GenomeNet

Database: RefSeq
Entry: NC_015711
LinkDB: NC_015711
Original site: NC_015711 
LOCUS       NC_015711            9003593 bp    DNA     circular CON 24-FEB-2015
DEFINITION  Myxococcus fulvus HW-1, complete genome.
ACCESSION   NC_015711
VERSION     NC_015711.1  GI:338529680
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603152
            Assembly: GCF_000219105.1
KEYWORDS    RefSeq.
SOURCE      Myxococcus fulvus HW-1
  ORGANISM  Myxococcus fulvus HW-1
            Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
            Cystobacterineae; Myxococcaceae; Myxococcus.
REFERENCE   1  (bases 1 to 9003593)
  AUTHORS   Li,Z.F., Li,X., Liu,H., Liu,X., Han,K., Wu,Z.H., Hu,W., Li,F.F. and
            Li,Y.Z.
  TITLE     Genome sequence of the halotolerant marine bacterium Myxococcus
            fulvus HW-1
  JOURNAL   J. Bacteriol. 193 (18), 5015-5016 (2011)
   PUBMED   21868801
REFERENCE   2  (bases 1 to 9003593)
  AUTHORS   Li,Y.Z., Li,Z.F., Li,X., Liu,H., Liu,X., Han,K., Wu,Z.H. and Hu,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2011) State Key Laboratory of Microbial
            Technology, College of Life Science, Shandong University, 27#
            Shanda Nanlu, Jinan, Shandong 250100, China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 01/16/2015 16:31:57
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 456760)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 7,223
            CDS                          :: 7,053
            Pseudo Genes                 :: 92
            CRISPR Arrays                :: 5
            rRNAs                        :: 9 ( 5S, 16S, 23S )
            tRNAs                        :: 68
            ncRNA                        :: 1
            Frameshifted Genes           :: 81
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9003593
                     /organism="Myxococcus fulvus HW-1"
                     /mol_type="genomic DNA"
                     /strain="HW-1"
                     /isolation_source="seawater"
                     /culture_collection="ATCC:BAA-855"
                     /db_xref="taxon:483219"
                     /country="China"
     gene            join(9002868..9003593,1..>33)
                     /locus_tag="LILAB_RS00005"
     CDS             join(9002868..9003593,1..>33)
                     /locus_tag="LILAB_RS00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478896.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043712191.1"
                     /db_xref="GI:760029136"
                     /translation="MSTYDELVPVLKKLRLSGLLQSLEVRCREAADANLSLTEFLYRL
                     LADEVERRDGKQLDVRLRRAAFERPSTLEDFDFSFNTSVPRAKVLELGTCTFVERHEN
                     VLVVGPAGVGKSHLAQALGQRACRAGHAVLYVSAHDMLTQLRASRADNSYERRLLRFT
                     TPALLIIDDLGLRPLTGEEGVDLYEIIRRRYERAATCITSNRALEEWPPLFGDALLAS
                     AAMDRLLHHSHVLTIEGDSYRNPPSMISMGATPGS"
     gene            1217..>1579
                     /locus_tag="LILAB_RS00010"
     CDS             1217..>1579
                     /locus_tag="LILAB_RS00010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011552246.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_043712193.1"
                     /db_xref="GI:760029138"
                     /translation="MAAQRLSMRKLRELFRLRFEAKLTTRAIAASLGIGNGTVCDYLG
                     RARVAKLTWPLPPELDDDAALTALLFPEDAKALTERPEPDWAHVHAELKKKGVTKLLL
                     WQECLEAVPGGYQYSRFCE"
     gene            complement(<1888..>2396)
                     /locus_tag="LILAB_RS00015"
                     /old_locus_tag="LILAB_00010"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(2452..4290)
                     /locus_tag="LILAB_RS00020"
                     /old_locus_tag="LILAB_00015"
     CDS             complement(2452..4290)
                     /locus_tag="LILAB_RS00020"
                     /old_locus_tag="LILAB_00015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935115.1"
                     /db_xref="GI:503701039"
                     /translation="MSTFDSTKTLLSDLLTKVVKGKLQLPDFQRGWVWDDEHIQSLLV
                     SIARSFPIGAVMLLETGGEARFQVRAVEGVDLPPNSNPEELILDGQQRLTSLTQVLKL
                     DKPVATRDAKKRELKLHYYFDIEKALLGPQALEDAIVTVDEQRTQREDFGRKVVLDLS
                     TREKEINAFHFPCSQILNSDDWEQALSEHAPEKLARFMKFRRQVVEPFRNYALPVISL
                     RKETSKEAVCLVFEKVNTGGVPLSVFELITATWAVDGFNLRDDWFGGRGKSGRHARLG
                     KRPLLRDLQPTDFLQGVSLLHSFDRRTQDLAAGRSGKEATGVTAKREHILEMPLGAFE
                     KWAESLTQGFEEAERFLRSEGFHHPKFLPYRTQLTPLGAVLAHLGERWLEPQIKTKLA
                     RWFWCGVLGELYGGAVETRIALDVQQLLAWVNEPSAPEPATVQSAGFNPNRLDTLRSR
                     TSAAYRGLYVLLQREGACDFFWKARMVDLDRDDAKLDIHHIFPKKWCEDHDIPPRVFN
                     AIVNKTAISYKANRMIGGSAPSKYLAQLQGHVQVKLDDAAMDTIVKSHVINPALLRAD
                     SFQAFYAARKAALLALVERAMGKASAEATAIGADDEDGDEDEGEAT"
     gene            4551..4922
                     /locus_tag="LILAB_RS00025"
                     /old_locus_tag="LILAB_00020"
     CDS             4551..4922
                     /locus_tag="LILAB_RS00025"
                     /old_locus_tag="LILAB_00020"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935116.1"
                     /db_xref="GI:503701040"
                     /translation="MSGWTSAGTHLWKASVSSTHVPVLALFDGTQLLDVGREFDANEN
                     GGWRFEDGSAAPSTLTLAPFQAVAAGARGARRRRPCGSRPSFRSTSAVCASRKASPDT
                     PMPEAARAPRAEVTPNRSSRH"
     gene            5314..5859
                     /locus_tag="LILAB_RS00030"
                     /old_locus_tag="LILAB_00025"
     CDS             5314..5859
                     /locus_tag="LILAB_RS00030"
                     /old_locus_tag="LILAB_00025"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935117.1"
                     /db_xref="GI:503701041"
                     /translation="MDEGRPKRCVACGRGAYEGGGLGLHGHGLVERQQRGPPTADEAP
                     RCEVVLCRRYRCKPCGAVMRVVPPSVRPRKHFSGEAIGFALALWTLCGLRADEVRRRT
                     SDWTRLGDAARGWRSLARWARQLGARQLFGALPLGAVAQGPRALAARAAQALCAHAPL
                     AWRGAPLERRSSIKPSPEPAM"
     gene            5998..>6717
                     /locus_tag="LILAB_RS00035"
     CDS             5998..>6717
                     /locus_tag="LILAB_RS00035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020734324.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043712194.1"
                     /db_xref="GI:760029139"
                     /translation="MDELVPKDHGEEIAVFRSQVIGPVVHRQLTRGELRGALRELTRQ
                     KFRPPGAERTWHFSMPTLERWYYRFRRHGLAALRPQPRKDAGRAKALDERQKQLVCDV
                     RREHLSASAELILTTLVRQGRVREGAVSAATVRRLLAERGLDRVSLRGTGEGVERRRW
                     EAAYPGALWHGDVCHGPVLTGGTKWEPLRIHALLDDRSHYVVALEARSTEREDDMLGL
                     LVRAARQHGVPETLYLDNRSSW"
     gene            complement(6926..7276)
                     /locus_tag="LILAB_RS00040"
     CDS             complement(6926..7276)
                     /locus_tag="LILAB_RS00040"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708881.1"
                     /db_xref="GI:760025745"
                     /translation="MGRAGSAKPVRQGLRQVSACGGVSVGRARCSGALGERWVAVAVT
                     LDGEDMGVVQQSVHGGAGQQCVTKQRRPLLQGAIGGDASGRTLVATTDNLVQVDALLT
                     REGPQSEVVDDEQG"
     gene            complement(7592..8683)
                     /locus_tag="LILAB_RS00045"
                     /old_locus_tag="LILAB_00040"
     CDS             complement(7592..8683)
                     /locus_tag="LILAB_RS00045"
                     /old_locus_tag="LILAB_00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708883.1"
                     /db_xref="GI:760025747"
                     /translation="MKSSVPFLALALASAVGLLGVTPAHAELPRTPLRGELARVGDAD
                     SAVIWLAGQNGEVDMAVVAKYPHRPLVAPRFFLKHSAEEVFLAVAPDSQPLPEALMSR
                     ESLTRSASQREQLRRDNAAELATMPEFVAEQSSSLAGSCTAQQRTWAASVYGDPTCGQ
                     PPAGNPIFTATVSDYYCEGCENPLGSEEPNACTPDLLPCDRVRRESTSVRLRTTSWNG
                     PVTFQHSGHSAHFAVHNCTGNGPVTFNFSRTGWSGSGSVQLDPQEMWNIKVGDFSAAN
                     AAKKVTMGQWAIGRPESGPTYVFNAMSVDANSGATDAITACGDIITKYRMTDLTVPSC
                     HGNAYVALCNGTNCNNACFHCYGPNGCPN"
     gene            complement(8956..9561)
                     /locus_tag="LILAB_RS00050"
                     /old_locus_tag="LILAB_00045"
     CDS             complement(8956..9561)
                     /locus_tag="LILAB_RS00050"
                     /old_locus_tag="LILAB_00045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_043712197.1"
                     /db_xref="GI:760029142"
                     /translation="MSQSVAGQRRRRGAALEEAILRAAADELTESGYAGLTMDKVAAR
                     AGTNKNTLYRRWPHRLALGIAAYRQLAKTVLPPDTGTLRGDALELLRRANRHWSSPLG
                     AILRELLSAAGGASEFLAQLPEQSNDAAAALWLTLLGRAVKRGEASPEALHPRVSTVA
                     IVLLRNEFVMRGVPTIPDDVLVEIIDEVYLPLVRKRGPPPR"
     gene            9694..10719
                     /locus_tag="LILAB_RS00055"
                     /old_locus_tag="LILAB_00050"
     CDS             9694..10719
                     /locus_tag="LILAB_RS00055"
                     /old_locus_tag="LILAB_00050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935122.1"
                     /db_xref="GI:503701046"
                     /translation="MRAKGISYDTGFLFKGAFSREVFDLEVVKHELRIIRDDLHCNAV
                     RVIGGDPDRLELAATYAADLGLEVWFSPYPLGLSIEEMLSLFTDCAERAERLRKRGAE
                     VVFVTGAELSLMNDGFLPGDSLEERVALLSQPDRLREQVIAVSARVNDFLRKATSRVR
                     ARFGGKVTYAAIPLERVDWTPFDIISLDLYRSAETADRFRDGFRALVAQGKPVAITEF
                     GAASYRGAGDRGARGLEIVEYCKATRRPLRLTGEYVRDEAGQAAYLCELLEIFDAEGV
                     DSSFVFIFALNDHVHRPDGAPQDDLDLASYGIVKVFENRNGDTYPDLPWEPKVAFSAL
                     AEFYRAH"
     gene            10966..12336
                     /locus_tag="LILAB_RS00060"
                     /old_locus_tag="LILAB_00055"
     CDS             10966..12336
                     /locus_tag="LILAB_RS00060"
                     /old_locus_tag="LILAB_00055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935123.1"
                     /db_xref="GI:503701047"
                     /translation="MSRVAGWLVLVLALLVSYRPAEAAQAKKAQAQTTKVAVLRPEGR
                     QAAALRRVLTQELGKKGRGRQVLPAKKVDAQVRRIRGGPKTDAQRQALAKKLGADVLV
                     LASVKGTKRWAVEVRAYSGKDGTLLAEERWDVRANRAFPDVRRELEPRLGAALKAGLE
                     RRLPPAAVTPPTPLSEPEVAPPAPIAEAPRPAGVKPPPPTVKREEPPVESEPTAAGLR
                     DLDGPILEALLSGQGLFRRFNFSGNNANALPDYNLNSAAAASLAVSYFPLSHFTDGVV
                     HNLGIVARGSRALGLSSRLPDGSEYGTTAQLLEGGLRFRLPLRWLEVSVSALYGIHTF
                     AVDLPPESTFALPDVDYRFAHVELGLRKALTERWAIAARVGYQHVLSGGELSSDDYFP
                     ELSGSGLDGELAVEFALTRTLGLRLGGELRSYSFTAGAADGAPVIAGGAKDLYFSGQL
                     GVYLRL"
     gene            12762..14285
                     /locus_tag="LILAB_RS00065"
                     /old_locus_tag="LILAB_00060"
     CDS             12762..14285
                     /locus_tag="LILAB_RS00065"
                     /old_locus_tag="LILAB_00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding protein"
                     /protein_id="WP_013935124.1"
                     /db_xref="GI:503701048"
                     /translation="MARLTHVQWSNSVQELLRLDAPPTTLAGTFRADPAQSGFLFDND
                     ARALSVDEALWGAYQRAAAELAGQVTTDATKLARLLPPSAATDEERARAFVESFGLRA
                     HRRPLTSEEVESYLALYRKGPQAYADMSDFEGGIRLVIEAFLQSPHFLYRVERSTEAV
                     QDRVPLDDYEVASRLSYGLWSAMPDDALFAAASEGTLRSREGVATQARRMLQDARSNK
                     VVEAFHRTLFDVPRYAAIRPSPTRYPQVSERLGEYAARETTLFVQDVVFSRKGGYSDL
                     LTSPNTFVNDELARVYGLSGAFTADFVPVTLDSRERKGVLTQVGFLASHATSVDPDPI
                     HRGVFVSERIICRKIGAPPANIPPLPAPQGRTNREVVASHTEAPGTPCASCHSTLINP
                     LGFPFENFDAIGGYRTTDNGHPVDASSTPNINGETVPVRDALDLADALAANEAVHACY
                     ARHWVEYLHGRPSANEDVPLVERLGKLSQAGNLSIVDLVVEVVTSEGFVNRHPEELP"
     gene            14282..15706
                     /locus_tag="LILAB_RS00070"
                     /old_locus_tag="LILAB_00065"
     CDS             14282..15706
                     /locus_tag="LILAB_RS00070"
                     /old_locus_tag="LILAB_00065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015347739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional initiation protein Tat"
                     /protein_id="WP_013935125.1"
                     /db_xref="GI:503701049"
                     /translation="MKLSRRMVLRGLGGTMLSLPFLEGLMPRTARAADSGVLPYAIFF
                     RQANGVASAQTTSELGAEPERFWPRTLGALTAESIAGRAVGVLDDHRAHLLVVRNVNM
                     RDFNYGDGHARGAMQGLTARGPVVEGAGGGSESGGESIDHRIGRELNPQQRDSLVFYA
                     GRRGGWLGGPCLSYRSSNVRRAALHDPWNAYQTMIGGPGGLTPEAREQLLVRQRSVND
                     LVKAQLQALQQRPELSASDHERLDLHLSNVRDLEVALSCRMRADQELILQQQAPGYDS
                     TDGTEVLATARLHMDIAVMAMACGTNRAAVIQVGNGNDGDTRYRHPDTGQLMENFHYV
                     SHRRSSHDSSGGIITGSDLLHHHVDVQFASAFKHLLDRLVAYQMPDGKRLIEHGVAVW
                     YNDLGNGPAHSARNVPFVLAGSCNGFLKQGVYVEASGGGNPNHNRMLNTIGSAVGLRN
                     AAGGYLDDFGDPALTKGVLSELIA"
     gene            15870..17015
                     /locus_tag="LILAB_RS00075"
                     /old_locus_tag="LILAB_00070"
     CDS             15870..17015
                     /locus_tag="LILAB_RS00075"
                     /old_locus_tag="LILAB_00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epoxide hydrolase"
