPLKDMKAGYEKSL
                     VEMLSAGKGKGGEEGGKAAAVPPERLAQTVTVKNGRQSYQMGHGAVVIASITSCTNTS
                     NPAVLVGAGILAKKAVERGLNPKPWVKTSLAPGSRVVSEYLRDAGLLPYLEAVGFHIV
                     GYGCTTCIGNSGPLTEPVANAVTEGDLVVAAVLSGNRNFEGRINPHVRMNYLASPPLV
                     VAYALAGEVGTDLDNEPLGTDPNGRPVFLRDIWPTNEEIQEVIRTSVKPEQFRSQYAN
                     AMEGDALWQQLPVGKGATFKWDETSTYVRKPPFFENLPAEPKATQDIKGAHVMALLGD
                     SVTTDHISPAGNIAKTSPAAKYLMANGVEPKDFNSYGARRGNHEVMVRGTFANIRLKN
                     LLVPGVEGGVTVHIPTRERMSIYDASMKYQAEGTPLVVLAGAEYGTGSSRDWAAKGTM
                     LLGVKAVIAKSFERIHRSNLVGMGVLPLQFEAGQDAQSLGLTGHETFDITGVAQDLAP
                     QKKLTVKATGEGGTKEFTVVCRIDTPNELDYYRHGGILQYVLRQLAKG"
     misc_feature    complement(465746..468457)
                     /locus_tag="LILAB_01975"
                     /note="aconitate hydratase; Validated; Region: PRK09277"
                     /db_xref="CDD:236445"
     misc_feature    complement(466733..468211)
                     /locus_tag="LILAB_01975"
                     /note="Aconitase A catalytic domain; Region: AcnA_IRP;
                     cd01586"
                     /db_xref="CDD:153136"
     misc_feature    complement(order(466808..466810,466823..466825,
                     466910..466912,467837..467842,468188..468190,
                     468197..468199))
                     /locus_tag="LILAB_01975"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153136"
     misc_feature    complement(order(466826..466828,466910..466915,
                     466922..466924,467120..467122,467834..467836))
                     /locus_tag="LILAB_01975"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153136"
     misc_feature    complement(465911..466423)
                     /locus_tag="LILAB_01975"
                     /note="Aconitase A swivel domain. This is the major form
                     of the TCA cycle enzyme aconitate hydratase, also known as
                     aconitase and citrate hydro-lyase. It includes bacterial
                     and archaeal aconitase A, and the eukaryotic cytosolic
                     form of aconitase. This group...; Region: AcnA_IRP_Swivel;
                     cd01580"
                     /db_xref="CDD:238812"
     misc_feature    complement(466088..466096)
                     /locus_tag="LILAB_01975"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238812"
     gene            complement(468625..469875)
                     /locus_tag="LILAB_01980"
                     /db_xref="GeneID:10874856"
     CDS             complement(468625..469875)
                     /locus_tag="LILAB_01980"
                     /note="COG1502
                     Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
                     n synthases and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase family protein"
                     /protein_id="YP_004663401.1"
                     /db_xref="GI:338530067"
                     /db_xref="GeneID:10874856"
                     /translation="MGEPEALTEQSGEADTGAPTPPGPVPEHGPVWSPNVSGLLLSRY
                     YLPRRHPVMQGNACQLLRDGVEAYPAMLEAIRGARRYVRLETYMFVSDAVGELFGEAL
                     AQAAERGVHVKVLYDAVGSWTSRRSFFAGLRARGVDIRAFKPFSLSRGLRHLLRRDHR
                     KILVVDGEVAFTGGVNISAHWAPAGVGAAWRDDVLRIEGPAVHELERCFSATWRMMFQ
                     GRFHRLTRRLERLRRQPSRQGGVGLAVLSSRRSIHRAYLHAIRRARRSVLVAAAYFIP
                     DRRMVMALREAARRGVEVHLLLNARSDHPLLEFMARGFYERLLGAGVRIFEWQRGVLH
                     AKTAVVDGVWGTIGSFNLERLSLAFNHEVNAVFADPRLGQQLEDSFRGDCGDCREVTL
                     AEFRRRPLWQKLLERALLLLRKII"
     misc_feature    complement(469234..469689)
                     /locus_tag="LILAB_01980"
                     /note="Catalytic domain, repeat 1, of bacterial
                     cardiolipin synthase and similar proteins; Region:
                     PLDc_CLS_1; cd09110"
                     /db_xref="CDD:197209"
     misc_feature    complement(469237..469665)
                     /locus_tag="LILAB_01980"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(order(469300..469302,469348..469350,
                     469354..469356,469393..469395,469399..469401))
                     /locus_tag="LILAB_01980"
                     /note="putative active site [active]"
                     /db_xref="CDD:197209"
     misc_feature    complement(469399..469401)
                     /locus_tag="LILAB_01980"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197209"
     misc_feature    complement(468667..469131)
                     /locus_tag="LILAB_01980"
                     /note="Catalytic domain, repeat 2, of Escherichia coli
                     cardiolipin synthase ybhO and similar proteins; Region:
                     PLDc_ybhO_like_2; cd09159"
                     /db_xref="CDD:197256"
     misc_feature    complement(468736..469110)
                     /locus_tag="LILAB_01980"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(order(468790..468792,468823..468825,
                     468829..468831,468868..468870,468874..468876))
                     /locus_tag="LILAB_01980"
                     /note="putative active site [active]"
                     /db_xref="CDD:197256"
     misc_feature    complement(468874..468876)
                     /locus_tag="LILAB_01980"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197256"
     gene            complement(470014..471582)
                     /locus_tag="LILAB_01985"
                     /db_xref="GeneID:10874857"
     CDS             complement(470014..471582)
                     /locus_tag="LILAB_01985"
                     /note="COG1716 FOG: FHA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="YP_004663402.1"
                     /db_xref="GI:338530068"
                     /db_xref="GeneID:10874857"
                     /translation="MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRR
                     HCRIFLDGDAYSVEDQGSANGSLVNGSPVKTQVLEDGDKLTLGPVTFIFAMLTDEPAT
                     GEEELPAGAQEGDGSTRIVSLDSLKRQRNKGVALAPEGADQDELDEIREGATRNNLQA
                     LRPVSQGQSGSRPAAIERSAPAAVPARRPASAPPPARARPAPSAGGGGLSAAERARIR
                     RESPGIVSSAKLFWADASQGVRTGIIGGGVALVLGLFGVLYWLVLSGEDGQPVGEEPA
                     WLSGQPIRDGFGLGPGATWERADMKVFEWEYTAATRAVVILHYQAQGISKDEVVVSVN
                     GVDVGKVPPDTLASQDRSIELMIPAQHLKKGEPNRIIFDNVKNPPGEDPWVIWNIWVE
                     RALLPDLLPEELVREATEYHKRGLKHFQTPDIGARNRYEAWKSFRVSWLMLEAHPEPK
                     PDLYYDAQERMKAAQQELDRTCSKLLLEVEGYYNQGNYKSASATLDHVKEYFPEYDQP
                     CATRAEAKRAEYGL"
     misc_feature    complement(471304..471576)
                     /locus_tag="LILAB_01985"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    complement(471256..>471558)
                     /locus_tag="LILAB_01985"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    complement(order(471388..471396,471454..471459,
                     471463..471465,471499..471501))
                     /locus_tag="LILAB_01985"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            complement(471567..472631)
                     /locus_tag="LILAB_01990"
                     /db_xref="GeneID:10874858"
     CDS             complement(471567..472631)
                     /locus_tag="LILAB_01990"
                     /note="COG1716 FOG: FHA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="YP_004663403.1"
                     /db_xref="GI:338530069"
                     /db_xref="GeneID:10874858"
                     /translation="MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRR
                     HCRIFLDGDAYSVEDQGSANGSLVNGSPVKTQVLEDGDKLTLGPVTFIFAMLTDEPAT
                     GEEELPAGAQEGDGSTRIVSLDSLKRQRNKGVALAPEGADQDELDEIREGATRNNLQA
                     LRPVSQGQSGSRPAAIERSAPAAVPARRPASAPPPARARPAPSAGGGGLSAAERARIR
                     RESPGIVSSAKLFWADASQGVRTGIIGGGVALVLGLFGVLYWLVLSGEDGQPVGEEPA
                     WLSGQPIRDGFGLGPGATWERADMKVFEWEYTAATRAVVILHYQAQGISKDEVVVSVN
                     GVDVGKVPPDTLANPPCLSS"
     misc_feature    complement(472353..472625)
                     /locus_tag="LILAB_01990"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    complement(472305..>472607)
                     /locus_tag="LILAB_01990"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    complement(order(472437..472445,472503..472508,
                     472512..472514,472548..472550))
                     /locus_tag="LILAB_01990"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            complement(472638..473567)
                     /locus_tag="LILAB_01995"
                     /db_xref="GeneID:10874859"
     CDS             complement(472638..473567)
                     /locus_tag="LILAB_01995"
                     /note="COG2378 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663404.1"
                     /db_xref="GI:338530070"
                     /db_xref="GeneID:10874859"
                     /translation="MSNVHERLRRLLFLVPYVSKHPGVTVDALARALNVSREDLLEEL
                     DLLTCVGRPPFNPDDYIDIYVDNDRVYVDLDQRLFAPPRLTPGEAAALAASAELLRPA
                     TGDALQSALQKLERVLPPATRERYREMYRKIDASTEAPQALGPLTRAIIERLEVTFGY
                     ASPGRSPEPRTVRPYELLSHRGQWYLQGYCHTRQDARLFRLDRMEDITVTDVPFQPPA
                     DARADVPNPARGLTDASVRVRFSPVAAPYVKERFGRDARPLADGGVEVLVAGDSERWL
                     TQWVLSFGGEAQVMEPASARAAVARAARASVGL"
     misc_feature    complement(472692..473555)
                     /locus_tag="LILAB_01995"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(472692..473147)
                     /locus_tag="LILAB_01995"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(473564..474586)
                     /locus_tag="LILAB_02000"
                     /db_xref="GeneID:10874860"
     CDS             complement(473564..474586)
                     /locus_tag="LILAB_02000"
                     /note="COG2378 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663405.1"
                     /db_xref="GI:338530071"
                     /db_xref="GeneID:10874860"
                     /translation="MDRTERILDLVALLLDAREPISWAELREHFPADYGGSDDAAERK
                     FERDKAELVELGFPLTYVQGDDERRDGYIVDRDAYYLPEADLSKEELAVLYAAGSAAL
                     ASGAFPGRDDLAHALRKIGFFAGQSLPTPRVRMELGSVHEGQEKEVSARLEQLWDACA
                     ARKWVDVTYASPKQAGTTQRRVDPYGLALRRGAWTLVGYCHLRASLRSFHVHRIRELK
                     VNTARPRTPDFQVPADFSLDSHVAYFPWQHRFHEQVEVVLHLSGTLASRAASLLPGAA
                     LEPAEAGAVRARLPVTFVDGLLRFCLALGPDCRVEGPERAQARLREMASRIVASHEDS
                     QDKVSA"
     misc_feature    complement(473591..474493)
                     /locus_tag="LILAB_02000"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(473603..474133)
                     /locus_tag="LILAB_02000"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            474946..475371
                     /locus_tag="LILAB_02005"
                     /db_xref="GeneID:10874861"
     CDS             474946..475371
                     /locus_tag="LILAB_02005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663406.1"
                     /db_xref="GI:338530072"
                     /db_xref="GeneID:10874861"
                     /translation="MFVGVTSTAAPAPVRAEPLYFAVEVRRDGRLVAQPKLLGETGRT
                     LRAERRRPGAPLPDYRLVLTPRAEGKSFLLQLDLQLPEAKGHSELALLHGQERKLQLG
                     SVPGELEVSLLLMKVDSPEFRALMQLGESSGASSSTSSI"
     gene            complement(475376..476509)
                     /locus_tag="LILAB_02010"
                     /db_xref="GeneID:10874862"
     CDS             complement(475376..476509)
                     /locus_tag="LILAB_02010"
                     /note="COG0263 Glutamate 5-kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="YP_004663407.1"
                     /db_xref="GI:338530073"
                     /db_xref="GeneID:10874862"
                     /translation="MSWISTGRTALRAARRVVVKIGTNALTNATGRFNRHHFDALGQD
                     LLWAAQGRELVVVSSGAIALGVERLGLPSRPRDIPGKQACAAVGQSRLMQAYEEAFAA
                     RGKAVAQVLLTHEDVQERRRYLNVKHTLERLLTAGVVPVINENDTVSVDELKFGDNDT
                     LAGLVAGVVEADALVLLSDVEGLYTGDPRRDADAELLATVLQVTPEVLALATGTTSGV
                     GTGGMSTKVRAAARASESGIHCVITSGAVPGRLRAVLEGEDVGTLFEPTGSRRSARAA
                     WIAHALRARGTLTVDAGAREAIVTGKRSLLPSGVRGVEGDFGRGDPVDLVGVDGAVFA
                     RGLAAYDANELRRIAGRHTADIEAVLGYRYLDEAVHRDDLAVL"
     misc_feature    complement(475379..476488)
                     /locus_tag="LILAB_02010"
                     /note="gamma-glutamyl kinase; Provisional; Region:
                     PRK05429"
                     /db_xref="CDD:235460"
     misc_feature    complement(475718..476464)
                     /locus_tag="LILAB_02010"
                     /note="AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes
                     glutamate-dependent ATP cleavage; G5K transfers the
                     terminal phosphoryl group of ATP to the gamma-carboxyl
                     group of glutamate, in the first and controlling step of
                     proline (and, in mammals, ornithine)...; Region:
                     AAK_G5K_ProB; cd04242"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(475832..475834,475844..475846,
                     475850..475852,475958..475963,475970..475978,
                     476438..476440))
                     /locus_tag="LILAB_02010"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(476066..476071,476075..476077,
                     476105..476107,476114..476116,476132..476137,
                     476177..476179,476183..476185,476252..476254,
                     476264..476266,476354..476356))
                     /locus_tag="LILAB_02010"
                     /note="homotetrameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(476309..476332)
                     /locus_tag="LILAB_02010"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(476039..476041,476072..476074,
                     476327..476329))
                     /locus_tag="LILAB_02010"
                     /note="putative allosteric binding site; other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(475430..475654)
                     /locus_tag="LILAB_02010"
                     /note="PUA domain; Region: PUA; pfam01472"
                     /db_xref="CDD:250644"
     gene            476631..478283
                     /locus_tag="LILAB_02015"
                     /db_xref="GeneID:10874863"
     CDS             476631..478283
                     /locus_tag="LILAB_02015"
                     /note="COG2262 GTPases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTP-binding protein HflX"
                     /protein_id="YP_004663408.1"
                     /db_xref="GI:338530074"
                     /db_xref="GeneID:10874863"
                     /translation="MKEIYGNTLGLKSSEQHRLRNTFRRRVPPHEIVSPELARHLTEL
                     SRETNRQVGVLVNRKGEIEHVIVGNAHKLELPDIGRARAGQVRLRGLRLVHTHLKSEP
                     LTKDDLTDLALLRLDCVAAIGVEHDGLPGVLHYAYLVPENGSGEFWNVESLPSVHVAQ
                     PDLMDTLGALEEEFNRKAASRKVGGREKAILVAVCLDGNRALAESSLAELKELARTAG
                     VEVIDSVLQVKREADPRYLIGRGKLEELNLRSMQSMVDLLIFDKDLTPSQGRHIGEAT
                     SLKVLDRSQLILDIFAQRAQSAEGKLQVELAQLKYRLPRLVQSDDSLSRLMGGIGGRG
                     PGETKLEIDRRRVRERITHLEKRIDAIGRERSVRRAQRNRRELPVISIVGYTNAGKST
                     LLNAITNAEVLAENKLFATLDPTSRRLRFPQEREVIITDTVGFIRDLPKDLVAAFRAT
                     LEELYDASLLLHVVDAADPARDEQVEAVENILDSLDLMEKPRLMVWNKADLLPQDEVE
                     ALLRTRGGVAISAATREGLATLLAKADTTLFAEGATEAIGAV"
     misc_feature    477192..478244
                     /locus_tag="LILAB_02015"
                     /note="GTP-binding protein HflX; Region: GTP_HflX;
                     TIGR03156"
                     /db_xref="CDD:234125"
     misc_feature    477240..477506
                     /locus_tag="LILAB_02015"
                     /note="GTP-binding GTPase N-terminal; Region: GTP-bdg_N;
                     pfam13167"
                     /db_xref="CDD:205348"
     misc_feature    477639..478229
                     /locus_tag="LILAB_02015"
                     /note="HflX GTPase family; Region: HflX; cd01878"
                     /db_xref="CDD:206666"
     misc_feature    477780..477803
                     /locus_tag="LILAB_02015"
                     /note="G1 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    order(477789..477791,477795..477806,478119..478124,
                     478128..478130,478188..478196)
                     /locus_tag="LILAB_02015"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206666"
     misc_feature    477843..477884
                     /locus_tag="LILAB_02015"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206666"
     misc_feature    477873..477875
                     /locus_tag="LILAB_02015"
                     /note="G2 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    477921..477932
                     /locus_tag="LILAB_02015"
                     /note="G3 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    477930..478001
                     /locus_tag="LILAB_02015"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206666"
     misc_feature    478119..478130
                     /locus_tag="LILAB_02015"
                     /note="G4 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    478188..478196
                     /locus_tag="LILAB_02015"
                     /note="G5 box; other site"
                     /db_xref="CDD:206666"
     gene            478331..478756
                     /locus_tag="LILAB_02020"
                     /db_xref="GeneID:10874864"
     CDS             478331..478756
                     /locus_tag="LILAB_02020"
                     /note="COG2390 Transcriptional regulator, contains sigma
                     factor-related N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663409.1"
                     /db_xref="GI:338530075"
                     /db_xref="GeneID:10874864"
                     /translation="MSIPTLTPLLLAQADYAKPVSSLSPKYIELLEQNSHIIYPIVAI
                     LTLVIIAAGVLQAWRTQDLDGLQKNEFKRAIVNELRRNISGMPGDLLAKSVGLDRLKT
                     NRLLEQMQQEGLVVSHTNSQRLTVWRVRGATPDAAPRRY"
     gene            478855..480204
                     /locus_tag="LILAB_02025"
                     /db_xref="GeneID:10874865"
     CDS             478855..480204
                     /locus_tag="LILAB_02025"
                     /note="COG3385 FOG: Transposase and inactivated
                     derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004663410.1"
                     /db_xref="GI:338530076"
                     /db_xref="GeneID:10874865"
                     /translation="MGLAQAVQGAALVAPEQFDRFRQHIDPVWVEEAVVATGFASMRR
                     RRLPADQVVWLVVGMAMMRNESIERVASFLNVALPAGTAPKPVAPSALTQARQRLGDE
                     PMEYLFNTTASAWAHRSARAHPWRKLAVYALDGTTVRVPDSADNWEQFGGNPGNGIRA
                     GSAYPTVRAVALMAARSHLVAAVRFGPYATGEVTLAAELWSQLPENSVAIVDRNFTAV
                     RDLLEIATGAKNRHWLVRAKAHMKPVLLEKLGPNDELVELPVTRHMRASSSKPMPEAV
                     RMRAIRYQRPGFRPGVLLTSLLDPKKYPAEEVVQLYHERWEIELGYDEIKTHLLDRQE
                     TIRSRTPQGVRQEVWGILLAYNLVRVEMERAADEAGVEPTRISFINALSLIRNAWLVW
                     STPPLAPGRIPEHLLDLRRHLGLLLLPERRSERRFPRVVKIKMSNYNKKWVKRPRPN"
     misc_feature    478894..479184
                     /locus_tag="LILAB_02025"
                     /note="Insertion element 4 transposase N-terminal; Region:
                     Nterm_IS4; pfam13006"
                     /db_xref="CDD:257453"
     misc_feature    479227..479925
                     /locus_tag="LILAB_02025"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(480217..481224)