                     /protein_id="WP_043708885.1"
                     /db_xref="GI:760025749"
                     /translation="MHTPRRRTMRPFTLAIPDSELADLRARLKATRFPPTVEGVGWDD
                     GTDAELLRQLVTHWAERFDWRAAEQRLNAIPQFIEELDGERVHFVHASGQGETRIPIV
                     LANGWPSNFVEFLPLIPLLTAERGGVSFDVIIPSMQGYGFSGRPTKQGMNMSRMGHLW
                     AELMTRLGYEKFLMACSDLGSGVCFSMVRNHPGRLMGVHYLNVFSGYPRPAAPTPEEV
                     DYFRRVDLWNATQGAYVMLHGTKPQTLAVGLNDSPAGLASWIIEKFHSGSRLQDGRLE
                     SVYSLDDLCTLLSVYWFTQTIGSSIRLYKEAFADQELLMPMPRHDVKQGVLVPADVDN
                     PAPRAWGERHLQNLVHWTEARQAGHYPALEDPEHYAADIRAFHRTIR"
     gene            17029..17721
                     /locus_tag="LILAB_RS00080"
                     /old_locus_tag="LILAB_00075"
     CDS             17029..17721
                     /locus_tag="LILAB_RS00080"
                     /old_locus_tag="LILAB_00075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013935127.1"
                     /db_xref="GI:503701051"
                     /translation="MDKTERLFAVMDALRRHRRPVTAAALAKEQGVSLRTLYRDVRTL
                     IGLGAPIVGEAGVGYVLKPGFFLPPLMFTAEELEALVLGSRWVEAQPDVGLAGAARNA
                     LSKIATASPDELRDRMKDTGLWPILMRGGPVSVPVLGLVRQAIREERALRIVYADGKG
                     PPSQRDIWPVQLAFHEGKQIVAAWCCLRQAFRNFRVDRITSAAATEARYGRQRSVLAR
                     EWRDEWKRLYPD"
     gene            <17957..18270
                     /locus_tag="LILAB_RS00085"
                     /note="protein rhiA; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(18582..19058)
                     /locus_tag="LILAB_RS00090"
                     /old_locus_tag="LILAB_00085"
     CDS             complement(18582..19058)
                     /locus_tag="LILAB_RS00090"
                     /old_locus_tag="LILAB_00085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S24"
                     /protein_id="WP_013935129.1"
                     /db_xref="GI:503701053"
                     /translation="MLTAMGAGAALLVAGVAAAAWGRRRWVVVAVQGNSMSPTLHDGQ
                     RLVARRLGRAPAPGNGYSRSDVVVFVLSAKQRETLEAEALPYLVKRVAAVAGDPVPDW
                     ARAALGADDDSRVPPGKVVVSGDNARSQDSRQLGYIDAEAIIAIVRLRGPEPSGTG"
     gene            complement(19058..20884)
                     /locus_tag="LILAB_RS00095"
                     /old_locus_tag="LILAB_00090"
     CDS             complement(19058..20884)
                     /locus_tag="LILAB_RS00095"
                     /old_locus_tag="LILAB_00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_043712199.1"
                     /db_xref="GI:760029144"
                     /translation="MTRTVGAAVALQWRAAPLASVFALLLTLCTGSVAAAGGWLTKAL
                     LDELGRGALADSQRALTLAVGAAAVVGGSMAILNVSEYLTGVIRWGVTLEVERRLFTK
                     VAALEGLHHFEDPAFHGRLRLAEEAARDAPQQLIEFVKATLRMLVTVGTLSAVVLLVS
                     PPMALLLLLAGGVALLAQLVRSRWLVELAVALVPTYRWRDFYHALLVDVRAAKESRLF
                     GLGDLLLERMVASLRKAADRELAVTRKGLAVQAALSLLTAAVAAVGSFIVARGALQGR
                     LQLGDVSLFLAAVAGIQGAFNGLLAQVEFAGRSVQTFKHYLDIIALPVHAPEASRPVA
                     PLRHGVELRDVWFRYDAQGPWVLRGVSLFIPAAGSVGLVGVNGAGKSTLVKLLCRLYD
                     AERGQILWDGVDVRELDARALRRRMTATFQDFMTYDFTAAENIGLGDLDRLKDEARIR
                     DVARLAEIDEKLASLPAGYHTLLSRVLEGEDEDMPAGVSLSGGQWQRLALARALMRQD
                     VDLLVLDEPSSGLDAAAEFHIHRTLARHGEGRARLLISHRMSALRSADTLFVLSEGRI
                     IEQGSHDALMTAGGEYARLFTLQASGYQDERVASRAGQKEVA"
     gene            complement(20911..21432)
                     /locus_tag="LILAB_RS00100"
                     /old_locus_tag="LILAB_00095"
     CDS             complement(20911..21432)
                     /locus_tag="LILAB_RS00100"
                     /old_locus_tag="LILAB_00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935131.1"
                     /db_xref="GI:503701055"
                     /translation="MIETLVVGGVILSVLVVGNLLLTLALVGRLRALQEMIANQVVLR
                     DPALPQKGEPVGSFEATTLEGEAFTDAVLREGKTLVGFFTTGCRPCSSLRKQLVDSPP
                     GMPLMAFVEGDPDDPQTLELGASLKQVARVAFLTEGDSVTRAIKQAGYPTLVLVERGV
                     VAASGHHLHEVLP"
     gene            complement(21429..21962)
                     /locus_tag="LILAB_RS00105"
                     /old_locus_tag="LILAB_00100"
     CDS             complement(21429..21962)
                     /locus_tag="LILAB_RS00105"
                     /old_locus_tag="LILAB_00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935132.1"
                     /db_xref="GI:503701056"
                     /translation="MLATVFALAALGKARGRRPFDEFIQTLESFGLPRALAGAPLAAM
                     LVLTEAASALLLGVGVAAGYALALALLVGFTLGIAWVMRRGEQVACRCFGASNAPVGA
                     AHLVRNGLLLAVTVAGAVSHPSASGGLAMGMGVIAGTVGVLAGLFVTRWDDLVFLLRG
                     PQPLAASPRTRRNRGSQ"
     gene            22783..>23853
                     /locus_tag="LILAB_RS00110"
                     /old_locus_tag="LILAB_00110"
     CDS             22783..>23853
                     /locus_tag="LILAB_RS00110"
                     /old_locus_tag="LILAB_00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015181090.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712202.1"
                     /db_xref="GI:760029147"
                     /translation="MRVLISTYGTRGDVQPFVALAKALRARGHVVALCTPAGFRGMVE
                     RHGIPYAHMDNAVLELTEAVLRAPTRAEQRRLFKGFGAIVRASMEDEWRAARELEPDV
                     LVYHSKALGSHHIAEKLRAAELLAMPLPLTPTRAFPAPMVPSFRLGGWLNALTYRVLA
                     LANAVWAGATNDFRVKTLGLAPRSRFADPMKTVEGSAVPALYAYSEHLLPRPPDWPLE
                     AQVTGCWFLDEGDPWTPPPALRAFLEAGPPPLYVGFGSMGAAHAESRAATVLKAVALT
                     GERAVLASGWGGMKARDLPPHVFMLESAPHDWLFPRMSAVVHHGGAGSTMAGLRAGKP
                     TVICPFLGDQPFWGHMVLRAGAG"
     gene            complement(24408..25955)
                     /locus_tag="LILAB_RS00115"
                     /old_locus_tag="LILAB_00120"
     CDS             complement(24408..25955)
                     /locus_tag="LILAB_RS00115"
                     /old_locus_tag="LILAB_00120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708888.1"
                     /db_xref="GI:760025752"
                     /translation="MHGWHQLVGACLLAVGCGGAMTDAPAPVSPAPGDVTAQWEAPLP
                     ELGPATLLKDLYPPPDEPFPGPFGGPAPTDLLAFRDRLYFSAIDFAAGRGALWRSNGT
                     TASTVPVKRLDDAPGRLTVVGNQLFFTGGFSEEHGNELWVSDGTTAGTRRVKDLTPAS
                     GTAFLENFIAVDDTLFFFRVVRMPLIFSSELELWRSDGTAEGTVRVTELGQEGTFNGP
                     LELASVGGLLFMSFGETDTGTELWGSDGTAEGTHLVKDLFPGPGSSFPRSLTPAAGVL
                     YFSADDGEHGRELWRSDGTEQGTELVEDTRPGPEGSQAQPITVFKQRLYFATFTPRYA
                     ATELRKLNPDPSCHPRSQRVATIPNPYANIPREFFIFVSTFTATERKLYFTLYYDVGS
                     PAPADVQLWRTDGTRKGTKLLYQPLLESPDLLPPRPVPTDDGRVVFYAYDEAHGHELW
                     VTNGQPSGTRLLQDINPGPASSYPQDLLRAGDFIYFTAVDGVHGREIWTLPVPDPEAV
                     QQQSSRE"
     gene            26470..28734
                     /locus_tag="LILAB_RS00120"
                     /old_locus_tag="LILAB_00125"
     CDS             26470..28734
                     /locus_tag="LILAB_RS00120"
                     /old_locus_tag="LILAB_00125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="WP_013935137.1"
                     /db_xref="GI:503701061"
                     /translation="MTLLALALMGLAAGGVLHVAHASDAARWAWAATTAVVLLPTLVS
                     IIKGLLRRETGVDLIAVLAMVGALALGEYLAGAIISVMLTGGAALERFAVARARRELS
                     ALLKRAPRVAHRRVGADISDVDVAEVGLGDFLVIKPGEVVPADGILSSGSAVLDESAL
                     TGESKPVQLDAGTPVRSGGTNAGGPFELRVTASAAESTYAGIIRLVKAAEESKAPFIR
                     LADRYALGFFGLTLALSGFAWFAGGSPSRALAVLVVATPCPLILAAPAALLAGVSRAA
                     KHGIIVKGGGPLETLARAKVLLLDKTGTVTSARPQVVAVETFGPMSSDDVVRHAASVE
                     QLSVHPFAPAILAEARSRSVEPSFPADVREQMGTGIEGTVDGRRVAVGQLAFAAPDTP
                     RTPELRSIKMRTAVEGSSSVYVSINGSLAGVLLIQDPIRPEAPRALRSLRAAGVQRIH
                     MVTGDHPDVAELVGDAVGVDRVFTERTPEEKVEVIKVVRAEGITAMVGDGINDAPALA
                     LADIGVAMGARGATAASEAADVVLTADRLEGLLLATRIAQHTRRIALESIFVGMGLSL
                     VAMLFAAAGYITPVAGAILQEGIDVLVILNALRALGGGGLITPKRPEVKGLAQRLASA
                     HRSLRPHVSELAALAARLDSLEPSDARAQLERLHEMLETKLWPHEREEQQTAYPLLGK
                     MLKDEDPTGPLIQTHHEIHRLARLFGRLVSQLPPEGPRAEDLRDLRRALYGLHAILTL
                     HFAQEEELYSLFEA"
     gene            <29066..30397
                     /locus_tag="LILAB_RS00125"
                     /old_locus_tag="LILAB_00130"
     CDS             <29066..30397
                     /locus_tag="LILAB_RS00125"
                     /old_locus_tag="LILAB_00130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935138.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_043712204.1"
                     /db_xref="GI:760029150"
                     /translation="ARALMAGRAFWNISSTAKGGGVAEIVPRLVAYARGASVDAHWLV
                     LTGTPEFFHITKRLHHALHGSRGDGSPLGAVEHERYDEVLRDNAEELLVLVQPGDVVL
                     LHDPQTCGLAPALAAVGAHVVWRCHIGRDTPNEEVTRAWEFLAPGLAAARLTIFTRAA
                     YVPPQCADRALVIQPSIDIFAVKNQPMTPEVARAILANTGLLRGTPGSPEPIFTRADG
                     VTARVSRCADIMQLGTEPSPDVPLVVQISRWDPQKDPAGVLSAFALLLRQSPNLRAEL
                     VLAGPAVTSVADDPDAAATLQDVLALWRQQSHFVRQRVHLACLPMTDLEENAAIVNAL
                     QRHAAIVAQKSLQEGFGLTITEAMWKARPVVASAVGGLQDQVVHGENGLLVRDPGDRA
                     EFAGAVRSLLEAPERAALLGRRAHEHVRAHFTVTRHLTDFVRLIDLLKARG"
     gene            30846..31532
                     /locus_tag="LILAB_RS00130"
                     /old_locus_tag="LILAB_00140"
     CDS             30846..31532
                     /locus_tag="LILAB_RS00130"
                     /old_locus_tag="LILAB_00140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712206.1"
                     /db_xref="GI:760029153"
                     /translation="MAYASAFAIGAALLAFLATTLQGAGLLLMWPAVSFILVALAYAG
                     AGPKVLGKRPDGRMQPIAVLMLLPYLLLTWGTWHLVRLLSRERPHAMVVPDVVVGRRL
                     LPGELPKGVTVVLDLTAEFIEPDGIRGACQYVSLPILDASTLPAEEVAPVLLGLATVP
                     GPIYVHCAQGHGRTGMIAAALLVARGDAPDEREALAMIQRVRPAVRTSTAQRHALAEL
                     AGALRRASPA"
     gene            complement(32930..33307)
                     /locus_tag="LILAB_RS00135"
                     /old_locus_tag="LILAB_00145"
     CDS             complement(32930..33307)
                     /locus_tag="LILAB_RS00135"
                     /old_locus_tag="LILAB_00145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002615207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_043708890.1"
                     /db_xref="GI:760025754"
                     /translation="MGYIPFGKHEHHTPVTAASGIEDAIQMLEGRWKLVILFHLFGGK
                     TRRFSELERAIPAISQKMLIQQLRQLEQDGIVARIVHAQVPPKVEYHLTEWGQSLCPA
                     LDELLTWAEKRPTPKRRRRPARA"
     gene            33358..33702
                     /locus_tag="LILAB_RS00140"
     CDS             33358..33702
                     /locus_tag="LILAB_RS00140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002633060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708891.1"
                     /db_xref="GI:760025755"
                     /translation="MQTTPNPPPDLPAPIAGYFAHETTSPAAVARCFTDDALVVDERH
                     EHRGRAAIEAWNAAANGKFTFTTELLAAEFDGPLITVRANVTGTFPGSPIQLHFRFTL
                     AGGLISRLEIAP"
     gene            33699..34478
                     /locus_tag="LILAB_RS00145"
                     /old_locus_tag="LILAB_00155"
     CDS             33699..34478
                     /locus_tag="LILAB_RS00145"
                     /old_locus_tag="LILAB_00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002633061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013935143.1"
                     /db_xref="GI:503701067"
                     /translation="MSFNLELKNRRALVTGGTKGVGAAVVTALVEAGVKVVATARTAP
                     SDTQGVHYVAADVTTIEGCARVARDALEHLGGIDILVNVLGGSSAPGGGFAALGEDAW
                     QKELNLNLMPAVRLDRALLPSMLAQGAGVIVHVTSIQRELPLPESTTAYAAAKAALST
                     YSKALSKEVAPKGVRVVRVSPGWVETEASVHLAERLAEQAGTDYEGGKQLIMKSLGGI
                     PLGRPVKPREVADLIAFVVSPRAGSITGTEYVIDGGTVPTV"
     gene            complement(34753..35121)
                     /locus_tag="LILAB_RS00150"
                     /old_locus_tag="LILAB_00160"
     CDS             complement(34753..35121)
                     /locus_tag="LILAB_RS00150"
                     /old_locus_tag="LILAB_00160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935144.1"
                     /db_xref="GI:503701068"
                     /translation="MRNVSTPTLLLSICAIGLILAVGAAWWMGRTSILVVNASERELW
                     SLEVKFPGRTCRYEAVAPQAEVLCEGRADRDGDVEVSYRFDEGGELGVFSTEYVNPTL
                     GWQGSMVLRPDGTIDVTRAR"
     gene            complement(35659..36177)
                     /locus_tag="LILAB_RS00155"
                     /old_locus_tag="LILAB_00170"
     CDS             complement(35659..36177)
                     /locus_tag="LILAB_RS00155"
                     /old_locus_tag="LILAB_00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712208.1"
                     /db_xref="GI:760029155"
                     /translation="MAQQESAASSVARDGCIYSISAYPQPNVTPTVYDVRLFRQPIPT
                     CGYGFGSVTLGTSVVYEPTRSVAMNALGIAASYTKKSSLSGSAPITLSVHHVDPATLT
                     VIRSSSLGVHLGAGNIVSETVAIAADGTTVTVSGSKTGVIWGESGSGSHYTATFPDFF