                     /gene="gpsA"
                     /locus_tag="LILAB_02030"
                     /db_xref="GeneID:10874866"
     CDS             complement(480217..481224)
                     /gene="gpsA"
                     /locus_tag="LILAB_02030"
                     /EC_number="1.1.1.94"
                     /note="COG0240 Glycerol-3-phosphate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="YP_004663411.1"
                     /db_xref="GI:338530077"
                     /db_xref="GeneID:10874866"
                     /translation="MRGSVIGSGSFGTALANVLAVNCEEVRLWGREASVVEAINAQHE
                     NPTYLKGIPISERVRATTNLEEALAGSELVVLATPSHATREVVAKAQAYLPRHVPIVT
                     VSKGIENETLLTMTELLEDCLPEEFHPYLAVLSGPSFAKELARRMPTVVTIASHWDKV
                     ALRCQKALQTETFRSYTSTDVVGVQYGGALKNVIAIAAGMADGLGMGHNARAAIITRG
                     LAEITRLAVRKGANPLTLSGLSGMGDLVLTCTGELSRNRHVGMELGKGRKLPDILADM
                     KEVAEGVKTARSARDLELKTGVELPICHQVYLIAHEGKSARSAVVDLMTRQPKSELAG
                     V"
     misc_feature    complement(480247..481224)
                     /gene="gpsA"
                     /locus_tag="LILAB_02030"
                     /note="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase; Validated; Region: gpsA; PRK00094"
                     /db_xref="CDD:234629"
     misc_feature    complement(480757..481212)
                     /gene="gpsA"
                     /locus_tag="LILAB_02030"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     N-terminus; Region: NAD_Gly3P_dh_N; pfam01210"
                     /db_xref="CDD:250446"
     misc_feature    complement(480256..480690)
                     /gene="gpsA"
                     /locus_tag="LILAB_02030"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     C-terminus; Region: NAD_Gly3P_dh_C; pfam07479"
                     /db_xref="CDD:254224"
     gene            complement(481236..481913)
                     /locus_tag="LILAB_02035"
                     /db_xref="GeneID:10874867"
     CDS             complement(481236..481913)
                     /locus_tag="LILAB_02035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663412.1"
                     /db_xref="GI:338530078"
                     /db_xref="GeneID:10874867"
                     /translation="MPVDEAAIPKPPAAPVATRPPPVPNRVSLLGARTVGEGGLAAGL
                     SLGFPTVSARVAVGVLRRLDVLAGVDSAYGLMNELRLGARWMVFDGGPRWSLGVAVEG
                     SHAFFLRPASVEERGARYLSGRRNWNVQPGIVGNLQLRGARAPRLFLDVRYLLTLDTE
                     PIQGVPLGGLPPDVEFSSAFPIRVGAEVPVSEKTSYAVTLGGDIRTRPDEADFMPVIS
                     FGVVTGF"
     gene            482614..483189
                     /locus_tag="LILAB_02040"
                     /db_xref="GeneID:10874868"
     CDS             482614..483189
                     /locus_tag="LILAB_02040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663413.1"
                     /db_xref="GI:338530079"
                     /db_xref="GeneID:10874868"
                     /translation="MFMALALAACRSRPADPPAADAGGAATPIERAAVPDCEVLLSEN
                     DRELMLPGFTMKQERACPTCGPLCSFRSDADPDIAVSIAWDCNARHAQADVHALMAPT
                     LQAGGVEVPALGRAAVRRAPAQGMSQVLAWDDDTPCALVITWLGGETERAVEVARAAL
                     IATTPAVLDAGTANGQAPDAGDADAGPTGAP"
     gene            complement(483213..485222)
                     /locus_tag="LILAB_02045"
                     /db_xref="GeneID:10874869"
     CDS             complement(483213..485222)
                     /locus_tag="LILAB_02045"
                     /note="COG3391 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663414.1"
                     /db_xref="GI:338530080"
                     /db_xref="GeneID:10874869"
                     /translation="MRRTLLATVVVSMLAAPACEDREAQATWTQASGSVALSRDDAFL
                     YVVDSDNGVLAVVDTARREKVGEVKVGLLPERVAVGPDDTVYVSNRGSRSVSVIRRGD
                     WSEAARVAVGVEPVGLSVSPTGDTLYVVNSTSRESSRHGSLMAVDTRSLAVRWELPVG
                     DEPRGIALAQGGKRALITRFRQGDLVSVDLTDADRPRVAREKTDLYARANTRDGAAAS
                     PDGLTPLPPSPDIRFQPRGMSSVAVTPDGERALATVMWAREDPLSPDGTPTPPTGGSL
                     YGGGGPCNTGGVVAPGLVTFDTDTGTPRVDDLDRCRPPPELAPDFPPSTIISPESTHP
                     IQGPVAAVVDPTGLWAFVVNRETDNVAIIPTGRRSGSDLMSGMGSTVRQLVRVGSGPT
                     GIAMTRDGRRAYVYNAFDHTVTTLVSDGAGGTANVRTEGAPLPIAGDVLAPNEVAGRK
                     LFFSALDSRMASTSVGASCASCHPDGREDGHVWGFPDGPRQTPSLAGRGMTKTGPFHW
                     SGEFSTMRDFLDATVRHRMGGTVLDGVMVAQLSDFIDVLPAPDNPHKGEVLTEAQARG
                     EAVFRKAACDACHGGEHFTLNTQADVGTFVTTGPLQDNAAVREVGLNTPSLLGLARTA
                     PYLHDGSAASLKDRLLQGRESNQHGVTAQLTDAEVDDLVEYLLTL"
     misc_feature    complement(483825..485126)
                     /locus_tag="LILAB_02045"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3391"
                     /db_xref="CDD:225926"
     misc_feature    complement(484860..484982)
                     /locus_tag="LILAB_02045"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     misc_feature    complement(483216..483902)
                     /locus_tag="LILAB_02045"
                     /note="tryptophan tryptophylquinone biosynthesis enzyme
                     MauG; Region: TTQ_mauG; TIGR03791"
                     /db_xref="CDD:163503"
     misc_feature    complement(<483681..483881)
                     /locus_tag="LILAB_02045"
                     /note="Di-haem cytochrome c peroxidase; Region: CCP_MauG;
                     pfam03150"
                     /db_xref="CDD:251759"
     gene            485422..486951
                     /locus_tag="LILAB_02050"
                     /db_xref="GeneID:10874870"
     CDS             485422..486951
                     /locus_tag="LILAB_02050"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_004663415.1"
                     /db_xref="GI:338530081"
                     /db_xref="GeneID:10874870"
                     /translation="MSRTPPRFLNFRRTFALLIVLVVVPSAGLSGFGVVAIINERAAV
                     EKRLEAAWRGTLESLSEELPRILASASLEAVEGRLQFILPDGQSVSEPEGGFELEEGQ
                     VRTRDPQLTEALTAVLPEAGGLPTEPTVFSLTAGGRAVLVAAERRGPVVHGVRLSVQA
                     LEARLAERVDSRAVSSEPVRFALLPVPRDTSEGGLMGRLVSEVAQARASALGPTGLAE
                     RVLPSPLQDFRLVVLPTGEDPVARASTRNRVLYGVLLGLFYLTLTFGVVYTGRALYRE
                     AQLSRMKTDFVSLVSHELRTPLTSIRMFIETLALGRLKDPAQMQEVLTLLMRETERLS
                     IFVERVLDWARIEGGRKVYQRELVAVPELVGAAVEAFRTQRMEDGVDLSVDVAEGLPR
                     VDVDRAAVAGALLNLLQNAYKYSGPDNRRITLLARGGGKWVDLSVEDNGVGIAAKERK
                     RVFERFYRVDNLLTRRTEGSGLGLAIARRIIEAHGGRISVQSEPGKGSRFTIQLPAGK
                     A"
     misc_feature    486259..486456
                     /locus_tag="LILAB_02050"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(486277..486279,486289..486291,486301..486303,
                     486310..486312,486322..486324,486331..486333,
                     486385..486387,486397..486399,486406..486408,
                     486418..486420,486427..486429,486439..486441)
                     /locus_tag="LILAB_02050"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    486295..486297
                     /locus_tag="LILAB_02050"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    486628..486933
                     /locus_tag="LILAB_02050"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(486637..486639,486649..486651,486658..486660,
                     486730..486732,486736..486738,486742..486744,
                     486748..486753,486832..486843,486889..486891,
                     486895..486897,486910..486915,486919..486921)
                     /locus_tag="LILAB_02050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    486649..486651
                     /locus_tag="LILAB_02050"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(486742..486744,486748..486750,486832..486834,
                     486838..486840)
                     /locus_tag="LILAB_02050"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            486948..487649
                     /locus_tag="LILAB_02055"
                     /db_xref="GeneID:10874871"
     CDS             486948..487649
                     /locus_tag="LILAB_02055"
                     /note="COG0745 Response regulators consisting of a
                     CheY-like receiver domain and a winged-helix DNA-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="YP_004663416.1"
                     /db_xref="GI:338530082"
                     /db_xref="GeneID:10874871"
                     /translation="MSSDKTRRILVVEDDLSILTGLSMNLRFEGYEVLQAQDGRTGLA
                     RALDESPDLVVLDVMLPELNGFEVLKELRQRGRDTPVVVLSAKGLEPDKILGLNLGAD
                     DYVVKPFGLQELLARIKAVLRRRYPSAGAGSPPPVTFGDVSVDMAARTVARAGTQVEL
                     TAQEFKLLAHFLAHPGRTFTREELLSGAWGYHYEGSARTVDNFMRQLRLKFEPDPEAP
                     RHFLTVRGLGYRFER"
     misc_feature    486969..487643
                     /locus_tag="LILAB_02055"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    486975..487313
                     /locus_tag="LILAB_02055"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(486984..486989,487116..487118,487140..487142,
                     487200..487202,487257..487259,487266..487271)
                     /locus_tag="LILAB_02055"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    487116..487118
                     /locus_tag="LILAB_02055"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(487125..487130,487134..487142)
                     /locus_tag="LILAB_02055"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    487266..487274
                     /locus_tag="LILAB_02055"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    487356..487640
                     /locus_tag="LILAB_02055"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(487428..487430,487485..487490,487542..487544,
                     487551..487553,487575..487580,487614..487616,
                     487629..487631)
                     /locus_tag="LILAB_02055"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(487657..488253)
                     /locus_tag="LILAB_02060"
                     /db_xref="GeneID:10874872"
     CDS             complement(487657..488253)
                     /locus_tag="LILAB_02060"
                     /note="COG0500 SAM-dependent methyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663417.1"
                     /db_xref="GI:338530083"
                     /db_xref="GeneID:10874872"
                     /translation="MLVLGAANGRVVWALAGHGFDAVGVDPSEVMIRSAEEQRSTEPE
                     DIARRARFQVADLRSLRLPERFPLILAPQHALGLMPGKDDLEALLATVRHHLTPEGTF
                     VYDVLNTPREPVLPRDDEAPSAGLEPRRPLFALHLRERRQPGGPSPIRRLKLRHFTPE
                     ELDAALTAAGLVPRERYGRFDGKPFDLEDSRHIGIAGP"
     misc_feature    complement(487933..488250)
                     /locus_tag="LILAB_02060"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(488029..488031,488083..488091,
                     488173..488178,488224..488244))
                     /locus_tag="LILAB_02060"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            488566..490230
                     /locus_tag="LILAB_02065"
                     /db_xref="GeneID:10874873"
     CDS             488566..490230
                     /locus_tag="LILAB_02065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663418.1"
                     /db_xref="GI:338530084"
                     /db_xref="GeneID:10874873"
                     /translation="MKRGWGWAGALFMAGVVGATGCGSGSDSTGAEDLDVPPVQSPQN
                     PEGDAGTPDSGIPGEPDSGTPDDGGTPDDGGTPDDGGTPDDGGTPDDGGTPDDGGTPD
                     GGPVEVPLPTPSAANWEFFGREAGGPRFIHGVTADASGNIWVAGGEEGLFLMKKGERT
                     FRKFTMADGLRPYGYMPDGSVPPGPKYLKVISVAGGWNDTVFVGYEGMPGDGALHCEN
                     NWDGNAPDPARYKSGDADRVSLRADGTLDVVHYDISSGPNVVDAELRGREKLCNIWRI
                     AYDANTNSVWFGANHGFARGDADYQGNPTCNGQLLCSGVEEHSHPGINAYIYADPAGD
                     RQRYGEDRSQWSVRDALLTDAYYGLGVRPDGDVWVGGANRTTRYFYGSVGNDFWEGQT
                     RTESAAYAWNRIDIWKDAVGEERYSRPEERTDDLVSGIALMGSSVWVGSFGHGIAELN
                     DSGQVVRTLKNELAAPHVASVAADPANGSIWAGHSWGGGLSRVHGGSVTLYGLSVFGR
                     ELSTLRVPDIQVDRSGPRRRILVAFQGATLSDGTVMPGTIGIYSGD"
     gene            complement(490329..490892)
                     /locus_tag="LILAB_02070"
                     /db_xref="GeneID:10874874"
     CDS             complement(490329..490892)
                     /locus_tag="LILAB_02070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663419.1"
                     /db_xref="GI:338530085"
                     /db_xref="GeneID:10874874"
                     /translation="MSNASSLMRTAQLNRDALLAALRQDLSSTRRIGVVMALVGAALM
                     LYGWPQLDLLMDAGREELTEFVSFLGWGAILLIGGLLVFWRGSRHTRRLIRSVKADER
                     APMLMTVLREEVPTDDDERVRFVATLYNVKERRVALRDVHLRTGDTPMAYPYDDGVTK
                     VPVEVYGRPGEGPIVIDAAGPSCSPPT"
     gene            complement(491024..492013)
                     /locus_tag="LILAB_02075"
                     /db_xref="GeneID:10874875"
     CDS             complement(491024..492013)
                     /locus_tag="LILAB_02075"
                     /note="COG2319 FOG: WD40 repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="WD-40 repeat-containing protein"
                     /protein_id="YP_004663420.1"
                     /db_xref="GI:338530086"
                     /db_xref="GeneID:10874875"
                     /translation="MTSLRPIITPANAARLSRVRQLGPVRVSFSSGQRLGFDSQCAVL
                     VAKDSRRARLRWWDLRTVSDHPVVDTELPLLGAPAVAVGELVVCIGAPALSPTGLWRP
                     SLKALSASDGSLQRQEFLPHAVTALCASRDGSQLLAVMDEEAGLLWDVRAWRPVRELP
                     WPEGEFSVTACALSADGRFAAASATQWSDDQKGVLWFWEVASGGQPWTMPIDASTAWS
                     VAFHPREPLLVVGGLTENVAVVHVEERRLVRTIPGFYGYACNLDFHPAGHLLAASHDG
                     RGFALHHFDTGEVLFRASDGDDLQTSDAVFSPDGRFVAWGQGDGTVGLWAVAD"
     misc_feature    complement(<491039..491653)
                     /locus_tag="LILAB_02075"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    complement(<491039..>491632)
                     /locus_tag="LILAB_02075"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    complement(order(491039..491041,491057..491059,
                     491069..491071,491159..491164,491201..491203,
                     491252..491254,491291..491296,491312..491314,
                     491327..491329,491378..491383,491417..491422,
                     491444..491446,491468..491470,491522..491524,
                     491567..491572,491588..491590,491600..491602))
                     /locus_tag="LILAB_02075"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     gene            complement(492078..492662)
                     /locus_tag="LILAB_02080"
                     /db_xref="GeneID:10874876"
     CDS             complement(492078..492662)
                     /locus_tag="LILAB_02080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663421.1"
                     /db_xref="GI:338530087"
                     /db_xref="GeneID:10874876"
                     /translation="MVPDARPEVKPVLGNRDELIDALRQRLAGSFRWAGVSVALGALA
                     VLYGASSFQQALDSGRYRWPFSAQLPVWGSLLIVIGLVAFWLAPRYTRRLVRSVESDV
                     RTELRMTVERKRVPGDDEHFLFVATLYTPDQRHVVLRNVHFHQGDKPLQYPYKKGVTQ
                     IPVQVYGRPGEGPIVIDAGWGFLLPANLTYPWYK"
     gene            492950..494314
                     /locus_tag="LILAB_02085"
                     /db_xref="GeneID:10874877"
     CDS             492950..494314
                     /locus_tag="LILAB_02085"
                     /note="COG1716 FOG: FHA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent transcription regulator"
                     /protein_id="YP_004663422.1"
                     /db_xref="GI:338530088"
                     /db_xref="GeneID:10874877"
                     /translation="MPVLPPAPIPSHTVIGARTQGERLSAQLFHLVLLDTERAGTVFP
                     LANDALRVGKAADNDVVIDHPTVSRNHLVVRRQGDRFLVQDLGSTNGTFLDGAQVREA
                     FLRPGALLEVGDVRLRFSPQVSPVQVEPILEDRLGDLVGRSLPMRQIFALLQRIAPTD
                     STVLLVGETGSGKGAAAKATHKLSPRATGPLVVFDCASVSDSLIESELFGHEKGAFTG
                     AVSQRIGCLERANGGTLFLDEIDDLALDLQPKLLRAIEDREFRRLGASSPISFDARII
                     VASKKDLWAETQAGRFREDLYFRLSVFTVSLPSLRDRKEDIPLLVDAFAGEGLWPRLP
                     EKIREQFTGHTWPGNVRELRNALERARHMVDIPELAGDSLLREFTREAPAAAGDSLPV
                     EFTGPFKVCKDELIRAFEREYLTRLLGRAKGNIARAAREAELDRKHLYSLLHKYGLVQ
                     SETD"
     misc_feature    493031..493306
                     /locus_tag="LILAB_02085"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    <493067..493378
                     /locus_tag="LILAB_02085"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    order(493109..493111,493145..493147,493151..493156,
                     493214..493222)
                     /locus_tag="LILAB_02085"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     misc_feature    493400..493852
                     /locus_tag="LILAB_02085"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    493412..494287
                     /locus_tag="LILAB_02085"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    493448..493471
                     /locus_tag="LILAB_02085"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(493451..493474,493661..493663,493787..493789)
                     /locus_tag="LILAB_02085"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    493649..493666
                     /locus_tag="LILAB_02085"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    493844..493846
                     /locus_tag="LILAB_02085"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    494165..494287
                     /locus_tag="LILAB_02085"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; cl17420"
                     /db_xref="CDD:266671"
     gene            494453..495097
                     /locus_tag="LILAB_02090"
                     /db_xref="GeneID:10874878"
     CDS             494453..495097
                     /locus_tag="LILAB_02090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663423.1"
                     /db_xref="GI:338530089"
                     /db_xref="GeneID:10874878"
                     /translation="MKRPSPWLAMLFAGFMSMHATGCFGQFQLTQKIWNFNKNISGNK
                     FVQWLMFLVLTIIPVYGLGAFIDAIVINSIEFWTGSNPVASVDGAPETTRIVKLSPTD
                     TLRLSRDVETGVMRMELEREGQETMVRYFEPLEDGMVVRDDAGAMLIQAQEATDGAVA
                     VTDAAGTTLTVHARDALAVARRVYEEGGAQALAQHTVAQASMSQGLAANTCVAR"
     misc_feature    494462..495040
                     /locus_tag="LILAB_02090"
                     /note="Domain of unknown function (DUF3332); Region:
                     DUF3332; pfam11810"
                     /db_xref="CDD:256639"
     gene            complement(495200..495775)
                     /locus_tag="LILAB_02095"
                     /db_xref="GeneID:10874879"
     CDS             complement(495200..495775)
                     /locus_tag="LILAB_02095"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663424.1"
                     /db_xref="GI:338530090"
                     /db_xref="GeneID:10874879"
                     /translation="MTRAVRALAAVGLSALMAGAGLAACGLADNSLGGSVSELFPLEV
                     SRVEVRRNAEAFQVSYYRNNDLDVDLVVRLTVSTEGLDLRPGSKVDLAGTTPSGQARA
                     TVVHLNAGEPARVFGPVNKGDLQLESGGNPGESTRGNFSMSFSRGDGYGAGRNLEGTF
                     AVVAQDATFGPEPGQLLDGGVPPPDAGTPPD"
     gene            complement(495772..497118)
                     /locus_tag="LILAB_02100"
                     /db_xref="GeneID:10874880"
     CDS             complement(495772..497118)
                     /locus_tag="LILAB_02100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663425.1"
                     /db_xref="GI:338530091"
                     /db_xref="GeneID:10874880"
                     /translation="MKRHAWALGLVLALGCGKDGNPTPPDAGGNPDGGPIDTSPFAKF
                     VVDADEGQFDPISSIAMAVGPQDRIGMAYFVRNGTRTEDVENSDVMYREFNGGQLGAA
                     ERIATVQRVYGISVAFGPDGQPVVTYLGGDREEPSSFWFQSDLAVAYRSASGAWTERI
                     TVRRSDEAQPVNPVTDVGFLVGLNPAIVFNGNEAIVAYRDGHSGNFGRQDWESSDLEI
                     ASGGPTTWQRRVAMSSGENKHGYGAHISLVMAGSQPAVVHDTAPEGAQATGTDVHFQR
                     RNADGLTWTAPVRVQAVSNTQLGASLAHDAEAGFGIAVLEKNGDRLTYTDCADTSASA
                     CTATGNWSAPDPVFNSGTGGWYPSLAFDPVHHEPSIAFYICALESGRNDTNCNPNDDA
                     LVISTRIQGIWRETLVDSGGGWSPKLAYLSNGKRVVLYRAPVVAQDKGVLKLAVER"
     gene            497252..497908
                     /locus_tag="LILAB_02105"
                     /db_xref="GeneID:10874881"
     CDS             497252..497908
                     /locus_tag="LILAB_02105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663426.1"
                     /db_xref="GI:338530092"
                     /db_xref="GeneID:10874881"
                     /translation="MTRARSNRGRLSRRSLIQRLTFLGGGVVLLGPACKRSSEPKEKA
                     PPADTGPLAAKQDGQGPRTFSSFEYAVVAAATERILPRDEDPGAVDANVPVYIDRILQ
                     TPELEPVKDDFLSGVAALERRAQRMHQKGFAALTAEQQDELLTLFKDSPPRSGEAHFF
                     ELLTVMTLEGFLGDPSYGGNQGKVGWRLMGFDTVGTLASAPPEDYDGPKCLRECGVHR
                     "
     misc_feature    497453..497809
                     /locus_tag="LILAB_02105"
                     /note="Gluconate 2-dehydrogenase subunit 3; Region:
                     Gluconate_2-dh3; pfam13618"
                     /db_xref="CDD:257931"
     gene            497905..499563
                     /locus_tag="LILAB_02110"
                     /db_xref="GeneID:10874882"
     CDS             497905..499563
                     /locus_tag="LILAB_02110"
                     /note="COG2303 Choline dehydrogenase and related
                     flavoproteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663427.1"
                     /db_xref="GI:338530093"
                     /db_xref="GeneID:10874882"
                     /translation="MSLPEVDVCIIGSGAGGAPMALELGRAGFKVVLLEKGPHYQPKD
                     FIHDEILNSRRNFFMPVPWEEPHLVRQGAAGRYEKTSAAWTANCVGGGTVHMSGFFYR
                     LKPVDFRLRSTLGAIPGSTVADWPISYEELAPFYDKAEAELGVSGESVPHPFAEPRKG
                     PYPLPPLDVHPVAKEIDKACGAMGWHSLPTARGILSKPYRGRAPCSYCALCGSYGCET
                     GAKSGTNASLIPAAVATGNVDLRPGCMARTVEVDKQGRARSVVYLDADGVTREQPAKV
                     VVVSCTAVESARLLLNSTSSRFPRGLANGNGLVGRNLTFSSFGESHATFRLSRQAAAR
                     PWLKDPSPFVNRSLQDFYLMPDARFGFRKGGTLGFMWAHPNPIHAAVGLAGKGQTALF
                     GKALKDKMREYRDSRILQFEVYAEFLPTAGTYVSVEGGVKDRYGIPVAAITVDRHPMD
                     LAATRFLVERGEEVLLRLDPDDVRRGTTTGETSILQHGTCRFGNDAATSVLDRHCRAH
                     EVPNLYVVDGSFMPTGGSVPSTLTISANSFRVADHLVRKLKGGR"
     misc_feature    497905..499542
                     /locus_tag="LILAB_02110"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    497917..>498012
                     /locus_tag="LILAB_02110"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    498169..498843
                     /locus_tag="LILAB_02110"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    499198..499509
                     /locus_tag="LILAB_02110"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(499560..500018)
                     /locus_tag="LILAB_02115"
                     /db_xref="GeneID:10874883"
     CDS             complement(499560..500018)
                     /locus_tag="LILAB_02115"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663428.1"
                     /db_xref="GI:338530094"
                     /db_xref="GeneID:10874883"
                     /translation="MLLFASLWGACDGTREDFIGARVQDTCGAAWPVCDRVAGCILGS
                     ESYSEGRFPGRQQLIVQLKEASTVKVSFFLEDVSAAGSETVVQFHEEGCRARIRRATE
                     GRAVLDLMERQGAFTEEAELTGVGDHLIEFESDMQARYIVKVDVAPLRNR"
     gene            500092..500529
                     /locus_tag="LILAB_02120"
                     /db_xref="GeneID:10874884"
     CDS             500092..500529
                     /locus_tag="LILAB_02120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663429.1"
                     /db_xref="GI:338530095"
                     /db_xref="GeneID:10874884"
                     /translation="MSMRLRTRWLPFIFFALAGCGNEVELPQAPTLFIDRAALTFNRE
                     FEHGTYVGQTTFNSLAIQNRGLDPLDITAITLSAPGVFTLQLPEGFTPGTPLRLETYE
                     RAFLTVAFRPTDDTEYDGTVTIESNAANTPQQVITLNGLGVAP"
     gene            complement(500583..502979)
                     /locus_tag="LILAB_02125"
                     /db_xref="GeneID:10874885"
     CDS             complement(500583..502979)
                     /locus_tag="LILAB_02125"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663430.1"
                     /db_xref="GI:338530096"
                     /db_xref="GeneID:10874885"
                     /translation="MPTSVRLLPLTLLVLAACSSGGGETPDAGTPAVEDLCNSREDAL
                     TRPECELKPGEPLERFLALDSEPRAGDQDWYRIVLPAGTNARTLLNVNGAYLAASTAV
                     NLSVTILGPLPNGEEGALAKKEDKHAQGAPRPVDIVLPLRDGLENQTLLVLVQDAPDV
                     PSRPNYDARNKYRLTVRIDQNPDEQEPNDTHETATPLVLTQSGELLMGASTGYLATDN
                     DVDHYTFDLEAGKIVYVRVVAPNLDFVPNWRLSYELWRPGFTEKEDEGVVLPQVRGGE
                     LATARKIKVGHAGRWTLVVKGYRGTNDRDTAQGDLTQPYEVEVRVLEEEDPQDQTTPD
                     VPDDHDDNDKVQWATTRNLSAATPGGTGSAVSFTGRLGYISDRDWYAVQLPAFGTSSL
                     LRYRLVPLDSGGRFPTLPVTASRVLHVFTLSAVGDNLNEWRENCATRPEVCPRDFSEN
                     PDARALVDGFCRRTDLPAPMCVHSSREEAVDNARFTGLSNFRGVIPVPAHAGVVTYYF
                     LVQDNGSWVDDRDYRLEVSWDAEDADELARYVDGAEAPVQRPMASTTAFPAPPDTAEF
                     SVSGQLSHGHGRLRSGTDRLNGLGVRGPLDYDAVPSDVDSYVFDLPTVPPPEDRTWLL
                     QWEVQKLADGGTPHGLALDLTFCDADAPDAGTGSCVPVRAGNRGPLTLGYRSDALRAW
                     HTPANAGTSSLQPLYQLEDRPGSTVVTLAPYACGCLERRFIRGGTLRVDVTASERLDY
                     ERVDYTLRTGHGDYPQSYPVDGGTTVACPAVTDGGTTPDGDGGVIQNYAGGCNFTYQP
                     "
     gene            complement(502991..504739)
                     /locus_tag="LILAB_02130"
                     /db_xref="GeneID:10874886"
     CDS             complement(502991..504739)
                     /locus_tag="LILAB_02130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663431.1"
                     /db_xref="GI:338530097"
                     /db_xref="GeneID:10874886"
                     /translation="MSRAVRVLAGALVSVVLVMACTDSYLYDPRRDTDVPVDRAVALD
                     GRFCTVGSNEVVRPIKLVVAMDASQSMRVSDPDGARATALVELIQNLPRDPEVSLAVM
                     LFAGSTTAFLTQQPGNPPQDGFVQVSSMDDAALRRLTEQLLTFRNPDTSPNRDSTDFV
                     KPLSDIYSLINTDIARSRLDPGGPQALAQARYSVIFLSDGKPTNDQDDELLRGDAVVR
                     IRQLRDLVEEVRVNTVHVFNPTQPVSSVCDLTGDGGCPMLIINQNADRLEQMATLGGG
                     NFRDFRNNEPINFLDFTFGQVRRAFIMKELVAFNFSAPPGSPVDEADSDGDGLTDARE
                     LELGTDPHKVDTDGDGFSDGVEVYFRDRGVDFNPTQEALPDGGGLDRGCPPALRGVDS
                     DCDGLLDCDEQFVGTNATLADSDRDGVPDGVEWLGGTQGASNDLDEDPDNDGLTNRME
                     LRMHTRPLEVDTADLSVNGYRYAFEADGPPDDLGRQCYRFRVENVLLAPTSASTDDAG
                     VVQRGAGFNDIAMSVAMVPGDDPTARTLIRTFRVNDVRYPVGGIKSPADGVIRVEPEQ
                     FVDGCPGRPDDVPPTP"
     misc_feature    complement(504032..504559)
                     /locus_tag="LILAB_02130"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(504143..504145,504269..504271,
                     504542..504544))
                     /locus_tag="LILAB_02130"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(504736..506715)
                     /locus_tag="LILAB_02135"
                     /db_xref="GeneID:10874887"
     CDS             complement(504736..506715)
                     /locus_tag="LILAB_02135"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663432.1"
                     /db_xref="GI:338530098"
                     /db_xref="GeneID:10874887"
                     /translation="MRRLVRTSLLAAGLLASGLWSCSDAMLESRVDALSNLDDRLTLQ
                     GRVCTRPPNPSGFPVKVVVVIDESGSMCVSDPPGAQLDSGFCQRREILDIIPEGVTEP
                     ARVRALKRLVQQFREVNAQGGNVQVSVAPFETNVRNVWPPATTGDRFARPDNNIDSYI
                     EGLQSQLGKGTDYQGALSYAYSLISSDINAVAQSNPELLPRTRYVVVFLTDGTPYPRC
                     SATDNLSVYADPDNPDLTWADSLTDFCNLTNTTDQIDGFEVGTDRNQNYQLFSYVRRL
                     MELKDQYNVGDLRMHTVLLFNQEAVRACGPICQDIYGVYPGVEQARYPEAAKKIAAWL
                     LRRFADMGNGVYQEFNDTGEISNLGLGALDYSSFASRNVMKTLMVESLSSAPGDTGRV
                     LDSDGDGVPDAVDNSFTLKTNTFVADSDGDCLDDGFEHRREDQGFKAANDLDARGCNP
                     ASPLTPNCVCRDTDGDGLSQFAEDYLRTRTGIVDSDGDGVPDGLESRWGLDPLENSVA
                     GLDTDGDGIPDYQELRAGSDPTRRDKAFHERFGYQYETRIAEVRPDGSLCYDFTISNL
                     QLVTPPDRAGVKQGYNLFKVWFAEAPESGVSTDYGVWRTACAWAQYAPPSVRVPLGPE
                     LTFEDGDFRRPDTLSNPWNNQNDCVGIPPSGSANP"
     misc_feature    complement(<506041..506535)
                     /locus_tag="LILAB_02135"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(506083..506085,506203..506205,
                     506518..506520))
                     /locus_tag="LILAB_02135"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(506750..508078)
                     /locus_tag="LILAB_02140"
                     /db_xref="GeneID:10874888"
     CDS             complement(506750..508078)
                     /locus_tag="LILAB_02140"
                     /codon_start=1
                     /transl_table=11
                     /product="thrombospondin type 3 repeat-containing protein"
                     /protein_id="YP_004663433.1"
                     /db_xref="GI:338530099"
                     /db_xref="GeneID:10874888"
                     /translation="MTRARFASALTLGAFLVLSPAGALAQSNNNPDNPECLGDRCGMP
                     LEQGGGCGCGAGGSVWVNYTDDGDTLSYTDDADGDGRADDRDNCPFVSNRDQADDDGD
                     DVGNACDNCASLSNFQQRDADGDGIGDDCDPDQDNDGHNNDVDNCPLVPNTNQVDTDR
                     DGLGDVCDLDDDGDGISDGEDNCPLVYNPDQVLPEDVTVCRVDADNDNISDSSDNCPG
                     VPNPDQRDTDADGVGDACDPDMDGDSVLNTQDNCPAVDNRDQRDDDRDGIGDACDTRY
                     CLVTNSERPDDCLDPKAPFTVSAGGLFRTEKAGITIRPPLFANRNGAAMEYEWAVVKR
                     PSGSTAVVERPQGAVTLSRDWQYMYVDGSVPTFVPDKKGEYQLQLTARLAFSDRVFPD
                     QRVSTSTLTVFVGDESEGGTNCSSVPAGFSATALGAALLSVLMRRRRSQQ"
     misc_feature    complement(507407..>507484)
                     /locus_tag="LILAB_02140"
                     /note="Thrombospondin type 3 repeat; Region: TSP_3;
                     pfam02412"
                     /db_xref="CDD:202235"
     misc_feature    complement(<507320..507403)
                     /locus_tag="LILAB_02140"
                     /note="Thrombospondin type 3 repeat; Region: TSP_3;
                     pfam02412"
                     /db_xref="CDD:202235"
     gene            complement(508249..509838)
                     /locus_tag="LILAB_02145"
                     /db_xref="GeneID:10874889"
     CDS             complement(508249..509838)
                     /locus_tag="LILAB_02145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663434.1"
                     /db_xref="GI:338530100"
                     /db_xref="GeneID:10874889"
                     /translation="MRALTRSVWLIPVLLLSCSDAGLYALNGRGPGGKDRASFSGTVC
                     VPLAGGEAFPTKVIFALQGGEGVEREVVGFATEALSTLSSRFSGPFVQFSLVAYHTVA
                     TGLLGSFSDASDFQAALPRYATYQESGPVSVRAALRLAKTLLSGDMQTSCRGEVARTR
                     YVIVVMVRSQDTSCANPAFNVGLDSRCSALGNTTACSQCELTAITGEIKALTSQFSAG
                     EVVVQPIYVRGETPDPVTRQHVAAIAAAGGTEPLETDAAGLSGTLTNIPYAARTNTLK
                     LKRFFAYNRNVVVRAGQVLVDSDGDGLPDTDEELLGTDPTRQDTDQDGLMDGVEVRMG
                     LDPLAPDIINGCNVSLDEDGDRLNTCEERVLGTNACIGDTDGDALPDLVEALAMTNPL
                     ISEDLLDSDRDGITNVSEVEAHGDPLSADLDFHRERGYGYELVETTPTVDGRTCYQVR
                     VENVTVVPTRERPHPFIPGEVIPAGTNEVYLYLQAGRDNDPRGAGIGSLLIQDIHYSE
                     EGGRLPAGIIPLEPDTFITGT"
     gene            complement(510021..512294)
                     /locus_tag="LILAB_02150"
                     /db_xref="GeneID:10874890"
     CDS             complement(510021..512294)
                     /locus_tag="LILAB_02150"
                     /note="COG3391 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663435.1"
                     /db_xref="GI:338530101"
                     /db_xref="GeneID:10874890"
                     /translation="MLAVLGALGLAAGVVAHHLGGASPAAPEAPAGRPRLVSVGPRLT
                     SNETSQPLSIQGERLVPGLSLSLGPPLSLRLPLTVVDATHAYARLPAGLRFPEDVPQA
                     VVEARLAGPAGGESEGAARLTVVNDAAFADLTAMVGSPDGRTLYVASAPTDTVFALDV
                     ESGRVERLSTGDGPSALAAWTDGDGRPWLGVAHRYQPELWLYALDAPGAAPRVLPAPL
                     GAEGLMVDGPGGVAFVAERVGDRVHALSLADGRARWSAPVDPNPRALARWRDVLAVGS
                     LQTGQLELLRQSDGTLVSTVVPGPGVAIIGGNTERFGEQVMGGKAPRFLVASERLGHV
                     FMSSLGPNVGPNPRRMEVSANSGVSVVEPSRGVYVRHRGFGAGGTEGLALDDGAGLLY
                     AADVGLGLVRVLDARALVAGDATARRAVLQEVAVTPPQGTPRIRPAEDFGVRGRAGEA
                     LHSGPSALALSPDARTLYVLNRFTRTVAVVDVREAKAGRARVVRQLPVETSRAQAKRR
                     LGQVLYYADLGRTGITCDGCHLEGHTGGVFYEKTQPNRIYRSTTLRGSRDTPPYFTPA
                     SHISLVDTVRFVGARNRFHNPDPSPSEVEALALYNALIVTPPNPFRGEDGAPLETVTL
                     PDGRVGRPAQGRALFEGKGACVTCHPAPLYTLDQDLETRGRYLDVGTPVALPLRLEQQ
                     DLAPGAATPSLVGAWDVWPLLTSATAGYGVREGRLVVASRFALRALLESSGPRHGHAS
                     ALTPEERDDLLAFLLTL"
     misc_feature    complement(<511464..511916)
                     /locus_tag="LILAB_02150"
                     /note="PQQ-like domain; Region: PQQ_2; pfam13360"
                     /db_xref="CDD:257688"
     misc_feature    complement(511761..511877)
                     /locus_tag="LILAB_02150"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     gene            512640..512993
                     /locus_tag="LILAB_02155"
                     /db_xref="GeneID:10874891"
     CDS             512640..512993
                     /locus_tag="LILAB_02155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663436.1"
                     /db_xref="GI:338530102"
                     /db_xref="GeneID:10874891"
                     /translation="MIAPTDTWAQSRSRSSRKAKSRTAKRAAKAAPKVPPKIETKGSS
                     AVDPVTGDTATTATTALPQRGPARIDFDDRLIQGQTNKSGAVYLYDRKELKTRSMIRE
                     RESFRSETLSTVYDP"
     gene            513033..515780
                     /locus_tag="LILAB_02160"
                     /db_xref="GeneID:10874892"
     CDS             513033..515780
                     /locus_tag="LILAB_02160"
                     /note="COG1716 FOG: FHA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="YP_004663437.1"
                     /db_xref="GI:338530103"
                     /db_xref="GeneID:10874892"
                     /translation="MSGQPSVLQVVILRDGLLVGTEVFVPGTYALGSDPASDLRLDDP
                     SVEPRHALLYFQNGRAAVQDAGSAGGLFVNGHRVSACEIRPVDEVLCGPFILKTRVLS
                     QKPQEAKPQPPPEVAALLGAAQAPSPFVAPPPQAAVPPPSAAPAHQLRPATAVPPNSA
                     TLPAARVPVAPPVQHVATQVAYPTPAQPVPAVAMVPPVAQAPQAHAQAGGYAQAPQVP
                     GHAQAPQAHGYVGGHAQAPQVPGHAGGHAQAPQAHAHTGGHAQPHQAHAQAGGLAHAA
                     AQPPQAHAGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVH
                     AGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVHAGGHAHVVAQAQPTAIPASPGAPR
                     PAQQAPTGVPASTVPSARRRAAPEPAPSANTGMRLADELMADLAIDPLPEPTGPLLEE
                     QRTLTRPTHAPRIATGKGAAQLYLDLYWGAIRRDARRFAPDKKKPVQASLDLEGAMPL
                     WGFTLPDGAPFTLAESVNNAFRLFVPPGTDVEKSGNDGRFTPVTGAALESDGSRRFLT
                     LREGTAARLTQGQMSLVAYAAPKPARVFVNPLKGLPWLTLTFLGLFASALGAFLVMKP
                     HRPEVADFQQKSLPPVALRLIAPEPKKKEEAKKKLEAIKAQAKKPTKEKVAEKAPPKP
                     VEKTPPPKQPERAVAAAAPQNKALKALAKLSAAGPATNNLLAAVDKLGSGPGSKNVKN
                     SNYKLSGLIGKAPIANAGLGTFGLGGGGKGGGATLGKELLRGKGGGGIGALGAGGVGK
                     GKVGGTVTRATARSIASTQGTVDREAVARVINSHLNEVHGCYERGLLKDPGLAGKVVL
                     EWTIGASGRVVAAKTKSSTLRNASVESCILSRLKSWKFPAPKGGVVIITYPFLFNSVG
                     Y"
     misc_feature    513051..513338
                     /locus_tag="LILAB_02160"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    <513126..>513269
                     /locus_tag="LILAB_02160"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    order(513129..513131,513165..513167,513171..513176,
                     513234..513242)
                     /locus_tag="LILAB_02160"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     misc_feature    515577..515765
                     /locus_tag="LILAB_02160"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; cl10048"
                     /db_xref="CDD:263958"
     gene            515831..516466
                     /locus_tag="LILAB_02165"
                     /db_xref="GeneID:10874893"
     CDS             515831..516466
                     /locus_tag="LILAB_02165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663438.1"
                     /db_xref="GI:338530104"
                     /db_xref="GeneID:10874893"
                     /translation="MRYALLILLLLTPGLVRAQAEALENPGAVSAIQERRFRMHHELL
                     LGVGVLPANAYYKGLVGSVGYTYHFSDTFAWQVGRGTYSYNLQTSLRRQLERDFNTSP
                     NAAAFQDQVQWMVGSDLIWSPLYGKMAFLNESVLHIEAFLLGGGTVVKLDRDGGFRPG
                     VNVGLGLRLFTGKTLSLRLDVTNNTVFTGATRVIQVPQIQFGTAFNFGATE"
     gene            516463..518055
                     /locus_tag="LILAB_02170"
                     /db_xref="GeneID:10874894"
     CDS             516463..518055
                     /locus_tag="LILAB_02170"
                     /note="COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663439.1"
                     /db_xref="GI:338530105"
                     /db_xref="GeneID:10874894"
                     /translation="MTSRSLIAALTSAALLVSPAPAAAQSAGGAQPTSPAPEQGSPPA
                     TDGKAPASPDAQAPAAQGASKPAEAPPPAPEKVDPAVFDQALQAYFDGNPRDAAEPLY
                     AWLQAAPRTDENYAWGQYFLARSLIDLGLTHAGASYLARIARERSNPNVLPRALDALK
                     ALTDRPHDEVMIDEQVFGALDLGFLPEETGAYAHYQQGLVDLRVGNERWANTHFAKLP
                     ETSAEASHAKFALLVTRLKHVKEPTDEIIADFLALSEDEKLTREARNEAALAVARLRY
                     ERKDFQGALEAYDRVKLPELDPGRASLYLEEAWTRYKLGELRASLGILTTLDAPSFRD
                     EFLPDKYLLRSLIYRDLCHYLPAKRAAKELTRRFADSLEAVRNREDLTQDVRLRRAAN
                     AHGSTQRAARFLQTLELEGERLGRYAGSFGDRLFSHLTKLYDLSRAEAVRVHDARLAE
                     AVRQEADTLLRAAEQVRLMEYEVGLKLYERVKKGARIVAPEDEQILSPTQTAYRFDGE
                     YWNDELRSYRVRIDSRCIEETP"
     gene            518052..521321
                     /locus_tag="LILAB_02175"
                     /db_xref="GeneID:10874895"
     CDS             518052..521321
                     /locus_tag="LILAB_02175"
                     /note="COG0457 FOG: TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663440.1"
                     /db_xref="GI:338530106"
                     /db_xref="GeneID:10874895"
                     /translation="MTGHLTGLIAAALLAAAPGGAGRPGPGVNPIVSKAKEREELIAK
                     LKRDIFKVDRAIGETERLISKSRNAPYLPDLQFRLAELYVEKSRYVYYLQAESRPEGA
                     SGAIVSPETRLMKQKAVQMYHRLLREYPDFKDGDQVTFYLAHEQRELGQFDEMLKTLG
                     DLTRKFPGSPLRLEAEQILGDHFFDKAELGEAEKHYQAILEAPPSPVHDLARYKMGWI
                     RVNQAKHAEAVTFFEAAAASAPLPGVDVKKALNVKREALLDLVYSYTEAKPPKGALNY
                     FEKLSDSRATYALALDKLGNRYFIKQQYEWAIPALRKLMELQHDPELDLERGQKLYDA