                     TSTTPPTVMAFP"
     gene            complement(36559..38007)
                     /locus_tag="LILAB_RS00160"
                     /old_locus_tag="LILAB_00175"
     CDS             complement(36559..38007)
                     /locus_tag="LILAB_RS00160"
                     /old_locus_tag="LILAB_00175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NHL repeat containing protein"
                     /protein_id="WP_043708893.1"
                     /db_xref="GI:760025757"
                     /translation="MSYLLPRWLAAPAAALRAGLVMALAASTLGACRDNDPPPNAPPV
                     ARDVTVETVEDTPLELHLPASGSGALTFTIVEAPDHGTLSEVGANGSLTYTPGADYHG
                     EDALIFRATNGQGQSAQATVTITIAPVNDAPTLSTVADQRIPAGSSTGDLAFTVGDVE
                     THPDGLVVTATSSNTDLVPDDPANLLFGGSGSGRTLSVVPTANASGSTTITLTVSDGS
                     DTTSTTFTVDVTALASLYWMTAAGSLWRIDVNGANAIELATGISGGSSVATDPVTRTL
                     FYTRDSAIVRADSDGANPVDVVANGGYPSGLAVDSTNRKLYWSDFNGSRVMRAELDGS
                     SPTQVVGGINSPSAIAFDIPNDKAYVITYNNTRLVRFSLDGSNLETVASNLGGLGVGL
                     AVDSSGGKVYYSTRGNSIYVADLDGSNVTTLVTNQTTVHGIAIDVTAGRMYWADWLGT
                     ALRSANLDDGGDIQDVNSGSARNLGLAWMPAP"
     gene            <38337..38618
                     /locus_tag="LILAB_RS00165"
                     /old_locus_tag="LILAB_00180"
     CDS             <38337..38618
                     /locus_tag="LILAB_RS00165"
                     /old_locus_tag="LILAB_00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012524856.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712210.1"
                     /db_xref="GI:760029157"
                     /translation="PMPRPPPPHRREVIEVKEIHARRVSARVIYAKEVKARDGRVGRI
                     VRGEPRRENWGGSELKVRNVSADVIRAKELHADWLEADGIHAKEVRFGR"
     gene            complement(38741..39781)
                     /locus_tag="LILAB_RS00170"
                     /old_locus_tag="LILAB_00185"
     CDS             complement(38741..39781)
                     /locus_tag="LILAB_RS00170"
                     /old_locus_tag="LILAB_00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935149.1"
                     /db_xref="GI:503701073"
                     /translation="MNPGVSIVADDTRSWGLETPGPGLVLRVPSTGRWARRPWVHLEA
                     APDYRIRLRGGRQTLLWARIDSYWDSAVFVRGTATAPLVLPPLSAPEVRAVEAASGSE
                     AWWEAWSWRMARALVDAPLPVLHSGHWCLRPVHAIAAEKAERHPISPMEWSFGQPPPP
                     PHSLASVTRFLSGWSEDWWESLPEQRPGAVLGLRALSAPEDGRVKSWRKRARDGTLPP
                     VLLLFVDILAKWVVLDGHDRLHAALLEGVTPQLLGLWPFIIRPRPEKSTREEGALVSA
                     EFLFRGGATPETVDRVNRMLLFSFSADPRGTVSRAWPLPGGRETWREEVSARRREGPL
                     PLLDETDWDWLT"
     gene            complement(39778..40467)
                     /locus_tag="LILAB_RS00175"
                     /old_locus_tag="LILAB_00190"
     CDS             complement(39778..40467)
                     /locus_tag="LILAB_RS00175"
                     /old_locus_tag="LILAB_00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015243681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935150.1"
                     /db_xref="GI:503701074"
                     /translation="MHGFRFDAHQQMTGVVLDTFHVFLCLDGRASIRRSMNDSVELMD
                     LGPGDVLVNPMAMSLRWSSSGAFEVLNIAVHPGYLEEAVRESMRGLVRLRPRALPYAP
                     VPSLVQLGREPHREVSTPGLLGAQRGARAAGERIALHLLRNFVDVERAGHDRTFTPEE
                     RLDQPVRVEHLAALVRLGEHHFSRTFRVIFGSARLNGGVQAVRAAGGTGVSWGTLHGA
                     MDSGQIEERVA"
     gene            <40659..>41168
                     /locus_tag="LILAB_RS00180"
     CDS             <40659..>41168
                     /locus_tag="LILAB_RS00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013375205.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_043712212.1"
                     /db_xref="GI:760029159"
                     /translation="LTDPNRLQAIRDTGLMDTPQEEAFDRLARLAAQLLDVPLTIMSL
                     VDADRQFFKADFGLPSPFRETRQLPIDASLCRYTLEGEPIISSNAPADPFLKFHPSTG
                     PWGIVALIVLPLINPEGHVLGTFCCIQPSVREWTARDHTVMRELTASIMTELNLRDQI
                     RKLKVEQNLR"
     gene            41602..41856
                     /locus_tag="LILAB_RS00185"
                     /old_locus_tag="LILAB_00200"
     CDS             41602..41856
                     /locus_tag="LILAB_RS00185"
                     /old_locus_tag="LILAB_00200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002617291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="WP_013935152.1"
                     /db_xref="GI:503701076"
                     /translation="MVLQVRNQGAPIAADELQTIFEPFHRARSAAESAAKGWGLGLPL
                     VRGIAEAHGGKATVTSSADEGTCFTVTLPVDATGQQRLTA"
     gene            complement(41910..42719)
                     /locus_tag="LILAB_RS00190"
                     /old_locus_tag="LILAB_00205"
     CDS             complement(41910..42719)
                     /locus_tag="LILAB_RS00190"
                     /old_locus_tag="LILAB_00205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_013935153.1"
                     /db_xref="GI:503701077"
                     /translation="MSKRTDEQLVKAARSGDGEALDEVLTRHEKQVYRFGLRMCGSEE
                     DAMEVLQETLLTAFRGIHAFRGDAALSTWLYQVARTHCFRLRRRRAGAPEDFQPLDMP
                     AATQVVAQEATPDMVSHARQMGEVLQAAILALPEAYREVLILRDVEGLTAEEAARVVG
                     VEVRALKSRLHRARLQMREHLATLMGEGAPGQHPGCPALARELAEFAEEAVDQAACSR
                     LEDHLSRCPRCSEACDALKRTVSLCRRIPGDEVPAPVRAAVRHALVQALPT"
     gene            complement(<42772..43185)
                     /locus_tag="LILAB_RS00195"
                     /old_locus_tag="LILAB_00210"
     CDS             complement(<42772..43185)
                     /locus_tag="LILAB_RS00195"
                     /old_locus_tag="LILAB_00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935154.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043712214.1"
                     /db_xref="GI:760029161"
                     /translation="MRSSLSAFLSGVLFALGLGLAGMTDPANVLGFLDLAGDWDYRLA
                     FVMGGAIAVHAALRPLIHRRARPLFAATFAALPRGRPDAPLLMGSALFGVGWGLAGYC
                     PGPALTALASGAGQVLVFVAAMLVGFSLARVLQAPS"
     gene            complement(43198..43626)
                     /locus_tag="LILAB_RS00200"
                     /old_locus_tag="LILAB_00215"
     CDS             complement(43198..43626)
                     /locus_tag="LILAB_RS00200"
                     /old_locus_tag="LILAB_00215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YeeE/YedE family protein"
                     /protein_id="WP_013935155.1"
                     /db_xref="GI:503701079"
                     /translation="MTSSILLPLLGGALIGLSASLLLLANGRVAGISGVVGSLLAPVR
                     GDIAWRVLFFAGLLAGGLLLSWLRPSAFPVPSSPSAGGVWLLVGAGLLVGVGSRLGNG
                     CTSGHGVCGISRGSARSIAATLTFMATGVLTVFVVRHVLA"
     gene            43721..44440
                     /locus_tag="LILAB_RS00205"
                     /old_locus_tag="LILAB_00220"
     CDS             43721..44440
                     /locus_tag="LILAB_RS00205"
                     /old_locus_tag="LILAB_00220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="WP_013935156.1"
                     /db_xref="GI:503701080"
                     /translation="MIFRQLFDSESSTYTYLIGDEATRQAVLIDPVLEQAGRDLKLVA
                     ELDLTLTHVFDTHVHADHVTASGVLRERTQATVVGGVGGASCANLHVRHGDAVRVGQL
                     VFQVLATPGHTDDSVSYLLGDRVFTGDALLIRGNGRTDFQNGNAGQLYDSLTRVLFAL
                     PDSTLVYPGHDYQGRTVTSIAEEKRHNPRVANQSREAFIHIMEHLNLPKPRRLEVAVP
                     ANRGCGHPTPAPASLDSTAAS"
     gene            complement(<44489..45267)
                     /locus_tag="LILAB_RS00210"
                     /old_locus_tag="LILAB_00230"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            45393..45581
                     /locus_tag="LILAB_RS00215"
     CDS             45393..45581
                     /locus_tag="LILAB_RS00215"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708895.1"
                     /db_xref="GI:760025759"
                     /translation="MDTVLGGLRQSLRSLGRSPGFTLMCVLMLAVGIGASTALFSVVE
                     GVLLRPLPYPRPGAARAR"
     gene            complement(<45571..46482)
                     /locus_tag="LILAB_RS00220"
                     /old_locus_tag="LILAB_00240"
     CDS             complement(<45571..46482)
                     /locus_tag="LILAB_RS00220"
                     /old_locus_tag="LILAB_00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935160.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_043712217.1"
                     /db_xref="GI:760029164"
                     /translation="MMRIHWLLAAALLTVSCASRPVPRDEPVTLQDTFQFDLGSAHTG
                     RTHRIYVAVPKGPAPAAGHPVIYLLDGDAHFPTLERLMRALPRLAKGFGVPAATPIIV
                     GLTYAGDAAASAQARGEDYTPPAPDVSNTGDRFSKKQGGADRFLDFVKQELEPALAAR
                     LPLDGSRTALMGHSYGGLLVLHALFTRPASFNTFVAGSPSIWWNGRYVLTEKTAFVER
                     AAATPVKARVLLTVGGLEQTPRKSAGPRGMFAAQRRMVDNTRELAAELSAMGGDDFQV
                     QYLEFPGDDHYSSWLPLLNRGLLYFTAP"
     gene            complement(46569..47855)
                     /locus_tag="LILAB_RS00225"
                     /old_locus_tag="LILAB_00245"
     CDS             complement(46569..47855)
                     /locus_tag="LILAB_RS00225"
                     /old_locus_tag="LILAB_00245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935161.1"
                     /db_xref="GI:503701085"
                     /translation="MKLKTALLALAVFATACSDSEDPTPPDSGTPDPDAGTSQPLYAA
                     ITQVAIAGGNTQSYLVTLDDIEEAQTVGIDDAVELPSDSYIATGVPGTGRFFVSSSRV
                     PTMTPYTLNADGSIVAGDPLSFTGQGVAATNGYQSQHYFVSETKAYYFDHVNYKLVIW
                     NPQDLSIITSRDLTSELKDGDFTFRYSQSLAVTAGNDVIIAGGWHASDVRTIPAKTAL
                     VIVDTQTDEVTVKTDNRCGWARDGVKHTDGKVYYATESLGSGAHFVSPGTAGAPCMIR
                     FNPATGEFDSWFTTLDSFVNPGTEGDIAAMLLPGAPGKGYLRVMNKTAAQTAWDAAVA
                     AERPFNGQSAAVGAWWSLWEVTLGEAPTATAVVRDDLVPTNGRTIPQNPGELLVLPEF
                     INDNAQTRFRLMSPETGLGDAKTVVEGQVRGLLRIR"
     gene            complement(47914..50514)
                     /locus_tag="LILAB_RS00230"
                     /old_locus_tag="LILAB_00250"
     CDS             complement(47914..50514)
                     /locus_tag="LILAB_RS00230"
                     /old_locus_tag="LILAB_00250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_043708897.1"
                     /db_xref="GI:760025761"
                     /translation="MPTLRRRRGSPAPFSPVSTCALLALLSAGVARAQDASEPPASAA
                     SDSPATETPHSQAPAGEGGPAPAGGIVPPVLLAQPEAVYPPEAVASGIEGAVKLLLTL
                     DAEGRVSRAEVVEGLGHGLDEAAVRALENARFSPALQDGNPVPCQFEFIHHFVRGPSP
                     DVAPPAEDAAQGTADAPVAEEAAPSPEAAEPPAGFTSVVRGKSTEARALVRGSESVDV
                     VELEKAHERAEDLAEVLTRASAVQVQRTGGLGSRTQLSLGGLSGDQVRVLIDGVPIEY
                     SPYVYGLGSVPVSLIRQLEVFNGVVPVRLATDALGGAIHLRSDLASPETGASLSLQGG
                     SFGSYRGTGRLTWRANEHVFMRAAGFHDRARNDYRITVPVDDPTTGRVSPRALRRNHD
                     AYRGTGGDLKVGFESLPGIDRLVLNAYLGRYDKEVPHDQFMVQPYGAVTSAQESWGLG
                     LRYAVSPHERLKVLAIAGYNERVGELLDVTECLYDWYGTCRATRARAGEIGATPLENT
                     QMRTTLFGRVRLLGSLFDVEDLEVSLGVDDSDRSGENAYLTRLQQEDPLRVPLALTSS
                     FGGVSHRQVLWGGKLENTAFLKGYLQRFASGTRQEAAEVRWAGGFGDTVRFSLTRGLL
                     LKASYERTTRMPRVDELFGDGGLLVESADLVPESSHNANLGVELLPIVTPVGRFGATA
                     VAGVRDVENLIQLFPGDATQAYENVDHARSYTAHAGLDWASPGDWVGLNGTVTWLNFR
                     NLAQEGQFSRFHGDRIPNMPWLQASATARLQVSRLLSSADALGLEWTTRFVESFYRSW
                     ESAGRGGDKERVPTQVLHFAALTYRTRFDRRAFSFSFNLQNLTDAPAYDIVGVQKPGR
                     AFSARATVDL"
     gene            50935..52125
                     /locus_tag="LILAB_RS00235"
                     /old_locus_tag="LILAB_00255"
     CDS             50935..52125
                     /locus_tag="LILAB_RS00235"
                     /old_locus_tag="LILAB_00255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase"
                     /protein_id="WP_043712218.1"
                     /db_xref="GI:760029165"
                     /translation="MTSSWAVDCRSRRAPLGLMESHLMELPLNPALRINLGKRAGVTA
                     GLLGVLCVCAEFCFLFPHLLVSNDSRAIYVEHLGLVRGILQAAIVATFALGAVSVLTL
                     RSKAHGGIAMLLALVAMLLGGSEAEPLTQQPRAMSAGLDYFALELFVLGLVFIPMERL
                     WGLHPQRIFREGWQTDLKHFFISHVGVQLISFAVMIPVQVFLAWAVRMDFQAHVAAQP
                     VWLQFFEILVVVDLVSYWVHRAFHQVPWMWKFHAIHHSSQQMDWLASSRSHLLDVLVN
                     RFAGFVPVFLLGFSPSAIYGYLVFVSFHAVYIHANVNHRWPYLRWVFATPEFHHWHHT
                     SDEEGIDKNFAVFLSFIDAIFGTAHLPAHWPSRYGTTKFQPPETYLGQLAYPFQRHEE
                     TAYG"
     gene            52204..52845
                     /locus_tag="LILAB_RS00240"
                     /old_locus_tag="LILAB_00260"
     CDS             52204..52845
                     /locus_tag="LILAB_RS00240"
                     /old_locus_tag="LILAB_00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013935164.1"
                     /db_xref="GI:503701088"
                     /translation="MPRPPKHAPERGDARTRLLEAAREVIRTKGFTATSVDELCQRAE
                     VTKGSFFHHFKSKEALGVAAAEHWAETTSAFFAGAPYHAPSDPLERVLAYVAFRKSMM
                     AGDLAEFTCLVGTMAQEVHASSPDIRDACGASILGHAATLEADLDAAMTERRIAGGWT
                     AQSLARHTQAVIQGAFVLAKAGNDPALAHESLDHLDRYIRLLFGRPLQEKALP"
     gene            52842..53381
                     /locus_tag="LILAB_RS00245"
                     /old_locus_tag="LILAB_00265"
     CDS             52842..53381
                     /locus_tag="LILAB_RS00245"
                     /old_locus_tag="LILAB_00265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935165.1"
                     /db_xref="GI:503701089"
                     /translation="MNPPPQLRCACGQVQLQVTGAPIVSAECCCTSCRTAGATLQALP
                     SAPRILGPHGTTRFELYRKDRVHFLEGAHHLKEHRLTPEAKTRRVVATCCNTPVFLEF
                     ESGHWLSLYGCLWSDGTLPRLELRTMASDLPPGVVLPDDVPNSRTQSFSFFVKLLGAW
                     IKMGFRSPKLAFVQGTLQR"
     gene            complement(53541..54512)
                     /locus_tag="LILAB_RS00250"
                     /old_locus_tag="LILAB_00270"
     CDS             complement(53541..54512)
                     /locus_tag="LILAB_RS00250"
                     /old_locus_tag="LILAB_00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935166.1"
                     /db_xref="GI:503701090"
                     /translation="MRRIIVLLAALNLVACAHGGGTPEALAPEAATVAKPKPVATPEA
                     KQAASEANGLSMKGDNAGALPLYRTAWEGGVRGRNLAYNAACAASLLEEREEALVWLE
                     RAVEEGFNDAKHLQKDSDLDNVRSLPGYAALEQRVVAAEAEQYVAADPALRDELLKRM
                     EEDQAVRNALAASNFQDEAARAKLREVDARNTTWLKGVIAKQGWPGSALVGPRASFAA
                     WLLVQHADQDVAFQSEVLPMLEQAVARGEGSAKELAYLTDRVLVNTGKPQRYATQLEE
                     VDGKTVPRTLEDPAKVNERRASVGLDSLEEYIAAFERMKAAATQQKP"
     gene            54616..55053
                     /locus_tag="LILAB_RS00255"
                     /old_locus_tag="LILAB_00275"
     CDS             54616..55053
                     /locus_tag="LILAB_RS00255"
                     /old_locus_tag="LILAB_00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708899.1"
                     /db_xref="GI:760025763"
                     /translation="MRPAKGRKMKNQPVTDGESASKVISEKIAELGDWRGETLARMRA
                     LIKEAAPDVVEEVKWRGTPVWSQDGGICTGETYKTAVKLTFFKGASLEDPAGLFNSSL
                     DGNVRRAIDIHQGEEVDAKAFKALIRAAVALNTAGGKKSTKRK"
     gene            complement(55274..56296)
                     /locus_tag="LILAB_RS00260"
                     /old_locus_tag="LILAB_00280"
     CDS             complement(55274..56296)
                     /locus_tag="LILAB_RS00260"
                     /old_locus_tag="LILAB_00280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyhypusine synthase"
                     /protein_id="WP_013935168.1"
                     /db_xref="GI:503701092"
                     /translation="MSASELPVLEFVLTNYKNFNARATRDALLSYWEHVSSGGRMFWS
                     VAGAMSSAQLGITLAPAIRAGLIHGLSVTGANLEESLFRLVAHSAYKDFPEYRYFTKQ
                     DDTKILEQRMRRVTDTSIPEDEAFRAVEKYVVPMWKTATEKGQRRFWHEYFYEVIQML
                     EPSSYEGDPEACWLLEAARRKLPIVVPGYEDSTFGNIFASYVKTGECNASIVKSGIEY
                     MADFYDRYEELSAGKGVGFFQIGGGIAGDFPICVVPSIKYDLQKPVKPWAYFCQISDS
                     TTSYGSYSGATPNEKITWDKLTETTPMFVIESDATIVAPLMLRALLEAQSKPEAAKAL
                     IAKHQR"
     gene            complement(56452..56976)
                     /locus_tag="LILAB_RS00265"
                     /old_locus_tag="LILAB_00285"
     CDS             complement(56452..56976)
                     /locus_tag="LILAB_RS00265"
                     /old_locus_tag="LILAB_00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_043708901.1"
                     /db_xref="GI:760025765"
                     /translation="MRTGRPRDEKVRLAILRAAQELVLEKGYSAVTTADVAKRAAAGK
                     QTLYRWWPGKGALVLDAFSEWVSQAPRMSRRKPSLSSTLVEFCRGASEAAPVLRALMA
                     EAQFDEDLHRRLIAQLVRPRGDELRACLADRRPADRELVVNVLSGLVWQRLMLNEPLD
                     ARFVRFALRVVQRI"
     gene            57119..59014
                     /locus_tag="LILAB_RS00270"
                     /old_locus_tag="LILAB_00290"
     CDS             57119..59014
                     /locus_tag="LILAB_RS00270"
                     /old_locus_tag="LILAB_00290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidase"
                     /protein_id="WP_043712221.1"
                     /db_xref="GI:760029168"
                     /translation="MSKQSGLLRRLGNVALTEVSERFGGSPSTPASGDTRFTPPAAPA
                     SKDEESLEGWGFADTRFVVKPDGNTVLTGTRYNISNVELPELMPWFAGKLASPLGYDN
                     RNEPHYPPEIPAAKQDAKLVAALREFLKEEQLTDDPKQRLRRGHGHTGGEIWAIRYRK
                     LDRVPDLVVFPRGHDEVVRLVEVATKHGACVIPFGGGTNVTEALRIPLAEERFVIAVD
                     MRQMNRILWVDPVNRMACIEAGATGRHLMEALAKFGFTMGHEPDSLEFSTLGGWIATN
                     ASGMKKNRYGNIEDLVLDMQVVTAQGIVERPRQAPRESVGVNPRQYMFGSEGNFGIVT
                     TAVVKLFPLPEVQRYGSVIFPDLETGLSFLYALQQSGAVPASVRVMDNTQFHFGQALK
                     PAKHGLAAKLKSEVEKAVVTKLKGFDPYKLAVATLVFEGSSEEVAFQEKTVYRIAAEH
                     GGMKGGGANGERGYQLTFGIAYIRDLTFEHWAIAESFETSVPWSRAMDLYERVQRRVE
                     KEHAAMGLPGKVFFTGRFTQVYQTGVVIYFYLGFYAKGVADPVAAYAALEHAAREEIL
                     AAGGSLSHHHGIGKIRRGFLPEVYSEGALALNRKVKAAIDPDNVFGASNSGINGPVAL
                     TPDEEAH"
     gene            59014..61620
                     /locus_tag="LILAB_RS00275"
                     /old_locus_tag="LILAB_00295"
     CDS             59014..61620
                     /locus_tag="LILAB_RS00275"
                     /old_locus_tag="LILAB_00295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935171.1"
                     /db_xref="GI:503701095"
                     /translation="MSRHVFLTGVTGFVGKVVLEALLSQGVERVTVLVRESKDRQGRV
                     HSAAERFAKVAQAECFSRLPAGWTERVAVVSGDLEQPACGLAPADSEAVRQHVTHVVH
                     CAASVEFDLPLAQATSANIRSALSVLELARACPRLVGMVDVSTAYVNVWRPGPIEEKL
                     AHLPKPAAELYAAFQVAEGEGREWLELTGHPNTYTLTKSVAEHLICEQRGHVPVVIVR
                     PSIVSAAYRTPFPAWLDSPAALAGCLLYSGLGVVRAFNADPSVRLDVVPVDVVASEVV
                     RSVFGPMPKPGQAVPIVHATMGVQRALRIDMAAASTIEWFKHRPGVVKAPDMFVGRKD
                     HGFDTVDLVRRELPVQLQKAALALLGQSKAHRRLVRADEKVQYLNEGFSYFTHHTFDF
                     VRGAPLEVPGFDPFDYVRVVNEGMYRHLLSRDETQVSFAGPKHDDARGDRAWVQERGV
                     GNATHKVFGYALRKTFRHCTSDVTFDRPSFERAMAQVPPGTLVVLAPTHRSYFDFLLT
                     SYLCFQHPELGISMPHIAAAEEFGRIPVVGPILKESQAFFIKRGVGREVPELGEELRR
                     LTEKNASLMFFVEGQRSRARLMLPPKRGLLRALQNTQRKFVVLPIAISYDRLPEEASL
                     SEELSGRPRPKMTLTGVLSWLSKLARGQVQLGRVHVACGAPQALNPDTDVRALSHTLM
                     AELQRHTTVSSFHLRTFLAEHPIPGVDEAWLRDAIERRGGRVVDSDLPVPTPLSPALA
                     HSLRNQWQHWFAGDVLARQPGNPALEDHLSRYRWCATPLAELSDARVDAVVKALFEPV
                     VRDYQEATKVRAPDELKAVAVTHRPHLDGVVQALVSRDIVKPSGDNFEWGPNAAELSQ
                     FHEACAWRGVQP"
     gene            61593..62582
                     /locus_tag="LILAB_RS00280"
                     /old_locus_tag="LILAB_00300"
     CDS             61593..62582
                     /locus_tag="LILAB_RS00280"
                     /old_locus_tag="LILAB_00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_013935172.1"
                     /db_xref="GI:503701096"
                     /translation="MRLARGAAVKTLVTGASGFLGRNLLEALGDDAVALVRSPLPGAV
                     AQVSGTPLDPDAWLPRAQGVKVVIHAAGMVHHSRQHAEEMVRFNIDSALAMVRAAKAL
                     DARLVLVSTSGTVGCFAHPTIEADEHSLYAEGLVGRWPYYLSKIRAEEQSRKLAKQLG
                     VALTVVRPPVLLGPGDTLGRSTTNVARVLNGRLPFIPTGGIAFTDVRDVAHALAVLAK
                     KADWRDTYHLPGTALPLRTFFERVGEVAGIRVNRPGVPTLVVDGLAKLGSHVPLKKLP
                     DPVVLEMSTCHWGFKTLWSHEELDYRPRSHRQTLSDTVAWLREAQARQTPLAG"
     gene            62732..63549
                     /locus_tag="LILAB_RS00285"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            63756..64061
                     /locus_tag="LILAB_RS00290"
                     /old_locus_tag="LILAB_00310"
     CDS             63756..64061
                     /locus_tag="LILAB_RS00290"
                     /old_locus_tag="LILAB_00310"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935174.1"
                     /db_xref="GI:503701098"
                     /translation="MKLTAALLGLVSLLAMPEARASGDTASPVQDWNCDGAINSFDLL
                     LYETYYWSPGLPPWPLDPDGNPIYDQVEACVRCHEGNLTAPQELPTNKGGLMKSGCS"
     gene            64612..66690
                     /locus_tag="LILAB_RS00295"
                     /old_locus_tag="LILAB_00315"
     CDS             64612..66690
                     /locus_tag="LILAB_RS00295"
                     /old_locus_tag="LILAB_00315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_043708903.1"
                     /db_xref="GI:760025767"
                     /translation="MELSSLESSFWAIAPGVVGAVGLLFAAVFYFRVKSLPEGDATMN
                     RIAGYIREGAMAFLVREYKVLAAYCAVIAVLIGLALGPLASGSFVLGAFLSLLAGYIG
                     MKAATYANVRTAQAARGGSKPNALLVALDGGAVMGLAVAGLGLLGMGGVYYAFQGHAQ
                     LSPILHSFAVGASSIALFARVGGGIYTKAADVGSDIAGKVIENIPEDDPRNPGVIADN
                     VGDNVGDVAGMGADIYESMVAAIVAAMAIALTANATELSRLVVDPAATGTAKVAGVVL
                     PLVLSAVGLVVSLLSIFIARALKNMNPAQVLRSALILPPVILVGLSFVMMQVFGLSQA
                     ITAALAAGAFGGAIIGLVTDYYTSARPVQRIAEASITGAGTNLIRGLAVGMESVGISM
                     ATIAVVAYIADQALGLYGIALSAVGMLGGTAVVMTVDAYGPISDNAGGISEMSGLGPE
                     VRAITDELDAVGNTTAAIGKGFAIGSATLTVIALFSAFNLEVNHTRVAGGLPEMSLML
                     TDPRVIVGLLLGSILPFMVGASTMLAVGRAAGAIVEEIGRQFREIPGLMELKADPDPK
                     KIVDIATKSALREMIFPGIVAVVAPPLVGFLLGPSALAGLLAGALVVGATMALYMANA
                     GGAWDNAKKYIEKGKLPGHAKGSAVHKAAVVGDMVGDPFKDTSGPGVAILIKVMSVVS
                     LLVASLIALR"
     gene            66901..67104
                     /locus_tag="LILAB_RS00300"
                     /old_locus_tag="LILAB_00320"
     CDS             66901..67104
                     /locus_tag="LILAB_RS00300"
                     /old_locus_tag="LILAB_00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935176.1"
                     /db_xref="GI:503701100"
                     /translation="MVLELSQQQLHLLHACLAESAEQLRDEVLHTDERDLREALKLKL
                     DRLQKLQRQVEATMRAQEGTPAY"
     gene            complement(67153..68391)
                     /locus_tag="LILAB_RS00305"
                     /old_locus_tag="LILAB_00325"
     CDS             complement(67153..68391)
                     /locus_tag="LILAB_RS00305"
                     /old_locus_tag="LILAB_00325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013935177.1"
                     /db_xref="GI:503701101"
                     /translation="MSFIRAVHGNAGASISHGGSAPMSGALRLLLAVSAGVPVAALYY
                     SQPMLGVIGASTRASDAVVGFLPTLTQLGYALGILLLTPLGDRFDRRRIILVKAALLS
                     VALLLGGLAPGMSLLLVMSFAVGLTATVAQDIVPAAATLAPERERGKVVGTVMTGLLL
                     GILLSRVVAGVVAEQLGWRAMFLIAAGSVALIGVAAWRGLPRFQPTSTLSYGALLGSL
                     AVLWRRYGPLRRAALAQGLLSVGFSAFWSTLAVMLHGAPFHLGSAAAGAFGLAGAAGA
                     LGAPVAGRFADRFGPEVVTRLGAGLTALSFATMFAAPWLEPHARLWLIAGSAIGFDLG
                     VQMSLVAHQTIVFGIDPEARSRLNAVLFVGIFIGMSVGAASGSLVLARWGWAAVTVLA
                     TGAALAALLVRLAPAGRVAR"
     gene            68613..69509
                     /locus_tag="LILAB_RS00310"
                     /old_locus_tag="LILAB_00330"
     CDS             68613..69509
                     /locus_tag="LILAB_RS00310"
                     /old_locus_tag="LILAB_00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013935178.1"
                     /db_xref="GI:503701102"
                     /translation="MQTFIRIVDAGSLSSAAAQLGTTQPTVSRRLQALERSLGLRLLQ
                     RSTHAMKLTEDGARCYGRAKELLASWELLEADLRGASNEPEGTLRVVVPHAFGQQLLV
                     EPLTEYLNRHARVSVEWLLHDRAVDFITDGIDCAIHVGEVHDPSVVAIRVAEVPRIVV
                     AAPSVLGGSSPPTHPDALARLPWLSLRTFYRNELSLTHVDTGEVQPITFQPRLSTDSL
                     YAIRSAALKGLGVCVASAWLLQEDLAQGRLVHLVPQWRAASLPMYLLYPHARFHPARL
                     RKFVELMRATIPAALAVATRAR"
     gene            69590..>72652
                     /locus_tag="LILAB_RS00315"
     CDS             69590..>72652
                     /locus_tag="LILAB_RS00315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011553226.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_043712222.1"
                     /db_xref="GI:760029169"
                     /translation="MSGDSPVPTPGGLPTLRFPPELPISSRVEDITAAIRAHQVVIVA
                     GATGSGKTTQLPKILLAMGRGRPRQIGVTQPRRIAATSVAARVARELGTELGTDVGYQ
                     IRFEDRSSRQTAVKFMTDGVLLAQIHSDPLLRRYDTIVLDEAHERSLTIDFLLGWLKR
                     ILPRRPDLKVVVSSATIETERFSQFFGGAPVVQVEGRTFPVDVLYEPPPEDAELADAV
                     ADAVANVLSLDPDGDVLVFLPGEREIREAENALNARELRGTVVQPLYARLSAAEQSRV
                     FATIPQRRVILATNVAETSVTIPGIVYVVDTGVARLSRYEPRSGTTRLHIEPVSQASA
                     DQRKGRCGRVREGICVRLYDEVSFTTRPAFTDPEIKRTGLAGVILRMKSLGLGDVEDF
                     PFLDPPQPKAIAEGWRVLEELGAIEGKERTLTPLGHQLARFPVDPRIARMILAGVEYG
                     CLDEVLIVAAALNLQDPRERPRELAQKADALHARFRDEHSDFTGLLKLWAFVREAEGR
                     GTSHLRRVCRDNFLSFLRVREWRDVQRQLEETVRELRLPRKGRGAPARGDVLHQALLT
                     GLLSRIGQWNPEQRHYTGSKQTRFMVHPSSALAKKPPAWVMAFELVETSQLFARTVAK
                     LDPEWLAAAAPHLLKRSYSDPHWSEKSARAIVKENATLFGLTVFRERPVPLASRDPAE
                     ARLMFLEHALVRGEYRTRGAFQEKNRQVFERVARLRDKARRSELLDSEAMLTFFDKRV
                     PADVTDGAGFEVWRRKAEAADPDVLVLSMEDALSHDPGLSPAHYPDALKLHGASVPVT
                     YTFDPSAEDDGITLSVPLLLLAQIGPGELDWTIPGWQREKLTALLEQLPRAQRKQLGP