                     IKASKGKVLPDPEDLRILVRAAVQSKKDPELTEAERKKHLVELEEMARDLSTLLHVEA
                     QKKNDKALYVSAADAYQTYLGLFRPQQHVRTMMKNRADALFSANEYPEAARQFEELAR
                     YHVKAKDAKGEEEALNAALLAHFSTLKPEEAQKRNAFEVADARQAMKLLGAEFVSRFP
                     RSGNALVVKFNIARAYYEDGEYPKAAELFTAFALSHPQHKDAPVAGNLALDSLRQLND
                     FKGLDATGKKLLGAPLPASFRADVQKILTQSRAEALDELALQSAQETGDVIQGLVKVA
                     DENKNSDIGEKALYGAFTAAREKRDMQAERELGAKLVKDYPKSQYLSDVLLTLGRHAA
                     EAAAFGEAAGWFEQVGQKLGGDFAAVDGWLAGARLRLALGEYKEAARDLEAATDIAGA
                     RKAEILVLLAETRLKQKDYARAKTAAEAALKLDRHSAAAAAVLAEVQATTAPTAPADA
                     LIATLTTAVQGPNGGTEEAAKGLWYLGEILYRGYKDLPADQVEEKVAALQSMEGIYTQ
                     AASLGYAEWAVASLWKLALAYGHIADVVEGTALPAGLSSAEAQQFRAAVKEQVTPLKA
                     RSEEAFKACLSRAESLEVFSAAVVGCRARSETAALPVPQPGAPTQPASLEELRKKAER
                     TLNVESLEALGLAYLDARQYGMAQLTFGRVTELQDTRASAHSALGLALLHMGDAMGAR
                     EAYGRAMDSDPTFGKARLNLAALRCRFGDVDGARRELAVLKDVASLAGNDVDGGWKAC
                     K"
     misc_feature    518688..519005
                     /locus_tag="LILAB_02175"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(518688..518693,518700..518705,518823..518828,
                     518832..518837,518844..518849,518925..518930,
                     518937..518942,518949..518954)
                     /locus_tag="LILAB_02175"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(518697..518699,518733..518735,518745..518747,
                     518754..518756,518832..518834,518868..518870,
                     518880..518882,518889..518891,518934..518936,
                     518970..518972,518982..518984,518991..518993)
                     /locus_tag="LILAB_02175"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    520974..521174
                     /locus_tag="LILAB_02175"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    520980..521240
                     /locus_tag="LILAB_02175"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(520980..520985,520989..520994,521001..521006,
                     521091..521096,521100..521105,521112..521117,
                     521193..521198,521205..521210,521217..521222)
                     /locus_tag="LILAB_02175"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(520998..521000,521034..521036,521046..521048,
                     521055..521057,521100..521102,521136..521138,
                     521148..521150,521157..521159,521202..521204,
                     521238..521240)
                     /locus_tag="LILAB_02175"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            521318..521812
                     /locus_tag="LILAB_02180"
                     /db_xref="GeneID:10874896"
     CDS             521318..521812
                     /locus_tag="LILAB_02180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663441.1"
                     /db_xref="GI:338530107"
                     /db_xref="GeneID:10874896"
                     /translation="MRPARASWLGVLLAAALCACGGEGGRLEGSVTSLIDLRYDRAEA
                     QLAEGELAVNFVTQQGTGTNTVLKVSARVADMIPEGYTGSLDVNLAEVLDSGAQRGAI
                     GRNVLDEPARTFPALRVGGLKVKALPSQQGQRISGEFHVTFENGTHTYSGRTIFGSFE
                     ATVP"
     gene            521809..522444
                     /locus_tag="LILAB_02185"
                     /db_xref="GeneID:10874897"
     CDS             521809..522444
                     /locus_tag="LILAB_02185"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663442.1"
                     /db_xref="GI:338530108"
                     /db_xref="GeneID:10874897"
                     /translation="MKRFVLLTLPLLSACGPSYNLRVPDSLEKKLPYEARIELLEAEN
                     NLALAIDKVDEADNEIGRARDHIRRARSRQEAAEDEVDRASDEVSREVAKLAIAEAEA
                     RVEYLRARQRLSVGLRDVERLALRCAFAEFELARLHAARKAKVEGSERLDQQEFEEQV
                     SECKAEVKEERASLAGDEKEEKTAREAWEAKKAALAKKTFDARASPYVENL"
     misc_feature    521908..>522375
                     /locus_tag="LILAB_02185"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     gene            522445..524364
                     /locus_tag="LILAB_02190"
                     /db_xref="GeneID:10874898"
     CDS             522445..524364
                     /locus_tag="LILAB_02190"
                     /note="COG0457 FOG: TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663443.1"
                     /db_xref="GI:338530109"
                     /db_xref="GeneID:10874898"
                     /translation="MKTASFLVLQLLTAQAAEPDTATLERTAAVESARLEDSPDDADA
                     LYRLGTAFLALNTPKKAVAPLKKLVAQEPDLIPPKLALARALRLSGEPEQAREVLDTA
                     IAAFPEESTLRAERGLLARVLDERDVAISQYAVAVELSPQDAELRFNLGEALQRASRT
                     DDAIEAYREALKLDGKLNVARVNLGKALAEKGLNGEAKETLREATRQKLGDTEAHYNL
                     GVLLMRENDLDGAIAEYQRTLAADPKHASAHNNMGVALNEKGDPRKATQAFLKAIAAD
                     PKFAEAHFNLGLAYYQLGDNVRALKAFEKAVVLEPRRSSGPYTQLGHLYLTQGKKKQA
                     VEAYKKAIEKSAEDRRKTTEAYQGLARAWLSLGKADEAVATLKTAVEAFPEDASARAA
                     YGDALRAKGDLDGAIAEYEEGVKLAPTPENRLALADVYAQKRVSAKARPLYQALLDEE
                     PGNRAARLALADLLLAMGDYVTAEGLLKPKDGEEADTAALARLGIVHSRRGRPDLAVS
                     ELEAVVAKDPAQLDARAELGFIYLRGGDGAKARKVLTSVLSVDPRHTLGLLYMGHTLY
                     QQGNTKGAEKSFRDAVQVDPNFAEPHNALGQLLEATKRVDEAKEAYKMAVQLQPDHSD
                     ARDALKRLTASAPTP"
     misc_feature    <522547..522768
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(522580..522585,522589..522594,522601..522606,
                     522682..522687,522694..522699,522706..522711)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(522589..522591,522625..522627,522637..522639,
                     522646..522648,522691..522693,522727..522729,
                     522739..522741,522748..522750)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    522682..522966
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(522682..522687,522694..522699,522784..522789,
                     522793..522798,522805..522810,522886..522891,
                     522898..522903,522910..522915)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(522691..522693,522727..522729,522739..522741,
                     522748..522750,522793..522795,522829..522831,
                     522841..522843,522850..522852,522895..522897,
                     522931..522933,522943..522945,522952..522954)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    522811..523599
                     /locus_tag="LILAB_02190"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    522886..523176
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(522886..522891,522898..522903,522988..522993,
                     522997..523002,523009..523014,523090..523095,
                     523102..523107,523114..523119)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(522895..522897,522931..522933,522943..522945,
                     522952..522954,522997..522999,523033..523035,
                     523045..523047,523054..523056,523099..523101,
                     523135..523137,523147..523149,523156..523158)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    523081..523377
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(523081..523086,523090..523095,523102..523107,
                     523192..523197,523201..523206,523213..523218,
                     523294..523299,523306..523311,523318..523323)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(523099..523101,523135..523137,523147..523149,
                     523156..523158,523201..523203,523237..523239,
                     523249..523251,523258..523260,523303..523305,
                     523339..523341,523351..523353,523360..523362)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    523396..523701
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(523399..523404,523411..523416,523513..523518,
                     523522..523527,523534..523539,523615..523620,
                     523627..523632,523639..523644)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(523408..523410,523444..523446,523456..523458,
                     523465..523467,523522..523524,523558..523560,
                     523570..523572,523579..523581,523624..523626,
                     523660..523662,523672..523674,523681..523683)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    523504..523698
                     /locus_tag="LILAB_02190"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    <523900..524100
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(523915..523920,523924..523929,523936..523941,
                     524017..524022,524029..524034,524041..524046)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(523924..523926,523960..523962,523972..523974,
                     523981..523983,524026..524028,524062..524064,
                     524074..524076,524083..524085)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    524020..524307
                     /locus_tag="LILAB_02190"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(524020..524022,524029..524034,524119..524124,
                     524128..524133,524140..524145,524221..524226,
                     524233..524238,524245..524250)
                     /locus_tag="LILAB_02190"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(524026..524028,524062..524064,524074..524076,
                     524083..524085,524128..524130,524164..524166,
                     524176..524178,524185..524187,524230..524232,
                     524266..524268,524278..524280,524287..524289)
                     /locus_tag="LILAB_02190"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    524116..524304
                     /locus_tag="LILAB_02190"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            complement(524503..525333)
                     /locus_tag="LILAB_02195"
                     /db_xref="GeneID:10874899"
     CDS             complement(524503..525333)
                     /locus_tag="LILAB_02195"
                     /note="COG0697 Permeases of the drug/metabolite
                     transporter (DMT) superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663444.1"
                     /db_xref="GI:338530110"
                     /db_xref="GeneID:10874899"
                     /translation="MLVLSSAFLHAAWSALLKRHPNPEVGVVSVISVVILASGLWALG
                     MRGPAFPRVEGLAWALWAGVCESVYLAGLARSLRQAPLGLAYTVSRGGAMLLVWPVSV
                     MWLGEAVSAWTVSGVALLCVGLAVMNLSRPAGPTGAGVAWAALSAVGIAGYHLSYKMA
                     LEVGAQPPALFATGLLVALPVLILERGRQQGWTALRRELSLAPGLVLTAGVISALSFG
                     LLLTALAGGGAGAVLTLRNTSIAFALALAALQGERLGRRRLSGAALVAVGAVLLGVPA
                     "
     misc_feature    complement(524518..525330)
                     /locus_tag="LILAB_02195"
                     /note="phosphonate utilization associated putative
                     membrane protein; Region: phn_DUF6; TIGR03340"
                     /db_xref="CDD:234171"
     misc_feature    complement(524944..>525150)
                     /locus_tag="LILAB_02195"
                     /note="Small Multidrug Resistance protein; Region:
                     Multi_Drug_Res; cl00910"
                     /db_xref="CDD:260691"
     gene            complement(525527..525997)
                     /locus_tag="LILAB_02200"
                     /db_xref="GeneID:10874900"
     CDS             complement(525527..525997)
                     /locus_tag="LILAB_02200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663445.1"
                     /db_xref="GI:338530111"
                     /db_xref="GeneID:10874900"
                     /translation="MGHGAHGAGLTTRLPTPLRVGWTVVASSPGQVRLVADVERLAGF
                     AAPVEVRLSLPAGVTLMEGAATFTVPAGAAEGGYSATYVVAFDTGRPPMDDLVLVARS
                     EGAGFGVHAEARHVFGRALVMTPPQPVPRGPELPAALMTGAGRPRGAPDSDEEP"
     gene            complement(526416..528053)
                     /locus_tag="LILAB_02205"
                     /db_xref="GeneID:10874901"
     CDS             complement(526416..528053)
                     /locus_tag="LILAB_02205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663446.1"
                     /db_xref="GI:338530112"
                     /db_xref="GeneID:10874901"
                     /translation="MRFEAAVLCLGILVLACGPERDAPPCDAACAPEDAVCRARACAS
                     TFPDEALRAAVDCASMPAGGRCLGTRIVERCVDGVRLQEDCGVTDACVVAEGGAHCAV
                     GAACMEGGTRCSADGALQGCVQGQWRARECAAGCVETGGRGWCGAPGPTLSGTVRYER
                     RFPDATFSGWSAEPEWVPAGGFLVASFQGTALVDLQVSGWDGRFSVRVAAQAGVDDRI
                     VVYAAGLGSASRVAFAVADPGLRGARQVTEAPGGGARLWRWSLATRTVAERGVFSIPE
                     AEGSGAAAVFSALRIAWDEARLRYGREGLPVVAWLGFGTTWSCGACFAEWPVTAAGRT
                     WASQVWLPGDGDAAWWSEAMVLHELGHWVMASHGTSPDEGGPHYLGVPTFPGQAWSEG
                     WATWFSSDVRGSSRYYDRQGGTMFWMDLDARRPAAGAWTRPRPEDGLLQKLEASEVAA
                     ILYRLGKGTPSRQPLYAALAAPEMNAAPWRRGYQRHQWRVEAGQVVDVARTDLPSPCL
                     ADFLDTMMCQGFPRWVMDAATEPESAYPYPSHSPLCR"
     misc_feature    complement(<527130..527369)
                     /locus_tag="LILAB_02205"
                     /note="magnesium chelatase ATPase subunit D; Region:
                     BchD-ChlD; TIGR02031"
                     /db_xref="CDD:233692"
     gene            complement(528287..529090)
                     /locus_tag="LILAB_02210"
                     /db_xref="GeneID:10874902"
     CDS             complement(528287..529090)
                     /locus_tag="LILAB_02210"
                     /note="COG4559 ABC-type hemin transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter ATP-binding protein"
                     /protein_id="YP_004663447.1"
                     /db_xref="GI:338530113"
                     /db_xref="GeneID:10874902"
                     /translation="MSLEVRGIEVWRGRGRTLGPMDLTLRPGEVLAVVGPNGAGKSTL
                     LSAMSGELKCSTGEVVLDGVPLSRWKPRERALRLGVLPQESSLGFGFTALEVALLGRS
                     PHASRAEGSADLAAAVAALDATDTRHLASRSYLTLSGGERQRVQLARVLAQLSEPVPS
                     GHRYLLLDEPTASLDLSHQHLVLEAAARFAQEGGAVLAVLHDLNLAARYAHRLAVLAG
                     GHVVEVGAPASVLTQELVARVFGLRVQVVEWPGSPGPLVIPEGRAPLSP"
     misc_feature    complement(528314..529090)
                     /locus_tag="LILAB_02210"
                     /note="hemin importer ATP-binding subunit; Provisional;
                     Region: hmuV; PRK13548"
                     /db_xref="CDD:237422"
     misc_feature    complement(528416..529081)
                     /locus_tag="LILAB_02210"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    complement(528965..528988)
                     /locus_tag="LILAB_02210"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(order(528488..528490,528584..528589,
                     528842..528844,528962..528970,528974..528979))
                     /locus_tag="LILAB_02210"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(528842..528853)
                     /locus_tag="LILAB_02210"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(528653..528682)
                     /locus_tag="LILAB_02210"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(528584..528601)
                     /locus_tag="LILAB_02210"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(528566..528577)
                     /locus_tag="LILAB_02210"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(528482..528502)
                     /locus_tag="LILAB_02210"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(529087..530094)
                     /locus_tag="LILAB_02215"
                     /db_xref="GeneID:10874903"
     CDS             complement(529087..530094)
                     /locus_tag="LILAB_02215"
                     /note="COG0609 ABC-type Fe3+-siderophore transport system,
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter permease"
                     /protein_id="YP_004663448.1"
                     /db_xref="GI:338530114"
                     /db_xref="GeneID:10874903"
                     /translation="MPLALLLLCVALLSLAVGAVSVPPLALAGSLLEQVGLDLGPRLE
                     SVQQAVLLSIRLPRVTLGIMVGAVLATCGAALQALFRNPLVEPGLLGTSSGAALGAVA
                     AIVLDVALSAHLGSLRMLAVPGAAFAGALGATLLAHRLGGGGGRTETARILLAGVAVS
                     AGAGAGIGLLTQVATDAQLRSITFWTWGSLGGASWDVVGAATPPLLVALGLLLREART
                     LNLLLLGEREAWHLGVDVERLKRRLILAAALGVGAAVSVSGVIAFVGLLVPALLRLAL
                     GPDHRRLLGASALLGASLLVGSDLLARTAAIPAELPVGALTSVLGVPVFIGLLSRKGA
                     A"
     misc_feature    complement(529108..529914)
                     /locus_tag="LILAB_02215"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(529255..529257,529276..529278,
                     529399..529407,529411..529428,529432..529437,
                     529441..529449,529453..529458,529846..529854,
                     529864..529866))
                     /locus_tag="LILAB_02215"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(529108..529110,529117..529122,
                     529129..529131,529138..529143,529150..529152,
                     529306..529308,529534..529536,529543..529548,
                     529579..529581,529588..529593,529600..529602,
                     529609..529614,529621..529626,529633..529638,
                     529642..529644,529828..529830,529843..529845,
                     529849..529851))
                     /locus_tag="LILAB_02215"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(529159..529161,529186..529188,
                     529318..529320,529330..529332,529504..529506,
                     529579..529581))
                     /locus_tag="LILAB_02215"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(530172..531068)
                     /locus_tag="LILAB_02220"
                     /db_xref="GeneID:10874904"
     CDS             complement(530172..531068)
                     /locus_tag="LILAB_02220"
                     /note="COG4558 ABC-type hemin transport system,
                     periplasmic component"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter periplasmic hemin-binding
                     protein"
                     /protein_id="YP_004663449.1"
                     /db_xref="GI:338530115"
                     /db_xref="GeneID:10874904"
                     /translation="MRRASGLSLLFMAMTSLAHAAAPARPQAEAAAKAPVAAAKLVTI
                     GPAITETVFALGAGGQVVGVDDTSLALEVARKSPKVGYQRALSSEAIIALGTSQLLAS
                     EEAGPPGVLEQLKAAGVDVVVLPNKHTVEATRERIRALAKRLGKAEQGEALVKQLDAD
                     LRKAQARTAARKDAKPPRVLALYARGANVLMVAGAGTAAGELVTLSGGVNAIAAYSGH
                     KPLTAEAVVEAAPDFILMPASSLEPVGGEEGLSRTPGLSQARGWRLITVDDVHFMGLG
                     PHLGKAVSRLQDGYASPARDSR"
     misc_feature    complement(530262..530951)
                     /locus_tag="LILAB_02220"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    complement(530295..530948)
                     /locus_tag="LILAB_02220"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    complement(order(530643..530645,530730..530732,
                     530739..530744))
                     /locus_tag="LILAB_02220"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(531068..532153)
                     /locus_tag="LILAB_02225"
                     /db_xref="GeneID:10874905"
     CDS             complement(531068..532153)
                     /locus_tag="LILAB_02225"
                     /note="COG3720 Putative heme degradation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin transport protein HemS"
                     /protein_id="YP_004663450.1"
                     /db_xref="GI:338530116"
                     /db_xref="GeneID:10874905"
                     /translation="MNQTANSDVVSEPVRLRQRWQALRDEQPRTRIRDAAEQLGVSEA