                     LPDLVDLLAKELEPFRGPMIPALARAVSRLCGVDVSEESFRADAVVPYLRITLRVLDE
                     RGKELARGRDVDALLKQHGGHARAALRSAAPASDWERKGLTAWTFGELPAVVTRRIGN
                     LEVRSHPALVDRGATVDLVLLETSAAADAATRTGVRRLLMLAARGHVQL"
     gene            73032..74438
                     /locus_tag="LILAB_RS00320"
     CDS             73032..74438
                     /locus_tag="LILAB_RS00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002633373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708904.1"
                     /db_xref="GI:760025768"
                     /translation="MEDALSHDPGLSPAHYPDALKLHGASVPVTYTFDPSAEDDGITL
                     SVPLLLLAQIGPGELDWTIPGWQREKLTALLEQLPRAQRKQLGPLPDLVDLLAKELEP
                     FRGPMIPALARAVSRLCGVDVSEESFRADAVVPYLRITLRVLDERGKELARGRDVDAL
                     LKQHGGHARAALRSAAPASDWERKGLTAWTFGELPAVVTRRIGNLEVRSHPALVDRGA
                     TVDLVLLETSAAADAATRTGVRRLLMLAARGHVAVSAARMPPPFPSLDGAPPARGQAD
                     AFRALVLARGVDDAFKLAPGAPLPRTKAAFEALLRDGSPRIEQAARDWANAVVVTSAE
                     LSKTLAALKAASTGPSGAAAVRDIRSQLGQLFPAKLIEWVPFSRLLHYPRYLRAAQAR
                     LARAVANPGKDAGKAAPFTPLWETFLARYATVREQEAAQELRWTFEELRVAIFAPEVT
                     TPVSVTVAKVGAALAALR"
     gene            complement(74543..75376)
                     /locus_tag="LILAB_RS00325"
                     /old_locus_tag="LILAB_00345"
     CDS             complement(74543..75376)
                     /locus_tag="LILAB_RS00325"
                     /old_locus_tag="LILAB_00345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allergen"
                     /protein_id="WP_043708906.1"
                     /db_xref="GI:760025770"
                     /translation="MSISLLNRSCSSLPQVGVPYVPSAASPAPDVKGTQASPPRSDAW
                     QKLMTDAFEPAARGQGVNLSGVSSAPRAASASHVSDAGPGFGAPSSGAVYNASQPWLS
                     VNNVGSPYNSNMQLISPEQKSQFKFTNTFTNTTGQPQTITLWNKVGEKGGPNDGQNFD
                     KSTPKTFTLQPGQSQMVAFDNNSSVAWCMSKDGSAKPGANSGQTWGEATFGNAATGWS
                     GYNTSQITPAGHTGSMSITNEATGKTVTEANAWQTPSDDPAGRDVGVPAGPMHLRTVL
                     S"
     gene            complement(75599..76435)
                     /locus_tag="LILAB_RS00330"
                     /old_locus_tag="LILAB_00350"
     CDS             complement(75599..76435)
                     /locus_tag="LILAB_RS00330"
                     /old_locus_tag="LILAB_00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_043708908.1"
                     /db_xref="GI:760025772"
                     /translation="MIRTSFVEGAGGVRLAVSESGPASGAPSVLFVHGFAQSRQSWSR
                     VLQGGLSRNHRLVALDLRGHGDSDKPEGEAPYVDGANFAGDLAAVIRQLGLERPVVVA
                     WSYGGVVVGDYLRHHGDEALGGLFLVAASLKTGKPARALFGPGMMSNARGLLSEDAGT
                     YAAAARAFVEACPARSFPPALVDASVQLMQRVPVNVRRALLSRAEDYSAELARCRCPV
                     VTLHGELDQVVLPAMSSEVVLASVRQGQSAWLAGVGHAPFIEATADFEAVLETFVVAA
                     WG"
     gene            complement(<76513..>77010)
                     /locus_tag="LILAB_RS00335"
     CDS             complement(<76513..>77010)
                     /locus_tag="LILAB_RS00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006159779.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712224.1"
                     /db_xref="GI:760029171"
                     /translation="DQRGFRVAPISRADLLDLTRTRQQLEPLALRAAIAQGDIAWEGE
                     VAAALHRLQRRAPASGSGTLDDTWEQEHARFHSALLSACGSPWLLKFHATLFDQTERY
                     RRLAQAYGKAGRHVENEHAALVKAALDRDAERACALLTEHIARTTELVLAAHPGLRAE
                     TPAPGA"
     gene            complement(<77019..77525)
                     /locus_tag="LILAB_RS00340"
     CDS             complement(<77019..77525)
                     /locus_tag="LILAB_RS00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013393754.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712227.1"
                     /db_xref="GI:760029174"
                     /translation="MRGGPVSEPTLASAVVDRLRGDILHGLLAPGEKLRLEHLAPRYG
                     VGRTPLREACCRLASEGLVTIEDQRGFRVAPISRADLLDLTRTRQQLEPLALRAAIAQ
                     GDIAWEGEVAAALHRLQRRAPASGSGTLDDTWEQEHARFHSALLSACGSPWLLKFHAT
                     LFDQTERYR"
     gene            77696..78565
                     /locus_tag="LILAB_RS00345"
                     /old_locus_tag="LILAB_00365"
     CDS             77696..78565
                     /locus_tag="LILAB_RS00345"
                     /old_locus_tag="LILAB_00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="WP_013935181.1"
                     /db_xref="GI:503701105"
                     /translation="MRIASILVRDTPALGVKTDRGMVDVTALDATVGSSLRALLERGP
                     EALASLARRAAEAPERFLLAPSAFRYRTLLPEPGKFLCLGLNYVAHASEATYETPRHP
                     VVFTRLPSSLLAHEEPLVVPTCSEQLDYEAELAVVVGRAGRNIPKARALEWVAGYTLF
                     NDGSIRDYQKRTHQWTIGKNFDGTGPLGPELVTPDELPEGARDLRIQMRVNGELLQDA
                     TTSDMIFDVATVLADLSEAMTLQPGDVIAMGTPSGVGAARKPPRFLRAGDVCEVSVER
                     IGVLRNPVVSAAK"
     gene            78602..79144
                     /locus_tag="LILAB_RS00350"
                     /old_locus_tag="LILAB_00370"
     CDS             78602..79144
                     /locus_tag="LILAB_RS00350"
                     /old_locus_tag="LILAB_00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013935182.1"
                     /db_xref="GI:503701106"
                     /translation="MSTQAKLPGRLHHTAYVTQDLEATRKFYEELIGLPLVATWCESD
                     ELFGAVRTYCHTFFELADGSALAFFQFEKPEDQALFGPKMPDSPFHHIALDVTLEAQQ
                     GIEQRLRAAGYTEPGMYVLEHGYCRSLYVKDPNGMIVEFTYDSPDAVKPELVQARRAR
                     AHKELARWLAGDRTSNNVFR"
     gene            79141..79791
                     /locus_tag="LILAB_RS00355"
                     /old_locus_tag="LILAB_00375"
     CDS             79141..79791
                     /locus_tag="LILAB_RS00355"
                     /old_locus_tag="LILAB_00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_013935183.1"
                     /db_xref="GI:503701107"
                     /translation="MSLLTLSFDNGPDPDVTPRVLDTLASHALTAQFFVLGKHLVTEE
                     GRRLVARARDEGHVIGNHSFTHAVPLGEDPRPDAVEAEIVATDALLAPLVPAPKWFRP
                     FGGGGKLGPHLLSQRAVGHLRAHGYSCVLWNSVPGDWLDPKGWPEKALADCAARAHTL
                     MVLHDIPNACLEALDGFLHRAKDLGLRFTTECPSDCVPIVEGRIVRDISGMVAAGG"
     gene            complement(79821..80225)
                     /locus_tag="LILAB_RS00360"
                     /old_locus_tag="LILAB_00380"
     CDS             complement(79821..80225)
                     /locus_tag="LILAB_RS00360"
                     /old_locus_tag="LILAB_00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PemK family transcriptional regulator"
                     /protein_id="WP_043712229.1"
                     /db_xref="GI:760029176"
                     /translation="MQADAGHRRPKGMPPDRINRGDVFWVAPDDSRGPAPSYSHPHVV
                     VQDDVFNHSRITTVVVCALTSNLHRASEPGNVLLEAGEANLPKQSVVVVSQISSVDKE
                     RLGERIGALSDARVEQILAGLRFQQVSFFRRP"
     gene            complement(80361..80681)
                     /locus_tag="LILAB_RS00365"
                     /old_locus_tag="LILAB_00385"
     CDS             complement(80361..80681)
                     /locus_tag="LILAB_RS00365"
                     /old_locus_tag="LILAB_00385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935185.1"
                     /db_xref="GI:503701109"
                     /translation="MENQMKSTLSLLVGALLFMGCGGPSPEEAQGSQGAIAIPEQYLS
                     PEDSSAEGGEVNALMACCYFRCSDNLLRGPFPNVVEGNCRNYAKYQCARRGLGFVGAS
                     WRDC"
     gene            complement(80719..81033)
                     /locus_tag="LILAB_RS00370"
                     /old_locus_tag="LILAB_00390"
     CDS             complement(80719..81033)
                     /locus_tag="LILAB_RS00370"
                     /old_locus_tag="LILAB_00390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935186.1"
                     /db_xref="GI:503701110"
                     /translation="MKNGHAEWFALFAGVVLLTGCGPANDETMPAVGPAEEGVSTPGI
                     PSEYLEEGGVESAAICCNVRCSGKWYGPFRSVNYDLCAKFGRYHCPQRGLVYQGYDWR
                     TC"
     gene            complement(81291..82253)
                     /locus_tag="LILAB_RS00375"
                     /old_locus_tag="LILAB_00395"
     CDS             complement(81291..82253)
                     /locus_tag="LILAB_RS00375"
                     /old_locus_tag="LILAB_00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018837228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013935187.1"
                     /db_xref="GI:503701111"
                     /translation="MSWLRGDPIDDVIQLLRPRTVVSAELRAAGRWGIRFQGYPHVKF
                     GTVVAGHCVILLEGQRRVVRCEAGDVYLLGNPPPYVMASDATAPRLEAHALFSRVTDG
                     VVTLGAAGTAPATHIVGGHFVFDASNAHLLMRALPPILRVPAASAGPLRELAGLLVRE
                     LAEPRPGRGLVLDRLSQLMLVHAMRSADLAGMRRRASWLQALADPRIGLALRRIHADA
                     RARVSLGELASAAGMSRSAFAARFKQLVGRPPLDYAIGWRMDLARDALRTTERTVGEL
                     AFAFGYESESAFSTAFRRVVGMSPRAYRQRARTSAVPPGKALAE"
     gene            82323..83057
                     /locus_tag="LILAB_RS00380"
                     /old_locus_tag="LILAB_00400"
     CDS             82323..83057
                     /locus_tag="LILAB_RS00380"
                     /old_locus_tag="LILAB_00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007885091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013935188.1"
                     /db_xref="GI:503701112"
                     /translation="MDSTGKTALVTGGNKGIGFAVVRQLAAHGYTTWLGSRDEARGRA
                     AVAALEEAGAGDVRFIALDVTDEASGAAAAARIASLTPSLDVLINNAGIYVKEGDGAP
                     STVRLDAMRATYDVNVFGPLRVTAAFLPLLRAARGAHVVMVGAGLGSLTLQLDPSQGL
                     SRWPAFAYSSSKTALNALTVGFANELREEGIVVTVVNPGFVATDLNGHAGTLTTDEGA
                     ERVLRAVQLPLSATGSFVTDHGTCPW"
     gene            83333..84082
                     /locus_tag="LILAB_RS00385"
                     /old_locus_tag="LILAB_00405"
     CDS             83333..84082
                     /locus_tag="LILAB_RS00385"
                     /old_locus_tag="LILAB_00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013935189.1"
                     /db_xref="GI:503701113"
                     /translation="MGTREKAGATQGRKRGRPRGRTEQGHETRQRLYAIALESLSTRG
                     YEATHLRDIAKEAGVSVGLLYRYFPSKRAILLALYDELSSAYAARAAALPAGPWRERF
                     SFALRTSLEVLGPHHAVLKALAPVLVSGEEDGVLAPQTAFSRLRVQAAFGEAVAGATD
                     APGSAPVTKALGRLLYVAHLAVLMWWLLDKSPGQRATAGLVALLSRVLLPASLALRLP
                     GAGSVVLRADVLCRQGLFGEAEPSDADEVPR"
     gene            84079..84981
                     /locus_tag="LILAB_RS00390"
                     /old_locus_tag="LILAB_00410"
     CDS             84079..84981
                     /locus_tag="LILAB_RS00390"
                     /old_locus_tag="LILAB_00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_013935190.1"
                     /db_xref="GI:503701114"
                     /translation="MSATRLEHPAPLPVEGRAHGPEARKAHLVPPEVGTLRFDPARTL
                     WLWAMLIPGVTVGLPAATPTTVAVSLLLTVATLCLGHSVGLHRGVIHRTYEAGPLTRG
                     VLAYLFVLSGLGGPLSWARLHAVRDYWQSRPDCPRYFAYGHSMVRDFGWNLHLRFEAA
                     DGRALARLPSDVLTDPWLRFLERTWPLHVLGLSGVVLAALGPEAVALCVCARTAASII
                     GHWAVGYAAHVWGERRYTLPGAAESGTNSWVLGVLSFGEGFHNNHHAFPCSARMGQKP
                     HELDLGWWAIRALRRLGLVRDVRT"
     gene            85088..85882
                     /locus_tag="LILAB_RS00395"
                     /old_locus_tag="LILAB_00415"
     CDS             85088..85882
                     /locus_tag="LILAB_RS00395"
                     /old_locus_tag="LILAB_00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_043712231.1"
                     /db_xref="GI:760029179"
                     /translation="MTQDMGEVRGEQLVRQLRDLGVREGGVLVVHTSFKAVRPVEGGP
                     LGLIQALRAALGDAGTLVMPTMTDGEGVFDPKRTPTEGMGITAELFWRQPGVLRSTHP
                     GGSFAAVGPRARDICRPQPLSPPHGPESPVGWAHESGGQVLLLGVTQGENTTLHLAEA
                     LAPVPYSVTHPCVVEVDGVARTVDIAETDHCCQGFQRADGWLRARGLLREGKVGHADA
                     KLAEARDIVNVVVEHLRADPLVFLCPADAGCEECDRARASVDDPAR"
     gene            86068..87096
                     /locus_tag="LILAB_RS00400"
                     /old_locus_tag="LILAB_00420"
     CDS             86068..87096
                     /locus_tag="LILAB_RS00400"
                     /old_locus_tag="LILAB_00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043708910.1"
                     /db_xref="GI:760025774"
                     /translation="MRRLAPALLSASLMVGCGPTSAESESPAPSTERQEAPLTTTDVD
                     VAPECQGLLTFVNTEPLSTLSTYLPSDVAQSLVSQRATAPFSTLVEVSAVRGISQARL
                     ARIEDGARTLGYVGSTCAGVLDELALSTDDAAALVNLVNTIDSSALYAVLPYAWNGAT
                     NLLNLRPFTSAQAISEVSGVGTVSLRNLRNAATQGYALTALIAAINAQEESLWTSRLS
                     QDFDIQDVIDGAHGNGEFQSASCFGIDPSLFPAGQNWTVRPNLATGTEVYQEIEGTVG
                     YADRNEPLPDTLMADGLAELQARTAGRTFNGCFISYGKGPWGGIQVKFYVDTVTGYRI
                     LSEQHWVE"
     gene            complement(87172..88308)
                     /locus_tag="LILAB_RS00405"
                     /old_locus_tag="LILAB_00425"
     CDS             complement(87172..88308)
                     /locus_tag="LILAB_RS00405"
                     /old_locus_tag="LILAB_00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S1"
                     /protein_id="WP_013935193.1"
                     /db_xref="GI:503701117"
                     /translation="MMSVKFMRRWSTVGAMSLLVGCGPELVDEQAEAVTPATIEQDIV
                     GGTTTTINANPWQVSLRRGGHWCGGSILNKDWILTAAHCVDGYTVSSIVAGSTSSTST
                     SSGQTRNVAQVIIHEDYGSAGNDVALLRLATSLSLNGTTVAAIPRVSAADAASGATNP
                     GVVARVTGWGATSSGGSGSSTLRTVDVNVISNTEAQQSYPNEYIGPDQIGAKAPGKDS
                     CQGDSGGPLTVMHNGVRKLAGVVSWGYGCADSRYPGMYARVSHFEAWVDAKLSGTNPP
                     PTGTTLLSQTNLSGSSSTWRHFSISVPAGTTSLKVVQAGGSGDADLYVRRGSQPTTSA
                     YDCRPYSAGNNENCDFTNPASGTWYVSVRGYSSYSGVSVTATIP"
     gene            complement(88605..90143)
                     /locus_tag="LILAB_RS00410"
                     /old_locus_tag="LILAB_00430"
     CDS             complement(88605..90143)
                     /locus_tag="LILAB_RS00410"
                     /old_locus_tag="LILAB_00430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_043708912.1"
                     /db_xref="GI:760025776"
                     /translation="MRGSLRGLVEGAISVFRGIPYAKPPTGALRWRAPERVNPWPGVR
                     EAYEFGYSALQSRQACIEGGGGDPGEMREDCLYLNVWTPRVDACAKLPVVFWIHGGAF
                     VIGSGRVPPYDGFHLAARDVVLVTFNYRLGHLGFFVHPALEKEHPGGPANFGLLDQML
                     ALEWVRDNIAQFGGDPSNVTVMGQSAGAKSVLSLFTSPLVREKNLFRQGVAMSAYVLQ
                     EKSLSDAKLAGMAFAWRNGLDRLLATAEELRALSPEKFWMLPTDTVNAPSPIYGDSVL
                     PEPIRESFERGSQLPLPLILGSTSDDSSVVSSFGIDPGTILERLGAFAPAIRQLYPDV
                     DDDREIGRRMCRDFVFTVLPRMLASRHAASGAAAWRYYFDYNARLLVPRQRLGVPHGG
                     EVPYFLETAADVPPSGEFFTDEDRTFLHQLVASLVQFARTGTPGPVAQVTWEGHTETQ
                     DRLLRLEVSPRMEADFERAILQAAESLIPILDSFARPPPPKLPRAASPSTSASGNARP
                     ELRP"
     gene            90220..91377
                     /locus_tag="LILAB_RS00415"
                     /old_locus_tag="LILAB_00435"
     CDS             90220..91377
                     /locus_tag="LILAB_RS00415"
                     /old_locus_tag="LILAB_00435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013935195.1"
                     /db_xref="GI:503701119"
                     /translation="MLVRKVAINEEQVRAFLENLFEEDLHAKRVLSLSHATLGVVHAA
                     SLSVHAIGQALAWARGGVQKHGIKQVDRLLSNEAVDVWKLAASWVPYVLAERTEAVVA
                     LDWTDFEADDHTTLVASLVTSHGRTTPLLWLTLKKSAMAGNRAQAEDELLLRLKECVP
                     EGVQVTILADRGFADQRLYALLAQAGFEYVVRFRKDVRVEVEGGHQRPAAEWIPASGH
                     AKKLTEVHVTADRTPVPAVVLVHQKGMKEPWCLATSLGAASARQVVDLYARRFSCEET
                     FRDVKDLRFGMGLSTVRVKSPERRDRLLLVSALAQVLLTLLGAAGESLGMEKGLKANT
                     VKTRTYSLFRQGCMYYQAIPMMKEERLRPLVERFAELLRHHPVFKEALGFI"
     gene            91855..92580
                     /locus_tag="LILAB_RS00420"
                     /old_locus_tag="LILAB_00440"
     CDS             91855..92580
                     /locus_tag="LILAB_RS00420"
                     /old_locus_tag="LILAB_00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935196.1"
                     /db_xref="GI:503701120"
                     /translation="MAIEKALLLIADIGGYTRFMSHHRFSLAHAQETVAQLLEAVIDA
                     SGPLKLAKLEGDAAFFYAVGDDFPTFARQVADIRRAFLARREQFVVDRMCKCDGCMQV
                     SALTLKFVAHAGEVAFQRVKHLTELAGVDVILVHRMLKNDVPVTEYVLMTDTVHQRLE
                     PELRQHTLGLEHDFEGMGRTATHYIDLNVFAIAAPEPVAPSLPRKLWAKVKMEWKSMK
                     YVLGLKQPCEDFRNVEVVDERSP"
     gene            92914..93438
                     /locus_tag="LILAB_RS00425"
                     /old_locus_tag="LILAB_00445"
     CDS             92914..93438
                     /locus_tag="LILAB_RS00425"
                     /old_locus_tag="LILAB_00445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935197.1"
                     /db_xref="GI:503701121"
                     /translation="MSDERLVLMRGDITQVQADAIVNAANSALCGGGGVDGAIHRAAG
                     PGLLAECRTLGRCPPGEARITGGHGLPARHVIHAVGPVWQGGGSGEETLLARCYWRAF
                     SLMEQHGLGTIAFPSISTGAYGYPIERASRVALREILSALERMPTLQRVTVVLFSDRD
                     LDVYQRARQALGDG"
     gene            complement(93530..>93907)
                     /locus_tag="LILAB_RS00430"
                     /old_locus_tag="LILAB_00450"
     CDS             complement(93530..>93907)
                     /locus_tag="LILAB_RS00430"
                     /old_locus_tag="LILAB_00450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013938480.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48"
                     /protein_id="WP_043712232.1"
                     /db_xref="GI:760029180"
                     /translation="PARVASSLALVALLFALDRLLRLSAARGWFGATRFADIRNLPLI
                     SLLFFLLMLTARPVSGAFSREREYEADRYALRLTGDVASFRRMLVKAARVNKMDPAPP
                     RWLVLKGMSHPPIGERIASLPPS"
     gene            complement(93997..94431)
                     /locus_tag="LILAB_RS00435"
                     /old_locus_tag="LILAB_00455"
     CDS             complement(93997..94431)
                     /locus_tag="LILAB_RS00435"
                     /old_locus_tag="LILAB_00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712234.1"
                     /db_xref="GI:760029182"
                     /translation="MVISGSCHCGNLSFTLVWEPSPDEIPARACGCSFCTRHGGVWTS
                     HPGGTLNVTVQEPSQVSRYVFGTRTAEFHTCCRCGVVPVVTSLIDGRLYAVVNVNAFE
                     GIDPARIRRATGSFDNEDTETRLARRKRNWISNVEILQAPRP"
     gene            complement(94557..>95322)
                     /locus_tag="LILAB_RS00440"
                     /old_locus_tag="LILAB_00460"
                     /note="epoxide hydrolase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(95542..95970)
                     /locus_tag="LILAB_RS00445"
                     /old_locus_tag="LILAB_00470"
     CDS             complement(95542..95970)
                     /locus_tag="LILAB_RS00445"
                     /old_locus_tag="LILAB_00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015351357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epoxide hydrolase"
                     /protein_id="WP_013935202.1"
                     /db_xref="GI:503701126"
                     /translation="MAGITHRTVTANGINLHLAEAGTGPLVLLVHGWPESWYSWRHQL
                     PALAAAGFHAVAPDVRGYGGSAGRRQRRKLVAPRVPGLRPAMHEQHERPRARLREVQV
                     DAIRRDGSMRDACHGTLRGEGGGARQRQARGLTRCFAARA"
     gene            complement(96009..96464)
                     /locus_tag="LILAB_RS00450"
                     /old_locus_tag="LILAB_00480"
     CDS             complement(96009..96464)
                     /locus_tag="LILAB_RS00450"
                     /old_locus_tag="LILAB_00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_013935204.1"
                     /db_xref="GI:503701128"
                     /translation="MRRDSRLSVALHVLLHMEDMGPVVTSEAMGRLMKANPVVVRRTM
                     AGLREAGILTSVKGHGGGWSLARPLDAVTLGDVYEALGTPALFSIGPRDESPGCLVEQ
                     AVNTALEAALDEAAALLLRKLRNTSVAELGRGVRRRHARAAKQRVRPRA"
     gene            complement(96541..97089)
                     /locus_tag="LILAB_RS00455"
                     /old_locus_tag="LILAB_00485"
     CDS             complement(96541..97089)
                     /locus_tag="LILAB_RS00455"
                     /old_locus_tag="LILAB_00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935205.1"
                     /db_xref="GI:503701129"
                     /translation="MKKIMLSTCVCAALALTACGGDSDRLDSVQDEQPPAPSGPVQTE
                     DGKRFELRLRGSSMEGYDKLELPIGAVRVTVDGKPLKVELAKDRVDVAAADHAPLVAY
                     FYVPEGVERVRVSLQLDGLGGYTKAGAPGYIDAAVAPMTFEAPVHELALRGRAVVQLD
                     VARSLVDLGSHHLLLPNGVVNY"
     gene            complement(97143..98078)
                     /locus_tag="LILAB_RS00460"
                     /old_locus_tag="LILAB_00490"
     CDS             complement(97143..98078)
                     /locus_tag="LILAB_RS00460"
                     /old_locus_tag="LILAB_00490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935206.1"
                     /db_xref="GI:503701130"
                     /translation="MRMKLKQQWMGAACAVVVGGSGVANAHDLICEKRVNGESVVVAD
                     EYPFTANYSFEVINVHPTLPSVLLTATDDVLSSEGFTFSPPPPVAIPVNGSLTDDFAL
                     QIGSYEECVAIAAEDGLADTHIDNTFRVTFDLGSAMCSARLTCEREEPPPVECTSATR
                     TLGFFSTRILTVTQCLALGPIDLGAIGTISTLPAAEGILWGSPAMYPQGGMRSQLDRL
                     RFLLARQTLVGICNQRLFGSTPTPPSLLTDAVAALDTTDCTLISSLIDPVDNFNNQCD
                     SYPLPEGFIPGPSTPQTAQAIAVDPTSNSGQSCSP"
     gene            complement(98431..100503)
                     /locus_tag="LILAB_RS00465"
                     /old_locus_tag="LILAB_00495"
     CDS             complement(98431..100503)
                     /locus_tag="LILAB_RS00465"
                     /old_locus_tag="LILAB_00495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="WP_013935207.1"
                     /db_xref="GI:503701131"
                     /translation="MRADSQTVPAPPDAFQKRLDGLLIAALVVWGLTQLAPHLAHPAI
                     YIWDESMHQAATRGTHDTFFTPHLYKDPLYPTDPRHWWAAHVWMHKPTGPFWFGALMM
                     HVVGVTPLALRLASLLGHLAAAVSIYLIARRPAGRPWAVLGAAGFLAMPFGWQLVQGR
                     FFGDVTDCTLTGCNAVAVALLFHATRQGSWRWGVAAGAAVGLGFLCKTGLALTPLGIA
                     GTLWALGRLRFCPGPSFGTVVAMVGAAVLLAAPWSLYSAWRWPELHELEARVTRAHLF
                     HDPTVDVGPWHRPVDALFNEVNTQSLAPLPPVVPVLAFGWLLVRALRRRELEVVGLAL
                     WVGATWFVLTLGVVKVPAIAWGAVPAVLAALAISGADARRHPALAAALLAGLFTPWFI
                     QHLPALGRVRAALPPVLAQTRERPGLAEGLVVVAVAALLVGLVCRLLPRKLSWAPLGV
                     GLLASAVLAWHLAVTLPVARARYLSDHLDDLYVTYSREVGRALEQQTPARSVLFLAQD
                     FDVPHAMEYLSLMFWSNRMAYRRPPDVPTARRRRYHPYLVSPLAERYAPVPGVPPDAA
                     LRAYDLLAPRPAPAALPDGVTPLSFREKNMEVLGVAVGHAGGGRDRYAFFVRAHGAPH
                     SLRVVFQGPGGRLERSLDPGAARRRDAALRNASWFIVPVLGPPGADVTHLELGSDGQQ
                     VTLALPGA"
     gene            complement(100560..101858)
                     /locus_tag="LILAB_RS00470"
                     /old_locus_tag="LILAB_00500"
     CDS             complement(100560..101858)
                     /locus_tag="LILAB_RS00470"
                     /old_locus_tag="LILAB_00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_013935208.1"
                     /db_xref="GI:503701132"
                     /translation="MRIAIIGTGYVGLVAGTCFAESGHDVTCVDLDARKVEALRRGEL
                     PLYEPGLEELVRRNVAARRLRFTGHLPEAVSAAQVVFIAVGTPQSERGSADLQYVLAA
                     AEQIGRALRHYTVIVNKSTVPVGTSDQVRAVVARSTDVVFDVVSNPEFLKEGAALDDF
                     LKPDRVVIGATSERARRLMADLYAPFVRTENPILFMDPHSAELTKYAANAMLATRISF
                     MNDMALLCERVGANVDLVRKGMGADRRIGYAFLYPGIGYGGSCFPKDVRALMSTARDA
                     GLELDLLRAVESTNTRQKRCLLGKALKHYGSLADHTFAVWGLAFKPKTDDMREAPSVE
                     LIEGLLGKGARVQCHDPVAGAVARQYFGDRVAYAPTCYEAAEGADGIFLVTEWNEFRR
                     PDLKRLRALMRRPIIFDGRNVLDPRLARSEGFTYIGVGRD"
     gene            complement(101882..102949)
                     /locus_tag="LILAB_RS00475"
                     /old_locus_tag="LILAB_00505"
     CDS             complement(101882..102949)
                     /locus_tag="LILAB_RS00475"
                     /old_locus_tag="LILAB_00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_013935209.1"
                     /db_xref="GI:503701133"
                     /translation="MKVVILGLSITSSWGNGHATTYRGLVRELARRGHDVLFLERDVP
                     WYAANRDLPRPPYGRTELYASLEDLAGRFTEDVRRADLAMVGSYVPRGAAVGEWVQRT
                     ARGVTAFYDIDTPVTLALLERGACDYLRPELVPGYRLYLSFTGGPTLARIERALGAPA
                     ARPLYCSCDPELYAPAACEPRWALGYLGTYSEDRQPVLERLMLEAARAWPEGRFAVAG
                     PQYPEHLQWPRNVTRVEHLAPPEHPAFYNAQRFTLNVTRADMVRAGYSPSVRLFEAAA
                     CGVPIISDAWPGLETFFAPGRELFVSRSGEETLRYLQEVSAPERRAMGARARQRVLAE
                     HTAEHRARTLEAYVLDAARGG"
     gene            complement(102946..104061)
                     /locus_tag="LILAB_RS00480"
                     /old_locus_tag="LILAB_00510"
     CDS             complement(102946..104061)
                     /locus_tag="LILAB_RS00480"
                     /old_locus_tag="LILAB_00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935210.1"
                     /db_xref="GI:503701134"
                     /translation="MSRGLRIAFFGSSLVSAYWNGAATYYRGLIRALHARGHQVTFYE
                     PDAFERQQHRDMADPDWARVVVYTEQGTEAVERCLEEAGRADVVVKASGVGVFDALLE
                     ARVLDLKRPGVQVVFWDVDAPATLERLERQPDDPLRALVPRYDHVFTYGGGAPVVTAY
                     RALGARRCVPIYNALDPTTHHPAPAEARFRGDLAFLGNRLPDREARVEDFFLRAAALL
                     PASRFLLGGSGWEARPLPANVTNLGHVYTHEHNALNCSARAVLNIHRDSMARFGFSPA
                     TRVFEAAGAGACLITDAFEGVELFLEPGREVLVARSGEEVAEHVRRLTAPEARRIGQA
                     ALRRVLAGHTYLHRVSQVEAALGLRAAPATAARECVA"
     gene            complement(104058..105197)
                     /locus_tag="LILAB_RS00485"
                     /old_locus_tag="LILAB_00515"
     CDS             complement(104058..105197)
                     /locus_tag="LILAB_RS00485"
                     /old_locus_tag="LILAB_00515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935211.1"
                     /db_xref="GI:503701135"
                     /translation="MRIVFFCHSLLSDWNHGNAHFLRGVVAELCARGHDVRVFEPADA
                     WSLRNLLAEPEGPAVLSEVASVYPHARPERYDLETLDLDRALEGARLVIVHEWSAPEL
                     VRRLGERRKGSEAFRLLFHDTHHRGVSAREEMARYELAHYDGVLAFGEVLRRLYLEQG