                     QLLATGLGETVVRLDLRLDALLPRIETLGRVMSLTRNAHAVHEKRGTWRNIELHGKQG
                     LVLDEEIDLRLFFSRWTFGFAIREPHGDGLRRSLQFFDASGMAIHKIYVEEAGREETF
                     DALVKEFTHAEQSPRLSVVPATPAAAPRPDSAIDVEGLRSGWRALQDTHEFFALLSRF
                     KVARTQALRLAEPELATAVKPDALTWVLEKVAASALPIMIFVGNPGCIQIHTGPVKNV
                     KAMGPWMNVLDAGFNLHVRADHVHSAWVVRKPTRDGVVTSVELFDEAGENIGLIFGKR
                     KPGVPESQEWRALAEALAQAMPAREVA"
     misc_feature    complement(531101..532105)
                     /locus_tag="LILAB_02225"
                     /note="Putative heme degradation protein [Inorganic ion
                     transport and metabolism]; Region: HemS; COG3720"
                     /db_xref="CDD:226243"
     misc_feature    complement(531653..532036)
                     /locus_tag="LILAB_02225"
                     /note="Haemin-degrading HemS.ChuX domain; Region: HemS;
                     pfam05171"
                     /db_xref="CDD:253058"
     misc_feature    complement(531101..531499)
                     /locus_tag="LILAB_02225"
                     /note="Haemin-degrading HemS.ChuX domain; Region: HemS;
                     pfam05171"
                     /db_xref="CDD:253058"
     gene            complement(532181..532882)
                     /locus_tag="LILAB_02230"
                     /db_xref="GeneID:10874906"
     CDS             complement(532181..532882)
                     /locus_tag="LILAB_02230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663451.1"
                     /db_xref="GI:338530117"
                     /db_xref="GeneID:10874906"
                     /translation="MSRLAPRSSFLGRAVAALLLAGSLSACGDDLELPPDPQNPDPQN
                     PGEQEEDAPVNGTHTTHVANGDGSYTTAVNATGSSEWIGLDLDNGTQVSKETDAAWDV
                     AFQRFNILSRGGVSGSGDVAVAVLTETDFAQVTQAPADGYLVDAEDGEDRGTDPDSAF
                     NVGDGWYAYDMSTHALSARRNVYVVRSDEGAYFKIALQSYYDDAGTPGMLSFRWAKVP
                     APASAGSALAQPSQH"
     misc_feature    complement(532232..532678)
                     /locus_tag="LILAB_02230"
                     /note="Bacterial proteins similar to Porphyromonas
                     gingivalis HmuY; Region: HmuY; cd12105"
                     /db_xref="CDD:213031"
     gene            complement(532925..534910)
                     /locus_tag="LILAB_02235"
                     /db_xref="GeneID:10874907"
     CDS             complement(532925..534910)
                     /locus_tag="LILAB_02235"
                     /note="COG1629 Outer membrane receptor proteins, mostly Fe
                     transport"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TonB dependent receptor"
                     /protein_id="YP_004663452.1"
                     /db_xref="GI:338530118"
                     /db_xref="GeneID:10874907"
                     /translation="MLFAACSLPWAAWGSDSEAPAGEAAATEVTSPGAQSVPAGAHQA
                     APLEPEEVRGARTVVTASRSPERLEDSAVATEVITRADILASGARDASELLAAHPGLQ
                     VTQTFAGATVQLQGLAPEYVLVLVDGERVAGRVAGSVDLSRLSTEDIEQVEVVKGPSS
                     VLYGSDAVAGVVNLITRRARRPLGAELRASYGNMQRLELDATGEAKGEDWGLRLSGGL
                     ARRDAYHLDPASIGTTGSSLDGIDVSAGGDLRTGDSATVQANATYARRVQRGVDVGVT
                     GAIFDRAARDDSLSARLSPRWTLSNGATLRVDGAYAWFNRRYLRDQRRSSALDTIEDT
                     REQQGRLGAQLDAKLGQSHAFVAGAELLGEWLQADRLGEDGRGRRGRVSLYAQDNWTL
                     VPRLKLTLVPGARVDTDTQFGTAVTPRLAARMDPASWLTLRGSYGWAFRAPGFQEMLL
                     DFENPSVGYMVRGNPDLRPERSRSFNLSVEVKPADSSLLWVSAFQHNLQDMIGVSTEM
                     SGPQQLFTYVNIARARVRGGEVGIRQQLPGRVSAELGYTLTDGRAEETGLALEGQARH
                     RLTAQATWRHRVTGLEAWVRGALVGPRPFYPDTDGDGVANPYDAKTYVTVDARLGWRM
                     REELQFFVLGTNLANAGNPTDLPIPPRAIQAGISARL"
     misc_feature    complement(532931..534799)
                     /locus_tag="LILAB_02235"
                     /note="Outer membrane cobalamin receptor protein [Coenzyme
                     metabolism]; Region: BtuB; COG4206"
                     /db_xref="CDD:226664"
     misc_feature    complement(532931..534688)
                     /locus_tag="LILAB_02235"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(534383..534409,534443..534475,
                     534518..534541,534560..534577,534605..534634,
                     534662..534688))
                     /locus_tag="LILAB_02235"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(533915..533917,533996..533998))
                     /locus_tag="LILAB_02235"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(535060..535248)
                     /locus_tag="LILAB_02240"
                     /db_xref="GeneID:10874908"
     CDS             complement(535060..535248)
                     /locus_tag="LILAB_02240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663453.1"
                     /db_xref="GI:338530119"
                     /db_xref="GeneID:10874908"
                     /translation="MRDGCHGEGGARELRCMCGSLLARLVPEGVELKCRRCHRTQVVP
                     LERTPPEGGGAQVGGSGR"
     gene            complement(535360..535998)
                     /locus_tag="LILAB_02245"
                     /db_xref="GeneID:10874909"
     CDS             complement(535360..535998)
                     /locus_tag="LILAB_02245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663454.1"
                     /db_xref="GI:338530120"
                     /db_xref="GeneID:10874909"
                     /translation="MARRRPNFNKTLRSLIRDIAAKMPEFGHVKAGRILVVAGEARRA
                     SRGTVKPLCFRGGKSTDRSGRRKPIIRIRRKRMLYCITLRPLFFRGSTAQARVETVIH
                     ELFHMSRRFDGTLHSGRRHDVLGRNFSRKLKPLVRRYLKLCPPELLASMAHSGEVRIL
                     QWLERPGPAYLPGGSRRVRKVYTEDQLYSGVARMVTPKVRLARDTSARSKVH"
     gene            536067..536897
                     /locus_tag="LILAB_02250"
                     /db_xref="GeneID:10874910"
     CDS             536067..536897
                     /locus_tag="LILAB_02250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663455.1"
                     /db_xref="GI:338530121"
                     /db_xref="GeneID:10874910"
                     /translation="MRLPSPMFRLAVVLSLCVGCASAPTRPSSPATLTAQRTVIASQG
                     LTDATLRYEAEVSSPGEGVVERADYELVADGQVVKTGTAKLGVALTPGTPADISFEER
                     APYVKNAEDLARLSAEQGTLLLALRGTLVVRSGDQEQTIPFAASRATRMPRLPTVVVE
                     ELDGARYSDEEVQLNLRIGVRNPNPFPLRLEGLTWTASVAGKTLDSGTLAHADTVDAS
                     ATGVYPVELAVTKDTWGPEVKALITQGLLPYGVTGEVTGPLLRVPYSLTGEVKLNVSR
                     "
     misc_feature    536595..536870
                     /locus_tag="LILAB_02250"
                     /note="Late embryogenesis abundant protein; Region: LEA_2;
                     pfam03168"
                     /db_xref="CDD:251772"
     gene            536910..537620
                     /gene="aat"
                     /locus_tag="LILAB_02255"
                     /db_xref="GeneID:10874911"
     CDS             536910..537620
                     /gene="aat"
                     /locus_tag="LILAB_02255"
                     /EC_number="2.3.2.6"
                     /note="COG2360 Leu/Phe-tRNA-protein transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl/phenylalanyl-tRNA--protein transferase"
                     /protein_id="YP_004663456.1"
                     /db_xref="GI:338530122"
                     /db_xref="GeneID:10874911"
                     /translation="MPIYLLSDEHPELFPPPERADKSGIVAVGGDLRPERLLAAYARG
                     IFPWYSEGDPILWHSPDPRFVLTPDMLHAGRSLRKAMARGVYEVRYDTAFRRVITECS
                     RVPRPGQSGTWITDEMMEAYVTLHEAGFAHSVEAWAEGELKGGLYGVSLGAAFFGESM
                     FALAPDASKVAFVTSVERFRDWGFQLIDCQVETEHLARFGAVNWPRKRFLAALAKALK
                     EPTRRGKWTALSKSAGPL"
     misc_feature    536910..537593
                     /gene="aat"
                     /locus_tag="LILAB_02255"
                     /note="leucyl/phenylalanyl-tRNA--protein transferase;
                     Reviewed; Region: aat; PRK00301"
                     /db_xref="CDD:234720"
     gene            537674..538459
                     /locus_tag="LILAB_02260"
                     /db_xref="GeneID:10874912"
     CDS             537674..538459
                     /locus_tag="LILAB_02260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663457.1"
                     /db_xref="GI:338530123"
                     /db_xref="GeneID:10874912"
                     /translation="MRWSSTLLLPLCLATTACGTSAKHQALIERRDAIRLADAEREQG
                     AREQYRSDTGFQDTRWGMTRSEALAVLPAHARLIGAWEDVHVTDVVAGHPADIYYVFA
                     EGQLAAVTLSFRAPGAVRGNFDSVAELLTRKYGKPEAMEDSARDAESRLALAQMSNNL
                     SEASANYHAWRSGVRPSGPAVDNFGRQLEANARTDAALAHYDYLLQGLWKDADTELRL
                     TGSQAPGARSLMLTYTSLRLQPYLAKELAVRDEQRKVEQSREL"
     gene            complement(538523..539518)
                     /locus_tag="LILAB_02265"
                     /db_xref="GeneID:10874913"
     CDS             complement(538523..539518)
                     /locus_tag="LILAB_02265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663458.1"
                     /db_xref="GI:338530124"
                     /db_xref="GeneID:10874913"
                     /translation="MHLVVRLTTQALAWSLTLLPLAASAQFDDVDSFPSAEPERGCPK
                     RPDIVPFTARNLVGLSGAGWLAHQAVIPEAKDRYFSEAERDRSGVKLVPAEDDVRKLG
                     APDPAVPLWVFGKADAAPCRAVPVVWWAVRMGTDADRKTYLMSELQVECDVLPPGRLS
                     GTPVALRQKDAPTGCKLRRPDDNANSAEGRGLPLELADVLPARACEAPECERKWEIFS
                     SRWDDGSAVFDIAASWMKRDGKKDPCEWATEDYTTLLLRPAGALAPVPLRSGGAFFGA
                     LYDSTGLRTVLSRDMGTLNVHDAARPKAAPKTVRYGSPTEEELLNAKRTLSPCKK"
     gene            complement(539622..540329)
                     /locus_tag="LILAB_02270"
                     /db_xref="GeneID:10874914"
     CDS             complement(539622..540329)
                     /locus_tag="LILAB_02270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663459.1"
                     /db_xref="GI:338530125"
                     /db_xref="GeneID:10874914"
                     /translation="MDLSVPLEPKKERFHKLDTVDWVQVEDASVAEAELLPGSNELLL
                     TGQKEGRTLLLLYAGGRFAVWRLTVGSPPPEDAAPRLAAARKACPDLNATTGAGRSLS
                     ASVKDSKCRLALLELLKTDAFMARDLALTFDVAILQEQLASVGEGLEPLGLEASYSGA
                     GVVVSGSASPEVHRKALWELFFRSVGRVPLNDQIEEVKPPEPSDAGAPDAAVPAVAPA
                     REIPVEVLPLPTKPRKR"
     misc_feature    complement(540120..>540263)
                     /locus_tag="LILAB_02270"
                     /note="Pilus formation protein N terminal region; Region:
                     T2SS-T3SS_pil_N; pfam13629"
                     /db_xref="CDD:257939"
     gene            540456..541808
                     /locus_tag="LILAB_02275"
                     /db_xref="GeneID:10874915"
     CDS             540456..541808
                     /locus_tag="LILAB_02275"
                     /note="COG4536 Putative Mg2+ and Co2+ transporter CorB"
                     /codon_start=1
                     /transl_table=11
                     /product="CBS/transporter associated domain-containing
                     protein"
                     /protein_id="YP_004663460.1"
                     /db_xref="GI:338530126"
                     /db_xref="GeneID:10874915"
                     /translation="MPTWTLWVACLALSFVRALVAASESALYGVSDLRAQELADSQPG
                     RATRRVLRHKTDREPVATALRLGMVLSGFQAAAIGAFVPPRMLDFSRYGDAEWLPVAT
                     VAAGALLVGVLATLMEVTMRGLANGSPERWALRLSGFTALLVTVLYPPMRVAMALLNL
                     MARTFGRTLRFEPPPPPLEELEKLLAAQAAKNEVDKSAPQLIRSIFELSDKRCRDVMV
                     PRTEVVTVDITVDTDELLRLLAEENHSRIPVYRDDVDHVIGVLHARDIIPLLQHPELI
                     VLHDIIRPAHFVPWMKPIGDLLRDMQKQKIHMAIVVDEYGGFMGVVTLEDILREIVGD
                     IGDEFEVEEKQVEKLADGSFLVDAALEVDAFTQSFGFPLPEGDFDTLGGFLSSMAGHL
                     PDVGERFAYNGWQFVVASKEGPRIDRVRMSRGKSGITKDARDGLAREPGREEQATAKS
                     "
     misc_feature    540456..541730
                     /locus_tag="LILAB_02275"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    540468..540959
                     /locus_tag="LILAB_02275"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    541116..541445
                     /locus_tag="LILAB_02275"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    541494..541724
                     /locus_tag="LILAB_02275"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            complement(541849..542691)
                     /locus_tag="LILAB_02280"
                     /db_xref="GeneID:10874916"
     CDS             complement(541849..542691)
                     /locus_tag="LILAB_02280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663461.1"
                     /db_xref="GI:338530127"
                     /db_xref="GeneID:10874916"
                     /translation="MGVVGLAALLLSHTGCSTTSEYVRGPRLREVPLGETHRDTLESV
                     VDASYVGRVAVKRTTCTEVSTEFSKNRIDTTTSPPMDSLLAGLAMLGGGGLLMSMSDG
                     ESEDEDIDLPMTLGVVLALASIYPLVTALTDEDVTRAEVATGEVEAERSQRCEDRTFA
                     LSGPLHWSVSLGAAKRTGRTGKDGAVALRQPLSELVEQAITDEASVRRLVAGRGIGFR
                     LELERAPAADFRLDSKALPDSYFRRFADAYGRQLGGGERARFENCELIGKSARETLEC
                     YWSQ"
     gene            complement(542693..543244)
                     /locus_tag="LILAB_02285"
                     /db_xref="GeneID:10874917"
     CDS             complement(542693..543244)
                     /locus_tag="LILAB_02285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663462.1"
                     /db_xref="GI:338530128"
                     /db_xref="GeneID:10874917"
                     /translation="MLPISLGVLSAASALAAEKSPPPGPPAPTRKVDPTKAQTEEWLR
                     EHIEAWNDSEVHVTVKDCRVMVLDKPRERTEIVDLRGLLLPIEVIRLNGGNDATLRLR
                     VKQKHTGTYSMFRKCSAENRYCAEPTGKFQSLPYVDLSVTSVRDFVPGRQTDVDKSLR
                     LERALEHYSKLCGAMEDARNRLF"
     gene            complement(543365..543850)
                     /locus_tag="LILAB_02290"
                     /db_xref="GeneID:10874918"
     CDS             complement(543365..543850)
                     /locus_tag="LILAB_02290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663463.1"
                     /db_xref="GI:338530129"
                     /db_xref="GeneID:10874918"
                     /translation="MRSRRAVVFLGLLAGGLAASGCLGSVPFRPRAYEEAVRVASFQV
                     DFRQDGTGVLDLDLRVTNPASDAATLAAVDFTLRVDGRRVAVGTQQVAAPLAEDGSAP
                     LRVLFPLASARATGGPEPVPRRVQVEGGVVLRFGGTERRAPFQAERVLPLAWVPPLSG
                     D"
     misc_feature    complement(543419..543682)
                     /locus_tag="LILAB_02290"
                     /note="Late embryogenesis abundant protein; Region: LEA_2;
                     pfam03168"
                     /db_xref="CDD:251772"
     gene            complement(543852..544766)
                     /locus_tag="LILAB_02295"
                     /db_xref="GeneID:10874919"
     CDS             complement(543852..544766)
                     /locus_tag="LILAB_02295"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine/threonine protein kinase"
                     /protein_id="YP_004663464.1"
                     /db_xref="GI:338530130"
                     /db_xref="GeneID:10874919"
                     /translation="MADAPDLGGYEVVGRLAVGGMAEVYQARARVTTQRSPGEPDEIV
                     IKRLHPSFRSDTAYVKAFVDEAKLTVRLRHPNIVRTYRLFKAGPDYLMVQELVSGRTL
                     GYMQELLLKAGAAMPPESACYIAWCLLKALDYIHRAKVGENGATIVHRDVNPANLLLG
                     INGDVKLTDFGVAEVEGMMRGDAGALRGTLPYMSPEQVLGLPVDARTDLYAVGIILWE
                     LWSGRRLFAGEHEAELMHKVRDARVPLLTSSPELPDYAVQVARKALFADRARRFQTAA
                     EFIKALESLSRRAGWPLTVEALQPLLGG"
     misc_feature    complement(543927..544739)
                     /locus_tag="LILAB_02295"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(544110..544712)
                     /locus_tag="LILAB_02295"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(544194..544205,544251..544253,
                     544260..544262,544293..544295,544299..544304,
                     544308..544310,544314..544316,544449..544451,
                     544464..544466,544476..544487,544533..544535,
                     544629..544631,544635..544637,544695..544697,
                     544707..544712))
                     /locus_tag="LILAB_02295"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(544260..544262,544293..544295,
                     544299..544304,544308..544310,544314..544316,
                     544464..544466,544476..544487,544533..544535,
                     544629..544631,544635..544637,544695..544697,
                     544707..544712))
                     /locus_tag="LILAB_02295"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(544194..544205,544251..544253,
                     544302..544304,544308..544310,544314..544316,
                     544449..544451,544464..544466,544707..544709))
                     /locus_tag="LILAB_02295"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(544194..544205,544245..544265))
                     /locus_tag="LILAB_02295"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(544802..546235)
                     /locus_tag="LILAB_02300"
                     /db_xref="GeneID:10874920"
     CDS             complement(544802..546235)
                     /locus_tag="LILAB_02300"
                     /note="COG0297 Glycogen synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase"
                     /protein_id="YP_004663465.1"
                     /db_xref="GI:338530131"
                     /db_xref="GeneID:10874920"
                     /translation="MNVLFISSEVAPFSKTGGLGDVAGALPAALASLGHDVKVITPRY
                     RDMRGAEQLVPTGQSLLLRFPFGELSGPILSARVSERLEVLFLENAFLFGNRHGLYGD
                     AWGAYADNHRRFAYLSVGALQAAQRLRFIPDVVHANDWQAGLSPVALRRGFQAGPLAQ
                     AKSVFTIHNLAYQGQFPKDVMGDLGLPWDLFTAHDGLEFHDTVNFLKAGLVFSDALTT
                     VSPTYAKEIQTPEQGYGLEGLLRHRAHRLHGILNGVDTHEWNPEDDAHLPARYGLKDL
                     TGKAVCKRELLARFGLEDGPAPVFGFVSRLAWQKGVDLLLEALPTALHADLRVVGVGS
                     GEGPLEEGLLALQARYPKQVGVHLGFDPALSHLVEAGADFFLMPSRYEPCGLNQMYSL
                     RYGTVPIVRATGGLVDTVEGGLDGNGILFEAFHKSALLAAIRRALALYADPPRLDEFR
                     RRGMEKDFSWGASGRRYEALFHDLMAE"
     misc_feature    complement(544808..546235)
                     /locus_tag="LILAB_02300"
                     /note="glycogen synthase; Provisional; Region: glgA;
                     PRK00654"
                     /db_xref="CDD:234809"
     misc_feature    complement(544817..546232)
                     /locus_tag="LILAB_02300"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. Glycogen synthase
                     catalyzes the formation and elongation of the
                     alpha-1,4-glucose backbone using ADP-glucose, the second
                     and key step of glycogen biosynthesis. This family...;
                     Region: GT1_Glycogen_synthase_DULL1_like; cd03791"
                     /db_xref="CDD:99965"
     misc_feature    complement(order(545075..545077,545090..545092,
                     545141..545143,545156..545161,545321..545329,
                     546182..546184,546191..546193))
                     /locus_tag="LILAB_02300"
                     /note="ADP-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99965"
     misc_feature    complement(order(544943..544945,545006..545008,
                     545012..545017,545030..545032,545561..545563))
                     /locus_tag="LILAB_02300"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99965"
     gene            546302..546898
                     /locus_tag="LILAB_02305"
                     /db_xref="GeneID:10874921"
     CDS             546302..546898
                     /locus_tag="LILAB_02305"
                     /note="COG0259 Pyridoxamine-phosphate oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="YP_004663466.1"
                     /db_xref="GI:338530132"
                     /db_xref="GeneID:10874921"
                     /translation="MLHRVMIPPDPIQRFAELFARAKQAIPVDPNAMVVATVGDDGRP
                     SARVVLLKDFDARGFVFYTNHESRKGREALAHPYVALCFYWQPLNEQVRVEGRVERVT
                     DAEADAYFQSRPRGSQVGAWASLQSQPLPSREDLVARVAEVEQKYAGQPVPRPPHWSG
                     LRVVPDRIEFWHAQESRLHDRHVYLREDGGWRTERLYP"
     misc_feature    546329..546895
                     /locus_tag="LILAB_02305"
                     /note="pyridoxamine-phosphate oxidase; Region: pdxH;
                     TIGR00558"
                     /db_xref="CDD:211586"
     misc_feature    546386..546616
                     /locus_tag="LILAB_02305"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_oxidase; pfam01243"
                     /db_xref="CDD:250471"
     misc_feature    546773..546895
                     /locus_tag="LILAB_02305"
                     /note="Pyridoxine 5'-phosphate oxidase C-terminal
                     dimerization region; Region: PNPOx_C; pfam10590"
                     /db_xref="CDD:256075"
     gene            complement(546912..547475)
                     /locus_tag="LILAB_02310"
                     /db_xref="GeneID:10874922"
     CDS             complement(546912..547475)
                     /locus_tag="LILAB_02310"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="CsgA protein"
                     /protein_id="YP_004663467.1"
                     /db_xref="GI:338530133"
                     /db_xref="GeneID:10874922"
                     /translation="MKHKAGNRLRIHALDVGDDASVRAFATNVCTSPVDVLINNAGVA
                     GLWCALSDVDYADMARTFTINALGPLRVTNAMLPGLRRGALRRVAHVTSRMGSLAENT
                     DGGAYAYRMSKAALNMAVRTLSTDLRPEGFVTVLLHPGWVQTDMGGPDATLPAPDSVR
                     GMLRVIDGLSPEHSGRFFDYQGAEVPW"
     misc_feature    complement(<547038..>547472)
                     /locus_tag="LILAB_02310"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    complement(546915..547466)
                     /locus_tag="LILAB_02310"
                     /note="carbonyl reductase sniffer-like, classical (c)
                     SDRs; Region: carb_red_sniffer_like_SDR_c; cd05325"
                     /db_xref="CDD:187586"
     misc_feature    complement(order(547035..547040,547044..547046,
                     547050..547064,547137..547139,547149..547151,
                     547197..547205,547284..547286,547347..547358,
                     547428..547433))
                     /locus_tag="LILAB_02310"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187586"
     misc_feature    complement(order(546915..546920,547098..547103,
                     547110..547115,547119..547124,547131..547136,
                     547143..547148,547155..547157,547173..547193,
                     547251..547256,547263..547265,547272..547280,
                     547287..547289,547302..547304,547410..547412,
                     547428..547430))
                     /locus_tag="LILAB_02310"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187586"
     misc_feature    complement(order(547137..547139,547149..547151,
                     547197..547199,547281..547283))
                     /locus_tag="LILAB_02310"
                     /note="active site"
                     /db_xref="CDD:187586"
     gene            547822..549099
                     /locus_tag="LILAB_02315"
                     /db_xref="GeneID:10874923"
     CDS             547822..549099
                     /locus_tag="LILAB_02315"
                     /note="COG1232 Protoporphyrinogen oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_004663468.1"
                     /db_xref="GI:338530134"
                     /db_xref="GeneID:10874923"
                     /translation="MGTHARAGYLVEQGPNSFLDREPATRALAAALNLEGRIRVADAS
                     AKRRYVYTRGRLRSVPASPPAFLTSDILPLGARLRVMGELFSSRAPEGTDESLAAFGR
                     RHLGPVATRVLLDAVQTGIYAGDVERLSVEATFPLLVKLEREHRSLILGAIHAQKAQA
                     RAKALLPPGDAPKLTGALSTFDGGLQVLIDALASSLGDAAHVGARVEGLTRVDGGWRL
                     AVEEHGQRAELSASHVVLAVPAHVAAELLQPLDDALAAQVSRIEYAPIAVVHLGFDAG
                     TLPAPDGFGFLVPFEEQRRLLGAIHASTTFPFRVEGGRVLYTCMVGGARQPDLVQRDE
                     AELAALALEELRALAGVTARPTFTQVFRWPRGIPQYNVGHLERMAGIDAALQRWPGLH
                     LAGNAYKGIGLNDCIRNAARLAAALSDEENVRK"
     misc_feature    547828..549042
                     /locus_tag="LILAB_02315"
                     /note="protoporphyrinogen oxidase; Reviewed; Region:
                     PRK11883"
                     /db_xref="CDD:237009"
     misc_feature    <548386..548928
                     /locus_tag="LILAB_02315"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            549215..549337
                     /locus_tag="LILAB_02320"
                     /db_xref="GeneID:10874924"
     CDS             549215..549337
                     /locus_tag="LILAB_02320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663469.1"
                     /db_xref="GI:338530135"
                     /db_xref="GeneID:10874924"
                     /translation="MFALPSPVLVVAAIVLFPVLLAGSMLLDAFETELEERPAR"
     gene            549369..550433
                     /locus_tag="LILAB_02325"
                     /db_xref="GeneID:10874925"
     CDS             549369..550433
                     /locus_tag="LILAB_02325"
                     /note="COG3275 Putative regulator of cell autolysis"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase family protein"
                     /protein_id="YP_004663470.1"
                     /db_xref="GI:338530136"
                     /db_xref="GeneID:10874925"
                     /translation="MPETSSEGSIVRATLRALVAPRRLLPILVVSVALMTAQVRFSPT
                     PLWVAFGLGLQMCLLFVAVAPVSYRVLFPEGLDFSHGGIRLLLYATVGSGVVLTSGFV
                     VPKLLGLGPTFLTQPTNLAVCGALFLVGGWGLGRDIGFEESLGRERARAARFALEAEQ
                     AQLLALRSHLDPHFLFNTLNAIAEWCREDGAVAEAAVLRLSTMLRSVLAGVRSATWPL
                     AQELELIRTLFELHLLRDPDLFQLTLNVPADVGEIPVPPLVLLPLAENAVKHGPAAGH
                     RGPLSLDVTARGHEVEVAIENPGPSRGPREGSAGLPTVERRLALAYGSAARLVLDGRE
                     ARTRVAVTLPRAGPQPGVLT"
     misc_feature    549852..550100
                     /locus_tag="LILAB_02325"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    550161..550406
                     /locus_tag="LILAB_02325"
                     /note="Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; Region: HATPase_c; pfam02518"
                     /db_xref="CDD:251347"
     gene            550430..551203
                     /locus_tag="LILAB_02330"
                     /db_xref="GeneID:10874926"
     CDS             550430..551203
                     /locus_tag="LILAB_02330"
                     /note="COG3279 Response regulator of the LytR/AlgR family"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_004663471.1"
                     /db_xref="GI:338530137"
                     /db_xref="GeneID:10874926"
                     /translation="MSVPLRVLIADDELLARKRLTRLLAALPDTQVCGEASDTEGVLA
                     AVRAGGVDVVLLDIHMPGLSGLDALALLPEGGHRVILCTAHAEHAVQAFEHGAVDYVL
                     KPVEPARLQKALERARARAPVAPPSVSGPPKLSPAPARSLGRLPIPTRQGIVLVDPEA
                     ISHAALEDELVTVFTTQGDFLTDFTLNELVEKLPSEHFHRVHRRALLNLTHVARLEPL
                     DTGGYLARTLRGHAVEVSRQSARELRRMLGLRRGVEEEG"
     misc_feature    550442..551179
                     /locus_tag="LILAB_02330"
                     /note="putative two-component response-regulatory protein
                     YehT; Provisional; Region: PRK11697"
                     /db_xref="CDD:236956"
     misc_feature    550451..550780
                     /locus_tag="LILAB_02330"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(550460..550465,550598..550600,550622..550624,
                     550676..550678,550727..550729,550736..550741)
                     /locus_tag="LILAB_02330"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    550598..550600
                     /locus_tag="LILAB_02330"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(550607..550612,550616..550624)
                     /locus_tag="LILAB_02330"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    550736..550744
                     /locus_tag="LILAB_02330"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    550883..551167
                     /locus_tag="LILAB_02330"
                     /note="LytTr DNA-binding domain; Region: LytTR;
                     smart00850"
                     /db_xref="CDD:197918"
     gene            complement(551254..552021)
                     /locus_tag="LILAB_02335"
                     /db_xref="GeneID:10874927"
     CDS             complement(551254..552021)
                     /locus_tag="LILAB_02335"
                     /note="COG0823 Periplasmic component of the Tol biopolymer
                     transport system"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663472.1"
                     /db_xref="GI:338530138"
                     /db_xref="GeneID:10874927"
                     /translation="MWMASSLLLAACGGAEAESLADAESQAVASQSLGGPSEESADRR
                     IIVYQTTSLQLMRVDNQGRSHLVAERTGAPVVSPDGNRAAYAKLPDGHRPGDLVRSSD
                     LYVLNANSGKSTRVTQGFDDSEPVWTPDGRVVLFQSTSRTGVPSLWRVKQNGKDLTQL
                     TNVGTSQFSSAYIPNPALGGTVEWDADRRIIVYTTTSLRQGEDGEVRIIAFDRDYDVA
                     SAYSLGKGSEASWTERGTVVYSRNEGGRVVTVEARVP"
     misc_feature    complement(551575..551682)
                     /locus_tag="LILAB_02335"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     gene            complement(552219..553565)
                     /locus_tag="LILAB_02340"
                     /db_xref="GeneID:10874928"
     CDS             complement(552219..553565)
                     /locus_tag="LILAB_02340"
                     /note="COG1882 Pyruvate-formate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_004663473.1"
                     /db_xref="GI:338530139"
                     /db_xref="GeneID:10874928"
                     /translation="MARKGLLVEAAAIYDDLSRQNPNDGELVLVRDNLRLRALTRLLS
                     DARRARVEGRDEDAEDSLLRFLNHRAEWNTKLDGGLESSLREEVAGTRRHLQKLVGAP
                     AGRGHALTAEQALLRKQPLLTHPELSRVARDMEWLVLQSGKASCLRLRDTSTEDSPHW
                     RELVYRYCGHWREYAPRPASAPELFGPPSWSGAVEGLDAAQQARLEARLTQAFEASAW
                     FSPGGPARPEFKLGGRFVTERDSQAVALTAPWTESVPYTDHEDRTETIEEPYEAEEEY
                     TDEDGKTRTRTVTKYTSHTHTYSVPVTRYRDVPRTFEYHALRLSQAHHLAVASAATLD
                     ARRSPFVLAMQDQLSESGHEHDVTFEKGKVRPSQPSFTPAETWLDAKVEALAAAFSRQ
                     LATHWQESYCSTPSLTLDEAARCARAGAAVPAQVARVLSDILGADATQVPILFASP"
     gene            complement(553732..555225)
                     /locus_tag="LILAB_02345"
                     /db_xref="GeneID:10874929"
     CDS             complement(553732..555225)
                     /locus_tag="LILAB_02345"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-cysteine ligase family 2 protein"
                     /protein_id="YP_004663474.1"
                     /db_xref="GI:338530140"
                     /db_xref="GeneID:10874929"
                     /translation="MGMAIHQEDFRPEDHARFSRRLAESLEALRALLARPGFGVGPPT
                     VGAELELCLVDRLGFPLPVNREVLARTSDPRVTLELDAFNLEVNLRPGPLAGRPFTAL
                     REEVESAVAAVRQAASTQGARVAVTGILPTLREADLGSGALTGEPRYRAMSAAIRQRR
                     GAVPFQVAIRGEEEALALTWNDVTLEGANTSLQYHLRVAPGDFARMYNAAQLATAPVL
                     AVSGNSPLFLGRKLWDETRVALFRQAVDDRGEPGEGGFQPHARVSFGHGWVREGAYEL
                     FAEAVALHPPMLPVTGEESPRERVAAGEVPGLDELRLHQSTVWSWNRAIYDPKDGGHL
                     RIEFRALPAGPTTVDMVANGAFLLGLTLALAERVDALLPALPFVHAYGNFIRAARQGL
                     DAELLWPADAAPSPQPVLATELVKRLLPEARRGLVGAGVDTREADTLLGVIERRVSLR
                     RTGAVWQRQVLARLESQMPRRDALAAMLERYLQHAESGAPVHAWPVE"
     misc_feature    complement(553837..555114)
                     /locus_tag="LILAB_02345"
                     /note="Glutamate-cysteine ligase family 2(GCS2); Region:
                     GCS2; cl00954"
                     /db_xref="CDD:260718"
     gene            555393..556472
                     /locus_tag="LILAB_02350"
                     /db_xref="GeneID:10874930"
     CDS             555393..556472
                     /locus_tag="LILAB_02350"
                     /note="COG0820 Predicted Fe-S-cluster redox enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="YP_004663475.1"
                     /db_xref="GI:338530141"
                     /db_xref="GeneID:10874930"
                     /translation="MPSDTSANLYDLTRPALGALLAGWGFGPYHRDQLWTALYRRHAA
                     SFDELDGLKPELLRALREHTRLGQLATHHESFSGDGFTHKLLLRLDDGQTIETVLMRF
                     KGRATVCISTQAGCAMGCVFCATGQMGLSRHLTPGEIVGQVLHVNRILRASGEALRNV
                     VLMGMGEPLHNYEHTMSAVDVLVDAMGLAMGPRFITLSTVGVVPGIRRLADEERPIHL
                     AVSLHGATDAERAALVPAGRRWPLDELMDACRYYSEKRKRRIFFEWTLISGRNDTAEH
                     AHTLGQLLQGMDAHVNVIPLNPTVGYDGGPSRPESVRAFQDVLAAYEVPSTVRQRRGI
                     DIDAGCGQLKAKVERRTRSSVPTSA"
     misc_feature    555414..556448
                     /locus_tag="LILAB_02350"
                     /note="Predicted Fe-S-cluster redox enzyme [General
                     function prediction only]; Region: COG0820"
                     /db_xref="CDD:223890"
     misc_feature    555720..556310
                     /locus_tag="LILAB_02350"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(555738..555740,555744..555746,555750..555752,
                     555756..555764,555882..555884,555888..555893,
                     555984..555992,556053..556055,556191..556193,
                     556284..556289)
                     /locus_tag="LILAB_02350"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            556777..557160
                     /locus_tag="LILAB_02355"
                     /db_xref="GeneID:10874931"
     CDS             556777..557160
                     /locus_tag="LILAB_02355"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663476.1"
                     /db_xref="GI:338530142"
                     /db_xref="GeneID:10874931"
                     /translation="MLSIQEHATVDEASSELLDFVLEPYNWLSLPRTGMDPATWPGQN
                     TLYQRRVGSLRICASVDVAATLDVFLHIAFRAPGLTPVKAADHLESFLKQRLPLTPNS
                     EWQVEVDERRWIHFSRRYAGPPLKA"
     gene            complement(557150..558748)
                     /locus_tag="LILAB_02360"
                     /db_xref="GeneID:10874932"
     CDS             complement(557150..558748)
                     /locus_tag="LILAB_02360"
                     /note="COG2114 Adenylate cyclase, family 3 (some proteins
                     contain HAMP domain)"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate and guanylate cyclase catalytic
                     domain-containing protein"
                     /protein_id="YP_004663477.1"
                     /db_xref="GI:338530143"
                     /db_xref="GeneID:10874932"
                     /translation="MTDISLEEYKALRTLQRAVDDALEESLREREPLTQTFRRCFPLV
                     LSLTGARAVAITTRDEELVEQTWGEGDWSDRHPGALLEGAAGVRRLDADTLASQPLDV
                     AGARVGSLGLLFAGDATAPEAAARLLRLLDTVAEQLDTVLCLVHTASEKHQLILQCNG
                     HLANPVFEAGMDLAVLTLAQRVRLPGFLLLYRDAVQPHLLHYRTYRGGHLEFESGEQP
                     QAGLEAAIRQHGPRLLLGEDSALRQLFPGRTTEAVLISGAAAAHGPLGKIVVWNDGGF
                     STYAMDLIRVLASTLSQRLQDYNRERIHLSQFFPNAVIDALLQDPAYAQHLRAQDQEV
                     GILFADINGFTRICEQGFDSPRSIGRFVDEWSQRAVGCIWEHGGVFDKMVGDCVIGLF
                     GPPFFKSTPRERAQAAVRAACDIQAFTAALGAREEVAALCERVKLPGLGVAVGVNLAH
                     ANCGLFGPNRQYTAFSSGMNQAARLQSLAGFRETLVMDSVHDALAGAEDAFFQGLRFG
                     PLTETPVKNVAQPLRHYRLEPLTP"
     misc_feature    complement(557246..557836)
                     /locus_tag="LILAB_02360"
                     /note="Adenylyl- / guanylyl cyclase, catalytic domain;
                     Region: CYCc; smart00044"
                     /db_xref="CDD:214485"
     misc_feature    complement(557168..557752)
                     /locus_tag="LILAB_02360"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(557201..557203,557327..557332,
                     557339..557344,557354..557362,557582..557584,
                     557591..557599,557603..557605,557714..557731,
                     557735..557737))
                     /locus_tag="LILAB_02360"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(557591..557593,557729..557731))
                     /locus_tag="LILAB_02360"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(557201..557203,557339..557341,
                     557348..557359,557384..557386,557393..557395,
                     557600..557605,557639..557641,557651..557653,
                     557660..557665,557672..557674,557714..557716))
                     /locus_tag="LILAB_02360"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     gene            complement(558783..559637)
                     /locus_tag="LILAB_02365"
                     /db_xref="GeneID:10874933"
     CDS             complement(558783..559637)
                     /locus_tag="LILAB_02365"
                     /note="COG1409 Predicted phosphohydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase family
                     protein"
                     /protein_id="YP_004663478.1"
                     /db_xref="GI:338530144"
                     /db_xref="GeneID:10874933"
                     /translation="MRIAHCSDVHITEDYFSLPLHRLGWRRWVALVELTVGGRARRYA
                     RAPQALAAIARDAQASQVDHFILSGDLTAYALEGEFSGARQSLGALADDPRRCTVIPG
                     NHDVFTPGSHRTGRFARHFGHLLESDLPEHRREGAFPFVRLLGTEAAVVGLLSARVPR
                     TPGLSYGVIGPAQLGGLAALLKDPRLEGRAVLVVVHHAPLNPRGRPDHWHHGLRDAEA
                     LLKLLPGPRYAVLHGHIHRRYHHPATADRPHVFGAGSSTEAGHEGYWLIDVADGQVTG
                     GQQQTPAL"
     misc_feature    complement(<558927..559637)
                     /locus_tag="LILAB_02365"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    complement(558927..559634)
                     /locus_tag="LILAB_02365"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(order(558936..558938,559050..559052,
                     559326..559331,559428..559430,559608..559610,
                     559614..559616))
                     /locus_tag="LILAB_02365"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(558936..558938,559050..559052,
                     559329..559331,559428..559430,559608..559610,
                     559614..559616))
                     /locus_tag="LILAB_02365"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            559806..560753
                     /locus_tag="LILAB_02370"
                     /db_xref="GeneID:10874934"
     CDS             559806..560753
                     /locus_tag="LILAB_02370"
                     /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA synthetase class I domain-containing
                     protein"
                     /protein_id="YP_004663479.1"
                     /db_xref="GI:338530145"
                     /db_xref="GeneID:10874934"
                     /translation="MSAVRGRFAPSPTGRMHLGNIRSALLGWLQARAAHGRFLLRVED
                     LDRARCKPQHVEELLRDLAWLGLDWDEAPLFQSQRDGLYRDAQAKLEREGLVYPCFCT
                     RAEIARAASAPHGLSDEGPRYPGTCARLTREQASERARTRAPAYRFRARPGELRFVDG
                     VQGPYTQDVDAAVGDFVVRRNDGVASYQLAVVVDDAATDITHVLRGDDLLSSTPRQLQ