                     WARRAWTWHEAADTRVFGPRGDVVPEDDLVWIGNWGDEERTAELREFLLGPVRALGVK
                     ARVHGVRYPDAARAALARAGITYAGWLPNHRVPEAFARARVTLHVPRRPYATSLPGIP
                     TIRPFEALACGIPLVSAPWRDVEGLFTPGRDYLVADTGARMRDHLRALLADADLRRAL
                     AEQGRRTVLARHTCAHRVDELLRIHASLEPPATRAGASSRGRVTA"
     gene            complement(105218..106315)
                     /locus_tag="LILAB_RS00490"
                     /old_locus_tag="LILAB_00520"
     CDS             complement(105218..106315)
                     /locus_tag="LILAB_RS00490"
                     /old_locus_tag="LILAB_00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935212.1"
                     /db_xref="GI:503701136"
                     /translation="MTTDTVGGVWTYVLELCRALAEAEVQVELATLGAPVTPMQAEAA
                     RRVPGLRLHESTYRLEWMDSPWADVRASGEWLLALEDRLDPDVIHLNGYAHGALPWRA
                     PSVVVAHSCVLSWWESVLREPAPARYARYQREARRGLRAVDRVVAPSAAMLAAIERHY
                     GPLPTACVIPNARRAEDFAAAPKEPFVLAAGRLWDEAKNLAALEAVAPRLAYPVRVAG
                     ETRHPGGGKAAQARNTEPLGQLSPEALAAWMGRAAIYALPVRYEPFGLSALEAALAGC
                     ALVLGDLPSLREVWADTAVFVHPEDLEGLTAALRRLLEDAAHRKHMAARARARALTLN
                     PRRMAEDYLRLYATLWARRVQPLAGVALGAP"
     gene            complement(106341..107438)
                     /locus_tag="LILAB_RS00495"
                     /old_locus_tag="LILAB_00525"
     CDS             complement(106341..107438)
                     /locus_tag="LILAB_RS00495"
                     /old_locus_tag="LILAB_00525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-paratose 2-epimerase"
                     /protein_id="WP_013935213.1"
                     /db_xref="GI:503701137"
                     /translation="MSAAEPWTGEGGRTVIFGGAGFIGSNLADHYLSAGRTVRIVDNL
                     TRPGVVHNLRWLQARHGARLEVMTADVRDAQAVKQAVAGATQVFHFAAQVAVTTSLEV
                     PVTDFEVNAGGTLNVLEALRAMERPAPLVFTSTNKVYGGMPGVELVQGQRRYEPRDTR
                     LRSQGVDEACPLDFESPYGCSKGAADQYVLDYARAYGLRTVVFRMSCIYGPRQFGTED
                     QGWVAHFLLRTLEGQPLTLYGDGKQVRDILDVRDLVDALSLAQQHMGRLKGQAFNMGG
                     GPTRAVSLLELLGLISQRTGLRPAIHFEDWRTGDQRYYVSDTRKFQAATGWAPRVGVR
                     EGVDRLHDWLRTLVRERSATGLGAEREVHAG"
     gene            complement(107435..108556)
                     /locus_tag="LILAB_RS00500"
                     /old_locus_tag="LILAB_00530"
     CDS             complement(107435..108556)
                     /locus_tag="LILAB_RS00500"
                     /old_locus_tag="LILAB_00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_043712235.1"
                     /db_xref="GI:760029184"
                     /translation="MKQRQILITGGAGFIGSHLADALLARGHRVRALDALVPQVHGEA
                     RQRPEYLSPDVELVVGDVCDGDKVRQALDGVDAVFHFAAAVGVGQSMYEVAHYTAVNN
                     LGTSVLMEALIEHPVERLVVASSMSVYGEGLSRAPDGRRVPGGQRPLEQLSAGKWELE
                     GPAGEPLTPVATPESKPPELSSVYALSKFDQERLCLILGRAYDIPTVALRFFNVYGPR
                     QALSNPYTGVLAIFGARLLNGSPPLVFEDGLQQRDFVNVRDVARACALALDAEGAVSR
                     VINVGSGRAITVREVARALAEVMGRPGLRPAVTGRYRMGDIRHCFADISLARDLLGYA
                     PEVTFHDGLTELSSWLEDQVATDRVAEARAELDARGLTV"
     gene            complement(108761..110530)
                     /locus_tag="LILAB_RS00505"
                     /old_locus_tag="LILAB_00535"
     CDS             complement(108761..110530)
                     /locus_tag="LILAB_RS00505"
                     /old_locus_tag="LILAB_00535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_043708914.1"
                     /db_xref="GI:760025778"
                     /translation="MWRALGYLRPYRRTIAFILLLVLTSASLSALEPLVLKGIFDQLG
                     SEDATKPVLLGVGLLVLMGLLREALGAASNWLTWRTRIQVHFALNEATVSRLHRLPLS
                     FHRQEGVGALMTRMDRGLQGFVGAITELTFNVIPAAVYLCIAVAVMLRLDWRLALLAL
                     AFAPLPVLIARRAAPVQARREETLLERWTQIYARFNEVLSGILTVKSFAMEDREKQRF
                     LHGVRDANAVVTRGVAFDSAVTAGQNTTVLVARVASICMGGLLVMKGQLTVGTLVAFL
                     GYIGGLFGPVQGLSGVYKTLRTASVAIRQVFSILDAQDSLGDAPDAHEVTHMRGDVTF
                     EDVHFAYPSGAGRPLINGISLNVRRGETVALVGPSGAGKTTLMSLLCRFYDPDQGVVR
                     VDGRDIRTLKQLSLRRNIGVVLQDALLFNESVKGNIAYGRPHATDAEIEAAARAAHAH
                     EFILGLPQGYDTLVGERGSRLSAGERQRIAIARSLLTDPPILILDEPTSALDAESEAL
                     VQDALGELMKGRTTFAIAHRLSTVVSADRILVLKDGRLIEEGTHAELLRRDGYYASLV
                     RKQTRGLLPELPAPPLPATPVAA"
     gene            complement(110655..111653)
                     /locus_tag="LILAB_RS00510"
                     /old_locus_tag="LILAB_00540"
     CDS             complement(110655..111653)
                     /locus_tag="LILAB_RS00510"
                     /old_locus_tag="LILAB_00540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_043708916.1"
                     /db_xref="GI:760025780"
                     /translation="MSAPAMRRPRLGFLGVGWIGRHRMEALVREAPVEVVGVADPSEA
                     AAEAARALAPGCERVDSLDALLALGLDGVVIATPSAVHAEQSIQALERGVAVFCQKPL
                     GRTAREVARVVDAARKADVLLGVDFSYRYAQGLRALRAHHQSGALGQVHAVNLVFHNA
                     YGPDKPWFYDPALAGGGCVMDLGIHLVDLALWVLDFPAVRRVSSQRFAQGRPLRGREE
                     AVEDYAAALLELEGGAAVQLACSWKLSAGCDAVIEASFYGTGGGVSFRNVNGSFYDFT
                     TDAFRGTERVRLAGPPDGWGGRAAVDWAHRLARGERFTPDNTRLIQVADTLDRLYA"
     gene            complement(111650..112618)
                     /locus_tag="LILAB_RS00515"
                     /old_locus_tag="LILAB_00545"
     CDS             complement(111650..112618)
                     /locus_tag="LILAB_RS00515"
                     /old_locus_tag="LILAB_00545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydrogenase"
                     /protein_id="WP_013935217.1"
                     /db_xref="GI:503701141"
                     /translation="MSDGMMRAAVVTGPGGTRVDRVARPEPGPGAVRVRMEGCGVCGS
                     NLPTWEGRDWFRYPLKPGTPGHEGWGVVDAVGSGVTELRVGDRVATLSSAAFAEYDVV
                     DAASAVVLPPALAGKPFPGEPLGCGVNIFRRADLQAGQTVAIIGIGFLGAVVTRLAAN
                     AGARVLAISRRPFALELARAHGATECIPLDDHGRVIERVKALTGGALCDRVIEAVGAQ
                     WPLDLAGELTRERGRLVIAGYHQDGPRQVDMQLWNWRGLDVINAHERDPRVYVEGIRL
                     AVEAVASGALDPYPLFTHHFRLEELGRAFEALRSRPDGFLKALVTP"
     gene            112940..113473
                     /locus_tag="LILAB_RS00520"
                     /old_locus_tag="LILAB_00550"
     CDS             112940..113473
                     /locus_tag="LILAB_RS00520"
                     /old_locus_tag="LILAB_00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="WP_013935218.1"
                     /db_xref="GI:503701142"
                     /translation="MTQTWELNLDAMTPSLAVGGRYPMEAAAYLAGQLGIRSVVDVRV
                     EHCDDEQVLRQHGITLLHLPTQDMCAIRLPMIHDGVAWVRARLAQREKVLIHCEHGIG
                     RSALLALCVLVEEGLSPLEALSLAKDRRGRVSPSPEQLSAFIAYTQALRASREVPWDV
                     PDFDALAAIAYRHLRQD"
     gene            complement(113521..114408)
                     /locus_tag="LILAB_RS00525"
                     /old_locus_tag="LILAB_00555"
     CDS             complement(113521..114408)
                     /locus_tag="LILAB_RS00525"
                     /old_locus_tag="LILAB_00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-xylosidase"
                     /protein_id="WP_013935219.1"
                     /db_xref="GI:503701143"
                     /translation="MIEAVKLWNEPNNLSHWDFGLDADWSIFSRMVRLAGAAVRSENA
                     RLPRVLGGMAPIDVSFLRRMEAQGALDEVDVVAVHGFPLDWNHWQLDEWPQRLEEIRA
                     VSRHRVWVTEVGVSTFGAEEVQEFGLRRTAELLLGRVERVHWYSLYDLPKAWPATTRH
                     REAEGSSYYRHFYMGLLREDGSPKRAMRHFADYTPQLGICQWFHFEDHRLEDAVAWLR
                     KMGVRKLRTGLSWADSHRPGAEAWFDQQMRALDGFDVTLTYCFTPGSCGLTDHHTSPP
                     RQVEEFADFCARMTRRYAR"
     gene            complement(114405..115142)
                     /locus_tag="LILAB_RS00530"
                     /old_locus_tag="LILAB_00560"
     CDS             complement(114405..115142)
                     /locus_tag="LILAB_RS00530"
                     /old_locus_tag="LILAB_00560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_043708918.1"
                     /db_xref="GI:760025782"
                     /translation="MSPPGLTAEQLQQQVHSLGEWFHNLDLHGVQTAPRHPLGDFPAV
                     FWRTFQRAFPTDLRGRSVLDIGCNGGFYSIEMKRRGAARVVGIDSDARYLAQARLATQ
                     VLGVDVELHQLDVYDAGALGERFDVVLFMGVLYHLRHPLLALDLLHEHVVKDLLIFQT
                     MERGGTQAGPVAEDYAITERSAFERPDFPKLHFIERRYAGDPTNWWVPNAACTEAMLR
                     SAGFSVLDRPAREIYLCQRSTRPEVLQ"
     gene            complement(115487..116491)
                     /locus_tag="LILAB_RS00535"
                     /old_locus_tag="LILAB_00565"
     CDS             complement(115487..116491)
                     /locus_tag="LILAB_RS00535"
                     /old_locus_tag="LILAB_00565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708920.1"
                     /db_xref="GI:760025784"
                     /translation="MALSPVSRSCVSSPSFQRASEVERPAMPRQSTMGAGAQQQPLRQ
                     LFQSDGFDGPSGAAKGQGAEALVQNLSRLAQMLTEASRLLGAEGAQGGLAPASGLKSA
                     GATPASRGGDHFAPAPAAPAVPAAAPSAPTAPSAPSGTQAKAVAGPTGAPGVSKDGNT
                     ITFTNDGTSPMTIKFTPNAGEKELDAITVPPGKTQTVQFPENWSGNFRSASGDGSAAT
                     LGEVKFDGGFGKTYYDVSYIEGHNASMTMQPEEGGRVSGTHDDLLSAAPDAIKARNAD
                     GSVYGIKKSTTSNVQDGGVVDFYRKHVGADEGYVIPTDDASTLGTSDTNLVVRMKNLA
                     "
     gene            complement(116707..117339)
                     /locus_tag="LILAB_RS00540"
                     /old_locus_tag="LILAB_00570"
     CDS             complement(116707..117339)
                     /locus_tag="LILAB_RS00540"
                     /old_locus_tag="LILAB_00570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013935222.1"
                     /db_xref="GI:503701146"
                     /translation="MTSTSSGPAYTIQTARTLLRCWSPADAARALRAIHASLEHLRPW
                     LDWAREAYPMSVSQQAAVLRRFRGRFDLGEDFTYAVFDRGGTEVLGGCGLHPRVGEGG
                     REIGYWIASEHIGQGLATEVAAALTRVAFELEGLRRVEIHCDPLNVRSVAVPRKLGFT
                     HEGTLRQRLRSPDGGWRDTMLWTLLAEDHAARPAAASNLEAFDVLGQRLL"
     gene            complement(117519..120122)
                     /locus_tag="LILAB_RS00545"
                     /old_locus_tag="LILAB_00575"
     CDS             complement(117519..120122)
                     /locus_tag="LILAB_RS00545"
                     /old_locus_tag="LILAB_00575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935223.1"
                     /db_xref="GI:503701147"
                     /translation="MRLVHSQNVWHLAGVLWLLVAAGCHLEDSPPIQLEPSASARVMV
                     VLPRTLPAEPGMQVRVTLTPTAGDAVGGALTGGGGLWQGVMRGITSGEGAAVSATVQD
                     ERGALLARIDVPEVSLAAHRTALLVLVPRVTGEAPEARGAPFIDAVLGSVVEVRPTGQ
                     VPLRAVAEAASGGGALTYAWRASDGRFDDAHAAAPVWTAPETPGLVSLSLEVTSAEGQ
                     VATLEFPMRVSRDQGFGADGAGDFNRWPRVMAPGSQPAGEVPHGDTLQLQAEAWDEDG
                     DALTYAWTANCAGTFDDASLPSPRFTPSTPPEGACGACQFVVAVRDGRGGERVGSVDV
                     CVVQRLPPIIVSTAQSRTEALGAEPVLLQAVAEDPRGEALTFQWTANTGLLEPAVRDG
                     TRGEVRWSALSCVPADVEPTVRLTVTNASGLSATHVYRIRWDDRRCGAFPPCSVQWED
                     GRLVLTADCTTEGTLYIPDGVTFDGAGHVVTAVDPEGGRFQGAVLRNRGGTAHVRDVT
                     VEARGLSEQACDAGEAGLAGIRFIGASGSIQDSEVRALHQGAGRGACQEGVAIEVRHA
                     LDASGSVTVEMLRNHVTGYQKAGIVASGRVVVAVEDNVVEGGGPSDLIARNGIQVSFG
                     ATGRVVGNRITGHIYSRPAYVAAGILVAGGGYYDAPVCEGLLIQGNTLEANDVGIDLS
                     QAEADGGPLARSSNLVVVENTLSHDRVENGFPYQAAIADLGGGNVISRNRISGAGYAR
                     DTLPGATFDVDVVADEAAQVAFLTPSQDVAAGTCSGALVVQSQDAMGNLSALASSELV
                     VEADGTGAVSFFRDSACTQVLLPLNGSGAMALEGPQQEAVFYFLAATAGALEVTVRGD
                     GVSASQTHVVR"
     gene            120595..>121983
                     /locus_tag="LILAB_RS00550"
                     /old_locus_tag="LILAB_00580"
     CDS             120595..>121983
                     /locus_tag="LILAB_RS00550"
                     /old_locus_tag="LILAB_00580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935224.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712236.1"
                     /db_xref="GI:760029185"
                     /translation="MVGCLGEEPTHEEALGGTGGAGHAAALSTASSQEGLQEPTCGYI
                     PCPVIENGNVLTLAGNCATYSTLRIPDGYVLDGAGHFVIALDPPGDHFKGPIARNCGS
                     SAFYMNLRLMLMGLSDVCDTGDDALAGIRFDDATGSVINTQVFNIRQGDGTGGCQEGT
                     GILIRNQDPSSPTRFVGVYGNVLLGYQKAGVVATGNVVVDITNNRLVGSGPIGNVAQS
                     GIQVGLGATGSIVNNLISGHSFTGEGVASGILVYGGPLYGGPLSSDVLIQGNHLFNND
                     IGVYLSQGNEDQSPPAVLTNNQVVDNVLHSDGVTNGYVYQAGISDLGTGNVIHSNVIT
                     GAGYDPATLPGSTFAVDVLAGPVASLAFLNPPRQAFQGLCSGPLIVQTQDANGNLAVP
                     TTTGFNITAAGPASPGIQFHTDPACAGPAVTTLDLANPQAQGRFYFRATTPGSVTVFV
                     WNDALSQAQPQLV"
     STS             122346..123422
                     /standard_name="D1S3688"
                     /db_xref="UniSTS:474266"
     gene            122487..124373
                     /locus_tag="LILAB_RS00555"
                     /old_locus_tag="LILAB_00585"
     CDS             122487..124373
                     /locus_tag="LILAB_RS00555"
                     /old_locus_tag="LILAB_00585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_043708922.1"
                     /db_xref="GI:760025786"