                     LYTALGLPAPAFLHVPLVMGEDGRRLAKREGAFALAELRERGVAPERVLGLLAAWSGL
                     GDGSPLTLAELVHGFRPEKLPRAPVVAGEAALRKALGLE"
     misc_feature    559806..560714
                     /locus_tag="LILAB_02370"
                     /note="glutamyl-Q tRNA(Asp) synthetase; Reviewed; Region:
                     PRK05710"
                     /db_xref="CDD:235573"
     misc_feature    559815..560705
                     /locus_tag="LILAB_02370"
                     /note="tRNA synthetases class I (E and Q), catalytic
                     domain; Region: tRNA-synt_1c; pfam00749"
                     /db_xref="CDD:250104"
     misc_feature    order(559854..559865,560538..560549)
                     /locus_tag="LILAB_02370"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    order(559854..559856,559863..559865,560541..560543)
                     /locus_tag="LILAB_02370"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    559854..559865
                     /locus_tag="LILAB_02370"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    560538..560549
                     /locus_tag="LILAB_02370"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            560895..561848
                     /locus_tag="LILAB_02375"
                     /db_xref="GeneID:10874935"
     CDS             560895..561848
                     /locus_tag="LILAB_02375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663480.1"
                     /db_xref="GI:338530146"
                     /db_xref="GeneID:10874935"
                     /translation="MAAIVENQAPGGVSAVAGNPYKLSWGAIFGGAFVALALWLLLNS
                     LGLALGLSTVDPNDPGSARAAGIGTGIWSAIAPLIALFCGGFVAARSAGRLDKGGGAL
                     HGAVLWGLTTLVGTALLGMLLSSVIGTALRAGGAVVGATGSAMAGAASGGGQAAQTFG
                     LDANDALGPINRRLQAEGKPTITANQLQAATSEVLSTALRTGNLDREVLVTSIADNTR
                     LSRQDAEGIADRVSQQFTAFTGRVGQMGEQVQQGALQAAQPTSRVFWGIFASLLLGLV
                     SAMLGATVGVSRRQRIAAEGAIATPPPRPTEPTGPRREVYP"
     gene            562034..563872
                     /locus_tag="LILAB_02380"
                     /db_xref="GeneID:10874936"
     CDS             562034..563872
                     /locus_tag="LILAB_02380"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin-like phospholipase family protein"
                     /protein_id="YP_004663481.1"
                     /db_xref="GI:338530147"
                     /db_xref="GeneID:10874936"
                     /translation="MSRSTTYLLCLATLSAVSSGCFLRTGAILDALNTPGDPRAAPLP
                     VPIQERAARLTRTHLMDAYADPAEAARWMSALGNAPQPIIEQVDCLKQTAGGDNSACY
                     ERFLAAAMEAPLWGLPPLPTTVDPAAPAPREVDAARFLANALGIAGSLVALRDAQGDR
                     VPLQVLTRGIREGAESAAQYVSARRWSRTLGRPSNAVVLSGGGANGAFSAGAIWRLLG
                     VLEQCRGKPAPEGCGDARIDLAAGSSTGALISTLVDLFHTPGHEAAARQLLVSNYTCS
                     VESDLYCVNDTWIWKIASDLRGLVQFDGIYGKLRAAVVPEQLTNGTELVAVSVDFDTG
                     DVYGVSDQDPENFAADATPQQRVEGIINGVVASIVEPVLADPVPWLPARAGRMKGSFY
                     DGGVRSGLPLLQAVQRGAERVLVLSTGGVEPSPEHPPENAVGVLMRTIDLFVAQPRVG
                     EVQQGELAAVGRRFAEHNVCVARLARVADPDGVNAFCRRTGAGFVPREPGALRAATNM
                     WLGSARFDQVASSWRSSWMFRPDSQLQTASGYGFSPEVMRPLFKEGVKHFQQRCHEVL
                     RLFEIRGTRATAECDRPVDDAVAEAEARFAPLAQCTQGKPEQRSCK"
     misc_feature    562622..563251
                     /locus_tag="LILAB_02380"
                     /note="Patatin-like phospholipase; Region: Patatin;
                     pfam01734"
                     /db_xref="CDD:250825"
     misc_feature    order(562637..562642,562646..562648,562763..562765,
                     563210..563212)
                     /locus_tag="LILAB_02380"
                     /note="active site"
                     /db_xref="CDD:132836"
     misc_feature    562757..562771
                     /locus_tag="LILAB_02380"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132836"
     gene            563901..564557
                     /locus_tag="LILAB_02385"
                     /db_xref="GeneID:10874937"
     CDS             563901..564557
                     /locus_tag="LILAB_02385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663482.1"
                     /db_xref="GI:338530148"
                     /db_xref="GeneID:10874937"
                     /translation="MSDRSSLIRWLVIPGVSLGVLILSAALSYWLTRPVHDAPLPVGP
                     PPAEERPTAQPPDTRGAPTPGLSPPSATPPPVRPPPAFPSARSEVPAPPPTSGDPRRV
                     VEVEPVIEATSGRIHAEDIRAAIQAVTPLVQQCFEDAAQRNRGPQTVKLRFTVEAGRE
                     GGVMSAGELVSSTIPDPFVQACALDSLLDVRFPAPYGGGKATVVYPFEFRVPGEETGR
                     "
     misc_feature    <563994..>564335
                     /locus_tag="LILAB_02385"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14971"
                     /db_xref="CDD:237874"
     gene            564598..565434
                     /locus_tag="LILAB_02390"
                     /db_xref="GeneID:10874938"
     CDS             564598..565434
                     /locus_tag="LILAB_02390"
                     /note="COG3393 Predicted acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663483.1"
                     /db_xref="GI:338530149"
                     /db_xref="GeneID:10874938"
                     /translation="MPVTVEQLGPHDAEALRGLLSKDPISNLYLLGLLEEFGIAPRGR
                     VPFAFYGRFDGQALTAAVFVGGDGGLVVPSASDATATSVIADALASNLTLRSTVGDKS
                     SVDALLRSLAPGKPRLSRTQRLFSVSADDLGPFTNPLLRLAKEEDLPRLLPLAQGYVR
                     EVHERDPLAEDPRGYEARVIQRVRQRRTYVLEENGALVFKVDIGSRSQYGAELEGLYT
                     LPSERRKGHALLCLGQISRHLLSSLPRLTLRIDERDDSTARIARKVGYLAGRTWRLVL
                     VD"
     misc_feature    564619..565425
                     /locus_tag="LILAB_02390"
                     /note="Predicted acetyltransferase [General function
                     prediction only]; Region: COG3393"
                     /db_xref="CDD:225928"
     misc_feature    564745..565053
                     /locus_tag="LILAB_02390"
                     /note="Domain of unknown function (DUF4081); Region:
                     DUF4081; pfam13312"
                     /db_xref="CDD:257649"
     gene            565463..566086
                     /locus_tag="LILAB_02395"
                     /db_xref="GeneID:10874939"
     CDS             565463..566086
                     /locus_tag="LILAB_02395"
                     /note="COG4445 Hydroxylase for synthesis of
                     2-methylthio-cis-ribozeatin in tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-(MS[2]IO[6]A)-hydroxylase"
                     /protein_id="YP_004663484.1"
                     /db_xref="GI:338530150"
                     /db_xref="GeneID:10874939"
                     /translation="MSRPTPSRRPLSGEGPVILHAATDPRWLPLALERFDEVLVDHAH
                     CEKKAAANALSLLQAYPDLPGLPAQMARLAREESAHLARVLDLMAARGLTLTKDAGDP
                     YAQGLQKLIRTPAAERRTDRLLVAAVIEARSCERLSLLAEGLTDPALARFYGELAQSE
                     DGHQSLFYRLAVAASAGDEARVKARLEWMLEREAQVITDVGLRAAIH"
     misc_feature    565517..566053
                     /locus_tag="LILAB_02395"
                     /note="MiaE tRNA-modifying nonheme diiron monooxygenase,
                     ferritin-like diiron-binding domain; Region: MiaE;
                     cd07910"
                     /db_xref="CDD:153119"
     misc_feature    order(565598..565600,565691..565693,565700..565702,
                     565784..565786,565826..565828,565835..565837,
                     565850..565852,565940..565942,565949..565951,
                     565961..565963)
                     /locus_tag="LILAB_02395"
                     /note="active site"
                     /db_xref="CDD:153119"
     misc_feature    order(565598..565600,565691..565693,565700..565702,
                     565850..565852,565940..565942,565949..565951)
                     /locus_tag="LILAB_02395"
                     /note="dinuclear metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:153119"
     misc_feature    order(565601..565603,565622..565624,565631..565633,
                     565664..565666,565673..565678,565685..565687,
                     565694..565696,565703..565708)
                     /locus_tag="LILAB_02395"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153119"
     gene            complement(566091..567944)
                     /locus_tag="LILAB_02400"
                     /db_xref="GeneID:10874940"
     CDS             complement(566091..567944)
                     /locus_tag="LILAB_02400"
                     /note="COG0471 Di- and tricarboxylate transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="YP_004663485.1"
                     /db_xref="GI:338530151"
                     /db_xref="GeneID:10874940"
                     /translation="MTIAIVLGVVVIALVLFSFDTLPIEVSSLVVVCLLALTGVLTPA
                     QAFEGFSNDTVIFIFTLLAMTEGLASTGVVQLVGQRLAFFARFGHQTFVMAMMVAVAV
                     FSSIISNTVTTAAFLPVAIGAAQRAKVPKSKVLLPLAYASMLGGMVFLYGTSTNLVMS
                     AALQRAGLPGIGVTELAPVGLPLAIIGIIGVVLLAPWLLPAREGRGGMEDWTLRDYLT
                     EAVLPPDSRYVGKELGDISEGLGLRVIGIIRDGGALPAVPGYRLRGDERLLIEGNREA
                     ILRVKDLRGIAIRPDVRLSDEELRDKDSILIEASVPPGSPLVGRSLKETLFVERYGMV
                     ALALHRKPAIQRVTKLQLLGRIFGERSLSMLPLSVGDVLLLRGARDRVDELARGGNLT
                     VLSGHEYQPPRYGKALLAVVLFLGALVAGSLNVVPLSVAGLTGMLLMIATGCVDSRTA
                     FRVDWRVVLLIGSMMALGLAMEVSGAGAFIGDKVAALGAYGGPRMVMVLLMVLTIVLS
                     APMSNQAAALVVLPVALNAAQQLGLDARPFAMAVTLAASCSFITPLEPSCVLVYGPGH
                     YRFTDFFRLGTPLTTVLVVLLAVAVPWVWPLEKGASAAPRPAVGLRAPPGP"
     misc_feature    complement(<567348..567926)
                     /locus_tag="LILAB_02400"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    complement(order(567348..567359,567372..567416,
                     567480..567551,567561..567614,567618..567668,
                     567738..567791,567834..567875,567894..567905))
                     /locus_tag="LILAB_02400"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     misc_feature    complement(566154..567563)
                     /locus_tag="LILAB_02400"
                     /note="Di- and tricarboxylate transporters [Inorganic ion
                     transport and metabolism]; Region: CitT; COG0471"
                     /db_xref="CDD:223547"
     misc_feature    complement(567105..567296)
                     /locus_tag="LILAB_02400"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(566790..567029)
                     /locus_tag="LILAB_02400"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(566160..>566726)
                     /locus_tag="LILAB_02400"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     gene            568134..569948
                     /locus_tag="LILAB_02405"
                     /db_xref="GeneID:10874941"
     CDS             568134..569948
                     /locus_tag="LILAB_02405"
                     /EC_number="4.1.1.32"
                     /note="COG1274 Phosphoenolpyruvate carboxykinase (GTP)"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="YP_004663486.1"
                     /db_xref="GI:338530152"
                     /db_xref="GeneID:10874941"
                     /translation="MNHKDESMASTQVAAEGQQAPTKNPTLLAWVAKMAEMTQPDRIV
                     WCDGSEAEKKRLTDQAVQEGILIPLNPEKRPNSYLHRSNPNDVARVEHLTFICTPNKT
                     DAGPTNNWMEPEAAYTKLGNLFSGCMKGRTMYVVPYAMGPIGSPFTKLGVEITDSIYV
                     VLNMRIMARMGKQALDMLGDSDDFNRGLHSTGDVDPDRRYICHFPQDNTIWSFGSGYG
                     GNVLLGKKCLALRIGSYLGREEGWMAEHMLILGVTSPKGETTYVAAAFPSACGKTNFA
                     MMIPPAEYKGWKIETVGDDIAWMHPGPDGRLYAINPEAGYFGVVPGTNYKTNPNAMES
                     IAKDTIFTNVAMTPDGDVWWEGKDGEVPEELTDWQGRPWKKGSTEKAAHPNSRFTAPM
                     SNNPALSPKANDPTGVPISAIIFGGRRSNTVPLVLQAFNWTHGVFLGATMGSETTAAA
                     TGKVGVVRRDPMAMLPFCGYHMGDYLQHWLDMQKHIAQLPKIFQVNWFRQDKNGKFMW
                     PGFGENMRVLEWIVNRVHGRVPTQETLLGWVPRADEGLNLKGLDLASDVVTEVTSIKE
                     DEWKSELKSQEVFFEQLGTKAPDALMLQRKLLMARLDH"
     misc_feature    568212..569927
                     /locus_tag="LILAB_02405"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_GTP;
                     cd00819"
                     /db_xref="CDD:238417"
     misc_feature    order(568398..568400,568782..568784,568788..568790,
                     568806..568811,568869..568871,568935..568955,
                     569013..569018,569082..569084,569088..569090,
                     569115..569117,569292..569294,569655..569657,
                     569664..569666,569673..569675)
                     /locus_tag="LILAB_02405"
                     /note="active site"
                     /db_xref="CDD:238417"
     misc_feature    order(568398..568400,568782..568784,568788..568790,
                     568806..568811,569082..569084,569292..569294)
                     /locus_tag="LILAB_02405"
                     /note="substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238417"
     misc_feature    order(568809..568811,568869..568871,568950..568952,
                     569013..569018,569082..569084)
                     /locus_tag="LILAB_02405"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238417"
     misc_feature    order(568938..568940,568944..568946,569385..569387,
                     569622..569627,569655..569657,569664..569666,
                     569673..569675)
                     /locus_tag="LILAB_02405"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238417"
     gene            570110..570910
                     /locus_tag="LILAB_02410"
                     /db_xref="GeneID:10874942"
     CDS             570110..570910
                     /locus_tag="LILAB_02410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663487.1"
                     /db_xref="GI:338530153"
                     /db_xref="GeneID:10874942"
                     /translation="MSVVLALAPPVAFAQRGKSAGALIKDGERLYQAGKYREAAEALK
                     KAHEAQPHPRLIYNIAISLENAGDLREAVSWYQQYVGATDGTDATLLKRSARSIDRLR
                     VLIEKEDQATAAANAERQRLQEEADAARRQAEEEQLAARRAEEESRRQQEAELQRALT
                     SYKRQRIGAFAAAGVGAAGVVAGVLFGMQARDAREQFDGATSVTSKDELADKTRGRAL
                     LADVGFGVGLAGVITAIVLYPKEGPPVAGEVRVTMAPKGAGAGMAVSF"
     misc_feature    570173..>570343
                     /locus_tag="LILAB_02410"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(570173..570175,570179..570184,570191..570196,
                     570278..570283,570287..570292,570299..570304)
                     /locus_tag="LILAB_02410"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(570188..570190,570224..570226,570236..570238,
                     570245..570247,570287..570289,570323..570325,
                     570335..570337)
                     /locus_tag="LILAB_02410"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    <570236..570580
                     /locus_tag="LILAB_02410"
                     /note="Protein of unknown function (DUF1682); Region:
                     DUF1682; pfam07946"
                     /db_xref="CDD:254533"
     gene            570910..572340
                     /locus_tag="LILAB_02415"
                     /db_xref="GeneID:10874943"
     CDS             570910..572340
                     /locus_tag="LILAB_02415"
                     /note="COG0683 ABC-type branched-chain amino acid
                     transport systems, periplasmic component"
                     /codon_start=1
                     /transl_table=11
                     /product="receptor family ligand-binding protein"
                     /protein_id="YP_004663488.1"
                     /db_xref="GI:338530154"
                     /db_xref="GeneID:10874943"
                     /translation="MRALGLMMTGSALLMAGCSFTTAGGLTECETSSDCDTAQVCNAG
                     YCLPQPVGCGTVYGPTTAANAIPLGATVPLSTSDGPDESEIQALNSIKLALDEINQRE
                     GVNGRPFVLHICDTRSDAARAAEQAQWLIRERQVPMIFASSSGQALSVATHTVPNGVL
                     MITYSGTSPDIATINDKIGTEAGLVWRTAPSDVLQGRIIGDLLQGRIQVNGAPLYDAV
                     SKVGISYVNDPYGQGLFGVTLGRINLPPENVTSSQYTRNGTDFSNVAQRIVTNAPDVE
                     VLIGFSEDNVRIINQTAAAGRDNQRWFFTDAGKDRGLFTALGNNRHLVTGAYGTSPAQ
                     AREDLVYRLFAQRFNSAFGEDPGQYSFTAHAYDAMYMVALGAAYAAGPDVNSPQAITG
                     ARIADGLALMTPDADGTPLNFNLGTEGFASARAAIRNGQVIDVTGASGNLDFDATGEA
                     PSEYELFRVTATGEFETVQLIAPPTE"
     misc_feature    571111..572055
                     /locus_tag="LILAB_02415"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    571165..572253
                     /locus_tag="LILAB_02415"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     gene            complement(572355..573524)
                     /locus_tag="LILAB_02420"
                     /db_xref="GeneID:10874944"
     CDS             complement(572355..573524)
                     /locus_tag="LILAB_02420"
                     /note="COG0436 Aspartate/tyrosine/aromatic
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="class I/II aminotransferase"
                     /protein_id="YP_004663489.1"
                     /db_xref="GI:338530155"
                     /db_xref="GeneID:10874944"
                     /translation="MSRFSERTDFARTPNPLALALERHRASGRPLLDLTESNPTRVGL
                     PLPDAALLAPEDAFTYQPEPLGLVSARQALVADFAARGAQVSAAHLLLTASTSEAYGW
                     LFKLLCEPGDNVLVPAPCYPLFEHLARLEGVQTRSYALPRAHGFGLDAREVAAACDAR
                     TRAVLVVNPGNPTGHFLHEGELAALADVCVDRRLALLCDEVFAPFAWDAAAPGRVATV
                     AGRALPMLTFALGGLSKAVGLPGLKLAWTHVGGPGHLRDEALARLEWVGDTYLPVGTP
                     VQRALPALLAHAPRFQAAVLERVRGNRQRLLAARPRGATWDVVPAEGGWSAVLRIPRV
                     PGEEATCLALLDAGARVQPGYFYDFGGGAFLVLSLLPQPEVFAAAVEVLTRTLGP"
     misc_feature    complement(572370..573521)
                     /locus_tag="LILAB_02420"
                     /note="Aspartate/tyrosine/aromatic aminotransferase [Amino
                     acid transport and metabolism]; Region: COG0436"
                     /db_xref="CDD:223513"
     misc_feature    complement(572376..573380)
                     /locus_tag="LILAB_02420"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(572796..572798,572820..572825,
                     572829..572831,572919..572921,573012..573014,
                     573162..573164,573234..573242))
                     /locus_tag="LILAB_02420"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(572685..572687,572694..572696,
                     572796..572804,572940..572942,573132..573134,
                     573231..573233))
                     /locus_tag="LILAB_02420"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(572820..572822)
                     /locus_tag="LILAB_02420"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(573521..573799)
                     /locus_tag="LILAB_02425"
                     /db_xref="GeneID:10874945"
     CDS             complement(573521..573799)
                     /locus_tag="LILAB_02425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663490.1"
                     /db_xref="GI:338530156"
                     /db_xref="GeneID:10874945"
                     /translation="MADIIDLTFLADVRRLYKKLIDQRGLSYFLQKEGPRLFHIEPSK
                     VELVLRTALRARDPQLPRPHDKAIEHCRKEVRRDLIRRVANAMLQTGL"
     gene            complement(573932..574615)
                     /locus_tag="LILAB_02430"
                     /db_xref="GeneID:10874946"
     CDS             complement(573932..574615)
                     /locus_tag="LILAB_02430"
                     /note="COG0132 Dethiobiotin synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="YP_004663491.1"
                     /db_xref="GI:338530157"
                     /db_xref="GeneID:10874946"
                     /translation="MAQTDKPFQIFVTGTDTGVGKTQASCALLSLLADAGLRPQGFKP
                     YESGCASLRAPADALALRAAAGSALSVDAVCPHRFRLPVAPGVAASRLGREPDWDVTL
                     AAWRRLRGGNAVVEGAGGLFVPLDSKHDVIDLIATLRLPVLLVARAGLGTLNHTALSL
                     QALAARRIPVRAVLLSRGTSAKDASERDNRRLLEARHGVPVLGPVPHLPDARKRHAAF
                     RRALRPLLP"
     misc_feature    complement(573986..574591)
                     /locus_tag="LILAB_02430"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     misc_feature    complement(573965..574588)
                     /locus_tag="LILAB_02430"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     gene            complement(574602..575783)
                     /locus_tag="LILAB_02435"
                     /db_xref="GeneID:10874947"
     CDS             complement(574602..575783)
                     /locus_tag="LILAB_02435"
                     /note="COG0156 7-keto-8-aminopelargonate synthetase and
                     related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_004663492.1"
                     /db_xref="GI:338530158"
                     /db_xref="GeneID:10874947"
                     /translation="MSDEAVAAAWAREDLEALSERGLRRYLEPLDSPQGPVVRVGDET
                     LVNFSSNDYLGLASSPTVRAAALAAVERYGVGTGASRLVVGDTAAHHRLEARLAAFER
                     AEAVRLFNSGYAANTGIIPALVGPGDAVFSDALNHASLVDGCRLSRARVCVYPHADVE
                     ALERALAQTPARRKLVVTDTVFSMDGDVAPLRDIVTACRAHGAALMVDEAHATGVLGH
                     RGAGLCEELGLEGQVDLRMGTLGKALGVMGAYVATSRAVADLLVSRARPFVFSTALPA
                     HLCAAAEAAVDAVEGDPDLRARLWRNIRRFAEGLRVLGVRAEPRSAVFPLILGEPERA
                     LDAARRLREAGVLVKAIRPPTVPEGTSRLRFCLSAAHTVGHVDLALEALRTVGVRRGP
                     D"
     misc_feature    complement(574635..575699)
                     /locus_tag="LILAB_02435"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    complement(574623..575651)
                     /locus_tag="LILAB_02435"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(574692..574694,575058..575060,
                     575067..575069,575151..575156,575160..575162,
                     575232..575237,575247..575249,575373..575375,
                     575445..575453,575631..575633))
                     /locus_tag="LILAB_02435"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(575058..575060,575067..575069,
                     575151..575156,575160..575162,575235..575237,
                     575247..575249,575373..575375,575445..575453))
                     /locus_tag="LILAB_02435"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(575058..575060)
                     /locus_tag="LILAB_02435"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            complement(575790..576824)
                     /locus_tag="LILAB_02440"
                     /db_xref="GeneID:10874948"
     CDS             complement(575790..576824)
                     /locus_tag="LILAB_02440"
                     /note="COG0502 Biotin synthase and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="YP_004663493.1"
                     /db_xref="GI:338530159"
                     /db_xref="GeneID:10874948"
                     /translation="MPDTATVASEFSGHAHVAAPPPPGVAVRHDWSLDEVKALYELPL
                     LDLVHKAQTVHRAVFVDNKVQLCSLLSIKTGGCPEDCSYCPQAARYKTGVKAENLMAV
                     PDVLDAASKARAAGATRFCMGAAWREVKDGPQFDSVLEMVRGVRALGMEACATLGMLS
                     ESQAKRLREAGLSAYNHNLDTSPEHYGDIISTRTFEDRLRTLDRVRGAGISVCCGGII
                     GMGESVADRCNLLRTLANQEHHPESVPINALVAVEGTPLQAQQRVETVDMVRTIATAR
                     ILMPQSMVRLSAGRQQMNEEAQLLCMMAGANSLFFGEKLLTTGNPEYTQDMALLEKAG
                     IRPLEPRQEG"
     misc_feature    complement(575805..576821)
                     /locus_tag="LILAB_02440"
                     /note="biotin synthase; Region: PLN02389"
                     /db_xref="CDD:215219"
     misc_feature    complement(576009..576605)
                     /locus_tag="LILAB_02440"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(576078..576083,576174..576176,
                     576291..576293,576360..576368,576453..576458,
                     576462..576464,576570..576578,576582..576584,
                     576588..576590,576594..576596))
                     /locus_tag="LILAB_02440"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(575814..576092)
                     /locus_tag="LILAB_02440"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; smart00876"
                     /db_xref="CDD:214877"
     gene            complement(576967..577236)
                     /locus_tag="LILAB_02445"
                     /db_xref="GeneID:10874949"
     CDS             complement(576967..577236)
                     /locus_tag="LILAB_02445"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004663494.1"
                     /db_xref="GI:338530160"
                     /db_xref="GeneID:10874949"
                     /translation="MGIIAFLVIGLLAGLIARALMPGNQSMGLLATTLLGIAGSFVGG
                     FIASLFRSDGNVFDLHPTGLLFSVLGALLVLFLVGLAGRGRRVHV"
     misc_feature    complement(576997..577236)
                     /locus_tag="LILAB_02445"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2261"
                     /db_xref="CDD:225170"
     gene            577420..578787
                     /locus_tag="LILAB_02450"
                     /db_xref="GeneID:10874950"
     CDS             577420..578787
                     /locus_tag="LILAB_02450"
                     /note="COG1066 Predicted ATP-dependent serine protease"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_004663495.1"
                     /db_xref="GI:338530161"
                     /db_xref="GeneID:10874950"
                     /translation="MAKAKTHYTCQACGYKTAKWLGKCPDCGAWSSLLEETDPKADER
                     RPAWGASGGAARPMLLKEVSGETETRRRTGIAEFDRVLGGGVVSGSIVLLGGDPGIGK
                     STLLLAALDRLARHGPVLYVSGEESLRQTKMRAERLKVEGDSIHLFAETDAERVLTAT
                     EALKPQALVVDSIQTMYLPELGNAPGSITQVREVAGRLMAYAKRTGVPTFLVGHVTKE
                     GSIAGPRVLEHMVDTVLYFEGERGHPFRILRAHKNRFGSTNEIGVFEMKGAGLVEVPD
                     PSALFLSERPVGKSGSVVTSTLNGTRPLLVEVQALVAPTGYGTARRTAIGVDGNRVAL
                     LAAVLEKKEEIPLVGCDLFVNVAGGMQLTEPACDLAVCAALVSSLQNRPLDPKTLVLG
                     EVGLAGEVRAVGQVEPRLAEAAKMGFQRVVMPAGSARRLEDAGPKMKIVGVETLGDAL
                     VAMFD"
     misc_feature    577420..578784
                     /locus_tag="LILAB_02450"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    577441..578553
                     /locus_tag="LILAB_02450"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    577705..577728
                     /locus_tag="LILAB_02450"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(577708..577710,577720..577728,577780..577782,
                     577786..577788,577930..577935)
                     /locus_tag="LILAB_02450"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    577921..577932
                     /locus_tag="LILAB_02450"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <578521..578697
                     /locus_tag="LILAB_02450"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            582250..585669
                     /locus_tag="LILAB_02455"
                     /db_xref="GeneID:10874951"
     CDS             582250..585669
                     /locus_tag="LILAB_02455"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_004663496.1"
                     /db_xref="GI:338530162"
                     /db_xref="GeneID:10874951"
                     /translation="MKGVYIAPGTRNVDVPILVRNGGDIAVAGVSVLVGRPAKGDSPL
                     RSVNSEIHVPWLSDQNLEDTAAVVVACTLELDPERIDLPRELRLSVRTSWFGGKGEET
                     YVIPIRTEHPDLIDARMNGYDGRPVDLNADQTLRLSSTTVQKCFSKLRDELGDGKPLR
                     AYIYGRRRRGKSSICSSLRDNRSVRRNFAVQDRVWNGARMTTVETAFSTLAETLASAL
                     AKTGVSVGKLDLSHLSRADEISERFLFWFDTLSDSLPEKKRVFLILDEFQKWLAGLGS
                     PQERIALLSALRHFNDRPSKLEVSFVLSGLHNLKTLIQESNDLANALEAFEIRALTNE
                     EADRYLRERLPLDLDGRTRRRLVSLSGGNPYVLNRLGGNLLEALREKRRRWCTAADVD
                     ALLADDDAQTGRLNEFVKYMLHEDEDDGAATLRQLTVLRAAASTLKERGDFDGYVRTT
                     DVEGWLTKNSIEFENGLVERQLEELSQLDLLQIRPGGRYYLRGEWLCRALAALDPVLV
                     KLQAVTTRGDPELVLGRFRRKQLLGRGGEAEVWLAENVLEGGRDVVLRIYPLSTVGLR
                     QRVEREKEILERVRHPNVVAFNGASIDDRHGGIVVLDHIAGSTLDELLTSKPPAAQSI
                     LPGGDLERQVELLKKLASAVSACHSAGVVHKDLSPRNVMLSQQMGVWEPKVIDFGIAG
                     FDTQPVDSGSTTVMGTPGYVAPEKLRLRSARRTPAADIYSLGALFVRLLTGIEPGYLV
                     DHGPALRTAFLDSKIPSRVLDLVQRMLSEAPDSRPSADEVRNGLETVLEPLTWSELRL
                     HAQTAYLEDRSADAVRLFGQALAAVPVAERVGDTYSVLLDEALDVLQQPSESKIPWDA
                     QWLSHWLSLARQTANHRPDTRRVLTVLLQYRMRLKEAGMSLLKELVTRLAEPPTSAFL
                     NALVASLGRQEELRDPAVVERTFDALATYCAEKHIETNLVEDFCVACARSSRVKYQSL
                     LGAELWLQRARRLGGAPRGDYAAESKALEDARRKTGKLQTLPREPEKQESFRFGEGER
                     GHLSVERLERFDENVRRRFPFIHRLERVRKDRGLQVARPTLLRLDNIGNHVPQGGADP
                     GNIIPMAFDASFTGDVALRVNITLVSGTTAAQREAAYDVLKAEADLFDCLD"
     misc_feature    582691..583350
                     /locus_tag="LILAB_02455"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     misc_feature    583825..584595
                     /locus_tag="LILAB_02455"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    583843..584595
                     /locus_tag="LILAB_02455"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(583843..583857,583867..583869,583909..583911,
                     583915..583917,584002..584004,584053..584064,
                     584074..584076,584080..584082,584215..584217,
                     584221..584223,584227..584232,584236..584238,
                     584278..584280,584287..584289,584338..584349)
                     /locus_tag="LILAB_02455"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(583843..583857,583867..583869,583909..583911,
                     583915..583917,584002..584004,584053..584064,
                     584074..584076,584215..584217,584221..584223,
                     584227..584232,584236..584238,584278..584280)
                     /locus_tag="LILAB_02455"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(583855..583857,584074..584076,584080..584082,
                     584215..584217,584221..584223,584227..584229,
                     584287..584289,584338..584349)
                     /locus_tag="LILAB_02455"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(584275..584295,584338..584349)
                     /locus_tag="LILAB_02455"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(585855..586514)
                     /locus_tag="LILAB_02460"
                     /db_xref="GeneID:10874952"
     CDS             complement(585855..586514)
                     /locus_tag="LILAB_02460"
                     /note="COG3328 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004663497.1"
                     /db_xref="GI:338530163"
                     /db_xref="GeneID:10874952"
                     /translation="MQNVSALVAYGVGEDGHRHLLAITLGGSESAESWLELLRQLLDR
                     GLKDVRLVIADGHAGLAAAARQSLPEARLQRCTVHLTRSVLAKAPWRLRGRLGKETSA
                     IFEAPNRQGARKRLEALQEGLGRQVPEAMECLREGFAAATCFFSFPKAHWKRLRSTNG
                     LERLHGEVQRRIRSVGAFPDRASALRLITAVALEVTGVWDDRRYLDMSLLNSTPDTIA
                     A"
     misc_feature    complement(585924..>586511)
                     /locus_tag="LILAB_02460"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(585918..>586508)
                     /locus_tag="LILAB_02460"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            complement(586535..587035)
                     /locus_tag="LILAB_02465"
                     /db_xref="GeneID:10874953"
     CDS             complement(586535..587035)
                     /locus_tag="LILAB_02465"
                     /note="COG3328 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004663498.1"
                     /db_xref="GI:338530164"
                     /db_xref="GeneID:10874953"
                     /translation="MDDTEFESPAHEAVQADLRALFRGAIRMTLEALLEEEVGELVGA
                     GRWQRMVGRADVRNGSYLRTLVTTAGAVDVAVPRTRHSGSAGDVLGRYKRRSGELDEA
                     ITSAYVQNVSTRRMGKVTRALMGEAVSRSGGEPGDEDAGGEGGGAAYPAPHPGLSLPL
                     PGCHLP"
     misc_feature    complement(<586640..586993)
                     /locus_tag="LILAB_02465"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(<586643..586978)
                     /locus_tag="LILAB_02465"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            587704..589854
                     /locus_tag="LILAB_02470"
                     /db_xref="GeneID:10874954"
     CDS             587704..589854
                     /locus_tag="LILAB_02470"
                     /note="COG3325 Chitinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chitinase"
                     /protein_id="YP_004663499.1"
                     /db_xref="GI:338530165"
                     /db_xref="GeneID:10874954"
                     /translation="MLAVGVQLSACGTESIADAQLPEAPAIEDTPAVQAEAVDDGATT
                     LYEDALGPGWADWSWATRNLAAASPVASGSRAISVTFGPWTGLYLHHSGVSTSGLEFL
                     EFQVHGGATSNPALTTYATVGNQARPTIAINRYCDGGAIKAGAWTRCRVPLTALNVAN
                     VTMDGIAIQEGAGRNLPVMTFDSLRLGTATLSAPSGLKAGASATDVSLTWNGVSGATG
                     YHVYRATSQTGTYAKRTTTPLTNTTYRDINVSAGATYWYAVTAVGTGGEGLRSTPVSA
                     TVQPPQQQVAISVTPTSASLAPGASRTFTAAVTGSTNTAVTWSIQQGGAGGTITHAGQ
                     YTAPRTTGTYHVIATSQADTTKKATATVSVAATQPGSGKWVSGYYTGWNADLYPPEKV
                     DFSALTHIIVGRVTPRPDGTLNTAFDNNNGPQIARTLAQRAHAAGRKAIIMVGGAGEH
                     AGWVSAASNANRARFVQNLLNAMDTFGYDGLDIDWEPVEAADKPNLLALVKELRAARP
                     DMLLTFPIGWINSNFASDADPWFANLAPYLDQINIMSYEMIGPWDGWQSWYTSALYGE
                     SGNRPTSVSSSLQGWARAGIPKAKLGMGIPFYGMAWRNITGPYQDFTHWSDYVGSDNA
                     FTYQKIQQLSAAGTYRWDAVAAASYVTFNTPVEDGTVRWISYDSPQAIAAKGAYAKDH
                     GFGGTIIWTINQGCTNPTTGANPLLDAVKGAFLQ"
     misc_feature    588277..588537
                     /locus_tag="LILAB_02470"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(588454..588456,588499..588501)
                     /locus_tag="LILAB_02470"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    order(588502..588507,588511..588516)
                     /locus_tag="LILAB_02470"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    588553..588789
                     /locus_tag="LILAB_02470"
                     /note="Bacterial Ig-like domain (group 2); Region: Big_2;
                     pfam02368"
                     /db_xref="CDD:251254"
     misc_feature    588826..589785
                     /locus_tag="LILAB_02470"
                     /note="The GH18 (glycosyl hydrolase, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
                     major component of the cell wall of fungi and the
                     exoskeleton of arthropods.  Chitinases have...; Region:
                     GH18_chitinase-like; cl10447"
                     /db_xref="CDD:263970"
     misc_feature    588826..589785
                     /locus_tag="LILAB_02470"
                     /note="Glyco_18 domain; Region: Glyco_18; smart00636"
                     /db_xref="CDD:214753"
     misc_feature    order(588832..588834,588913..588915,589147..589149,
                     589153..589155,589159..589161,589339..589344,
                     589495..589497,589771..589773)
                     /locus_tag="LILAB_02470"
                     /note="active site"
                     /db_xref="CDD:119349"
     gene            complement(589919..590470)
                     /locus_tag="LILAB_02475"
                     /db_xref="GeneID:10874955"
     CDS             complement(589919..590470)
                     /locus_tag="LILAB_02475"
                     /note="COG0262 Dihydrofolate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibD
                     domain-containing protein"
                     /protein_id="YP_004663500.1"
                     /db_xref="GI:338530166"
                     /db_xref="GeneID:10874955"
                     /translation="MRKLKYHVATSVDGFIAHEDDTYGAFMQTRLIQDSEHVTDFVAS
                     LATYSAALMGRRTYEVGLKEGVTDPYTNLETYVFSRTMKESPNPRVKLVSEDAVGAVR
                     RLKAQEGGDIYLSGGGAFAGLLFAQGLVDEVLLKMNPLILGAGIPLVSSLRQVVDLEL
                     KSTKVYGNGVLLLRYAVLPRPKA"
     misc_feature    complement(589928..590464)
                     /locus_tag="LILAB_02475"
                     /note="Dihydrofolate reductase [Coenzyme metabolism];
                     Region: FolA; COG0262"
                     /db_xref="CDD:223340"
     misc_feature    complement(order(590114..590125,590231..590233,
                     590300..590308))
                     /locus_tag="LILAB_02475"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            590776..592269
                     /locus_tag="LILAB_02480"
                     /db_xref="GeneID:10874956"
     CDS             590776..592269
                     /locus_tag="LILAB_02480"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="developmental sensor histidine kinase SasS"
                     /protein_id="YP_004663501.1"
                     /db_xref="GI:338530167"
                     /db_xref="GeneID:10874956"
                     /translation="MAHVPPHTSRWRDALGSLSARLLVAFLVPTLLFVAVAGTAVYQL
                     ARTILEEELGTSLSAIAAATATQVHGERLLTVEPGDDVASTRTWRNFVRTFEGIAEAS
                     GVRRIYAVDTQGRVRVDVGGGLPVGAEMPELARDRLELTRVFEGARAASQVLFTGSDG
                     RLYKTGYAPILYEGRVVGAVGVEGSAVFFGPLQELSRTFATMGAVALTALAVIALVTA
                     RGLARPLRRLMASALRIGRGDLTTPVPPEPTLEIGVLARELEDMRGALESRDRQLKMM
                     LAGVAHEVRNPIGGIALFSGILKEDLQAGAHAEAGAHVERIQREVAYLQRIVEDFLAF
                     AREQPLARAPVEAPALLSVACELMAAEASARDVTVDLDAAPAVLEADGSLLTAALVNL
                     VKNAVQASPPGGRVRVSGAPNGGHYTIQVRDAGPGVPGAERERIFEPFFTTREKGTGL
                     GLPLARKIALAHGGALRLDSAPGDTRFTLTLPLGGTPGDSAAITLSR"
     misc_feature    591283..592224
                     /locus_tag="LILAB_02480"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    591436..591576
                     /locus_tag="LILAB_02480"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(591436..591441,591448..591453,591457..591462,
                     591469..591474,591478..591480,591526..591531,
                     591535..591540,591547..591552,591556..591561,
                     591568..591573)
                     /locus_tag="LILAB_02480"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    591583..591783
                     /locus_tag="LILAB_02480"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(591601..591603,591613..591615,591625..591627,
                     591634..591636,591646..591648,591655..591657,
                     591712..591714,591724..591726,591733..591735,
                     591745..591747,591754..591756,591766..591768)
                     /locus_tag="LILAB_02480"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    591619..591621
                     /locus_tag="LILAB_02480"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    591937..592218
                     /locus_tag="LILAB_02480"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(591946..591948,591958..591960,591967..591969,
                     592036..592038,592042..592044,592048..592050,
                     592054..592059,592120..592131,592177..592179,
                     592183..592185,592198..592200,592204..592206)
                     /locus_tag="LILAB_02480"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    5