                     /translation="MAMVLATGGSAAWAAQAEARPPAAAVDTAEGAAPEFVPTTTSWI
                     YREAMEAPWQDYSWAPHSLTNTSPVAAGRHSISVTMRAWEALYFNTSPLTVAPGMTLT
                     LSVHGGASGNNAVVQTRAVVNGAFTPGTELGPYCTGGRIRANTWSTCTIPISVLAPQG
                     ARFTGLALQEGRGLSLPTLYFDELGVRGIPAPAPQVEVAINPTSATVPAGGTQAFTAT
                     VTGSANTAVTWSVQEGASGGSVTAAGLYTAPSSAGTYHVVATSQAAPTKSAVATVTVT
                     STPPPPGGKWVSGYYTGWNADLYPPEKVDFTALTHILVGRVTPNPDGTVNTQFDNSNG
                     PAIARTLSTRAHAAGRKAIIMVGGAGEHDGWVGAASSANRARFVQNLVNAMETFGYDG
                     LDIDWEPVEQADKPALLALIQELRAARPQMLLTMPIGWVNSNFPEDADPWFTHLVPYL
                     DQMNVMSYEMTGPWGGWLSWYTSALRGESGYHPTSVSSSLNAWVGAGIPRSKLGMGIP
                     FYGMAWRNITGPYQPYTDWSDYVGSDNSFTYEKILELSATGVYRWDEAAQASYVTFDV
                     PVEDGTVRWISYDSPQAIAAKGAFAHDNGFGGTIIWTINQGCTDPATGANPLLDAVKD
                     AFLE"
     gene            124806..126683
                     /locus_tag="LILAB_RS00560"
                     /old_locus_tag="LILAB_00590"
     CDS             124806..126683
                     /locus_tag="LILAB_RS00560"
                     /old_locus_tag="LILAB_00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935226.1"
                     /db_xref="GI:503701150"
                     /translation="MASQAEPLEADLPRVPTEQDVAWELDMYPTVGVSALPTLNLVKF
                     WTYERFLINGDKGIWTRPELERNLLAKAEVDECFSSMGGPISQPPCDPGTTPKRNQAY
                     VWGLALADRSLWFGTVANTLCLVEQGFLGATTPQENPYWVCEFGQSQSGTGDFRPPDL
                     QRYQLNTGVLSSLNGSLPGWAELLRRTTVGLRSAGAQDGVVFLAGPSLIAGINLFAFH
                     SETGAFLGATNLPQYNNIREWVNVRGALYTGVAYSQVVGNAPGGAVLRWRGQRSTNPA
                     VLFNFEVVGQTDAEVANLVEHAGRIYVTTWPTFLSGGAPSPLTARFMGVWRSPRLEQD
                     GLDDDDASQWRKVWDIRDYEPDLVAAATTGGGAVASFDGRLYWGTMHVPFLATSVALG
                     AHAAGLLNLDADGSGSLDWLELLNTALGTHRSTSVFQSDELGNQDESVRVIYGEKYLP
                     RYSPLARGYDIAFNDFYRNRLENPEPRWGSSGLGNFFNAYTWALEVYGNDLYLGTFDW
                     SQVARVGLQEAIGGVTLPPMAPPAIASSLHSVEDARRAHHHFLRVLNIAIPKEGADLF
                     RFEGRNKSAVAESLRGLGNDTNYGVRTLVSGRKALYVGTANPMNLHPDGGWELLQLKK
                     D"
     gene            126838..127332
                     /locus_tag="LILAB_RS00565"
                     /old_locus_tag="LILAB_00595"
     CDS             126838..127332
                     /locus_tag="LILAB_RS00565"
                     /old_locus_tag="LILAB_00595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935227.1"
                     /db_xref="GI:503701151"
                     /translation="MTLPSKLSIAALSLSFLSPVSALAVEKTVTSQYVDTSAYLTSEA
                     DIEAWYQLTRSLNQNFDAICGDTFCEGEYSNIESLRFRCSVNDQTGQLGQCVWVFAAS
                     NEEVDPATGAVTVDAQTWSCQVPLAPSTTIQQLLTALAGTSPLYATLPNTQTTIYEGL
                     GDCL"
     gene            complement(127393..127941)
                     /locus_tag="LILAB_RS00570"
                     /old_locus_tag="LILAB_00600"
     CDS             complement(127393..127941)
                     /locus_tag="LILAB_RS00570"
                     /old_locus_tag="LILAB_00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712238.1"
                     /db_xref="GI:760029187"
                     /translation="MAKNADESAVAEAVERLKSLAEEVEDLTVEFSKPVTAAEVAKLE
                     KKFKLKLPPSYVHFIRTYGTFKVLHGGRELIGMEEPGFLRAAAPDASDAVNGDDPDVE
                     EAINEALFFQRADDDAVDNFWCFNPRDVTPEGEMGVVGYYHDETFELPQLLGTKNARH
                     FRAFPAHIVEIIDELIENFAEA"
     gene            complement(128203..129624)
                     /locus_tag="LILAB_RS00575"
                     /old_locus_tag="LILAB_00610"
     CDS             complement(128203..129624)
                     /locus_tag="LILAB_RS00575"
                     /old_locus_tag="LILAB_00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002639316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_013935230.1"
                     /db_xref="GI:503701154"
                     /translation="MTTHSIRTRLVAPALMVLGMLSAPALAAAPAPARTREAPPAPQA
                     PKPFKVPVRTEFKLDNGLEVSLLPYGDMPKVAIQLAIDTGNIHEKATETWLADLTGRL
                     LSEGTTTRSAEQLAQAAAQLGGSLNIGTTMDQTYVGLEVLSESAPDAVALIADVIQNP
                     AFPPAEVERVKGDLVREMAIYKSQPGTLADERLLQALYGDHPYGRYFPPEAQLKGYTA
                     QAVRAHYDANIGAARSRLYVVGRFEPAAVEKAIRGAFTGWKAGPARLQNLPKQQVAKA
                     VQFIDRPGSVQSTVRVAVKALPPSSPDFVKQTVLNTLLGGYFSSRITANIREAKGYTY
                     SPHSTVSAHLGDAYWVQNADVTTAVTGESLKEIFKEVATLRKTPPPAEELSAVQSYLA
                     GTFLLQNSSRSGIIGQLRFVDLHGLPDSYLQNYVQSVMAVTPEQVQQLAAKMLTREAM
                     TVIVVGDQKAVAPQLKVVSPALK"
     gene            complement(129637..131076)
                     /locus_tag="LILAB_RS00580"
                     /old_locus_tag="LILAB_00615"
     CDS             complement(129637..131076)
                     /locus_tag="LILAB_RS00580"
                     /old_locus_tag="LILAB_00615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002639317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_043708924.1"
                     /db_xref="GI:760025788"
                     /translation="MRRVFGAVALAAFAGCATTQEAQKPETPPAVEAAKVEAPAEPPS
                     KLQVPVDYYKLDNGLKVVLSRDSSAPKAVVAVYYNIGFRIEPKDRTGFAHLFEHMMFQ
                     GSTNLGKMEFIRLIQKNGGVLNGSTRFDFTNYFEVVPSNTLETILWAEADRMRGLDVT
                     EENLKNQQGVVTNEVKVNVLNQPYGGFPWLDMPQVANSNWYNAHNFYGDLKDLEAASL
                     ADVRAFFKTYYAPSNAALVVVGDFEPEQVKGWIQQYFGPLPTVAQPSKPDISEPRQTK
                     EKRHDKVDKLAQRPALAVGYHMPDVGTPEYYAMALVDEVLLNGNDSALYQQLVQKKGL
                     TGEVSGGVNQLGNHWNYNGPMQWTAYLFHDADTTTETILTEFDGVVARLQEQPIDEAT
                     LERARVKARSRLYGQLEGFLGFGRADLLASFALFFDDPARINRLEAELMKVTPELIQK
                     TAKEYLRRENRTVLTVTPAAATATQTKAP"
     gene            131569..131784
                     /locus_tag="LILAB_RS00585"
                     /old_locus_tag="LILAB_00620"
     CDS             131569..131784
                     /locus_tag="LILAB_RS00585"
                     /old_locus_tag="LILAB_00620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935232.1"
                     /db_xref="GI:503701156"
                     /translation="MRHLEPLLGGFTAKMAIQTAALRTLKRPPEQLKREDLPQLLEGL
                     KPMLNTFIGALHAKVVLAEISASLEKL"
     gene            131784..132677
                     /locus_tag="LILAB_RS00590"
                     /old_locus_tag="LILAB_00625"
     CDS             131784..132677
                     /locus_tag="LILAB_RS00590"
                     /old_locus_tag="LILAB_00625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935233.1"
                     /db_xref="GI:503701157"
                     /translation="MSTHSTGRAAGSIVPWFGAVLVLQLAHAFAAASALDAPHSLQLV
                     HDVAGWGSGVLAVAGTFAAARSFAQGDYLRKVWGGLAAGAFLSLVSTALRSYWLHAVP
                     DVPFTQSPLLPLRMGVVVLANVCTTYALILLAMTYRQSGLQPPSSFRSNALWAGTAIA
                     ALAVGLPVLATEVRHLGADSAATMSAVISLASTLADMTTILLVAPILSVAYMLRGGRL
                     AWVWWAMGVSGAMWLFYDARVWLAPLLPGDAAQSAELLRTLRTSGLVLLGLAGWLQRT
                     ALAPRQAPAAGPEVQTHAGMS"
     gene            complement(132713..135127)
                     /locus_tag="LILAB_RS00595"
                     /old_locus_tag="LILAB_00630"
     CDS             complement(132713..135127)
                     /locus_tag="LILAB_RS00595"
                     /old_locus_tag="LILAB_00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II"
                     /protein_id="WP_013935234.1"
                     /db_xref="GI:503701158"
                     /translation="MEDEWLWGWDPTPGIVSVWAEPDGRAFVWRRVPRTGALVREDVR
                     FRPWLLLSSLEDLAHLGPRLRPESEGPARHRVTWQELEGPGALRYLVRAEDGRALTSA
                     VLEGASRRLGRPVAHLRDLGANAALALPPEEQYLTASGRTYFRDLDFDELRRMQFDLE
                     TTGLDPAHHRVFLVALRRPDGETETLEAQGEDDSAEADLLYHLAERVRTYDPDVIENH
                     NLHGFDLPFLARRARHLGVSLALGRAGAPGLRHRPSARGAALGRPVPGAPPDAMRRAR
                     YTVPGRELIDTLDAVLRHDFSTRDLPGHGLKAVARHLGLAGPEREHIPGARVYEVFRT
                     DPARVRRYARDDVTEAGGLARLLGGAAFALARMAPRRYERLADAGPATGVLDPLLVRA
                     YLREGAALPAHEDGDGTSHSGAALHLFATGVARRIVKADVASLYPSLMRQYRIGPRRD
                     RLGVLLALVDRLVDQRLAAKGRARAAAPGSQERFTNEALSAAMKIVVNSAYGYLGAVG
                     LTRFSDVHAANEVTRQGRQVLGLLCRELARRGVTLLEADTDGVYFAVPEAWREADERR
                     VVAEVAALLPPRVQLEFDGRYAAMLSHEPKNYALQPYDGPLVLRGVAFRSSRAEPFGE
                     AFLRRALRCLLAGDVPGVREVYVETVMALRRRKLPTLEVCAHVRLTKSAAQYLAIRPR
                     RRELPYEAMLASGRAEWPLGEQVRIYRAVGGRAGLLPVPEADDPGAARPLTREEDPRD
                     YDVEYYVRLLRETFAARLVRALEPEDFRTVFDDPGQPSLFAPSLAEARPILTVLAEPP
                     DAPEPV"
     gene            135266..135910
                     /locus_tag="LILAB_RS00600"
                     /old_locus_tag="LILAB_00635"
     CDS             135266..135910
                     /locus_tag="LILAB_RS00600"
                     /old_locus_tag="LILAB_00635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013935235.1"
                     /db_xref="GI:503701159"
                     /translation="MQRTERLFALAEYLRGRRTGVTAEVLAERFGVTVRTIYRDLDSL
                     RASSMPVSAERGRGGGYALDRSYSLPPVNFTAREAALIVALGRFAIDMRLLPFAGTLE
                     SALDKVRAALSTSAQRELLTRLRELSFIGVPSLPSRKGVREALERAWFEQQPLRITYV
                     DSNYLETVRDVRVMSVIMNRHETRIDGEDLSTGERRPFRLDRITRAEVLRAAGP"
     gene            complement(136039..136221)
                     /locus_tag="LILAB_RS00605"
                     /old_locus_tag="LILAB_00640"
     CDS             complement(136039..136221)
                     /locus_tag="LILAB_RS00605"
                     /old_locus_tag="LILAB_00640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRp25 nuclear protein, isoform 3"
                     /protein_id="WP_011551729.1"
                     /db_xref="GI:499870995"
                     /translation="MQGRSTKRQKEQARKQHQQEKNAKREERKKVKSERGPRQPGEVD
                     PDIADIIPGPQPPLEI"
     misc_feature    complement(136244..136659)
                     /note="cspA; Derived by automated computational analysis
                     using gene prediction method: cmsearch."
     gene            complement(136297..136503)
                     /locus_tag="LILAB_RS00610"
                     /old_locus_tag="LILAB_00645"
     CDS             complement(136297..136503)
                     /locus_tag="LILAB_RS00610"
                     /old_locus_tag="LILAB_00645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_013935236.1"
                     /db_xref="GI:503701160"
                     /translation="MATGTVKWFNDAKGFGFIAQDDGGADVFCHHTAIQSDGFRTLAE
                     GQKVEFETRKGPKGLQAENVRVVG"
     gene            complement(136838..137482)
                     /locus_tag="LILAB_RS00615"
                     /old_locus_tag="LILAB_00650"
     CDS             complement(136838..137482)
                     /locus_tag="LILAB_RS00615"
                     /old_locus_tag="LILAB_00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935237.1"
                     /db_xref="GI:503701161"
                     /translation="MSGQSLTGKMLEGARKWAKRLPNALSDDMAVDVSRGRVRLSHSR
                     VEAVARQLLTRLKHFELREWSAREDVYDVRFSVRGWRLRVETTPERVELAAGRYRLWL
                     RTPGVVALEESQTASSLVMGVLRAGAGRAAMRALAERMLPPGIRWDGQVLQVEGPLPE
                     EGVLPARLFDTAALAMTAEHQAEGLWLSAEAWPGLMDLLQVVFGTELPRTPPGV"
     gene            complement(137628..138998)
                     /locus_tag="LILAB_RS00620"
                     /old_locus_tag="LILAB_00655"
     CDS             complement(137628..138998)
                     /locus_tag="LILAB_RS00620"
                     /old_locus_tag="LILAB_00655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="WP_013935238.1"
                     /db_xref="GI:503701162"
                     /translation="MQGGSEEDSGVASCAGLELRALLTSATEALASFSRRHAPSHAEL
                     FLAAERKLSLEYDAGTGRSTLNQGESLDATARVAWDARQGLWTAPVGDASALPLLLER
                     AEQVAAPGRAGPLPGLPAMSPAAPASPPALQPDRAARWMKRFIQTAVPPGSVVQAAVL
                     SQSAAWRALVREHGAPRVRTEWREALFVRCETPRGALVDAVALPPDANEDAFAPLRQR
                     LADAVDALTGPAHRVDRSLPLVLRPAVAAPLAAGLLWLLRGDVAAATPALARAVGRKL
                     FPSALSVVDDPHHPAGTRRVPLDDEGLPTEALTLVDAGVLRAFLHAADTATRLGAPPN
                     GRGFRPALAPPAPEAVNPWVVPGAAPALPAHYTELVARVETFTTMPRPGTVTVVAGGW
                     EVRDGHRVRRVAPVELELPVLETFRALRGVGNDLTFFPTAEGCGTPTLVFPPLLADAP
                     GGHAAR"
     gene            139143..140468
                     /locus_tag="LILAB_RS00625"
                     /old_locus_tag="LILAB_00660"
     CDS             139143..140468
                     /locus_tag="LILAB_RS00625"
                     /old_locus_tag="LILAB_00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="WP_043712240.1"
                     /db_xref="GI:760029189"
                     /translation="MEPRAARCGARPEDTRVDWFVERREVTEVLHQRAGARVVAPMLD
                     RGWSRGHATPEGTTWQWAQVGGTHAKKGLFPGELEHRARPLLDAEPRLGGDTEATLAL
                     VHRLAETARAAGALHLDVLLRQVERHTLSASDAHLREDTQRHALLEVKAFHDSGAGIA
                     ELWRCAAWPDGAGARAALPSLEALVEGLVRELRDTTPRVPCPRGVLPVVFPPGAASGC
                     FFHEVCGHPLEGDVVARGGSYLARRLGQQVAGAHLTVSDDPTDGHGALGFAWDDEGHA
                     ALPVTLLREGRVDAPLLDARSATALGRAPNGHGRRVSYRHPPLPRMAHTRVDAHQGHL
                     EALMADLPHGLLVQHLTPRQMDLLSGDFSFYIVEAREIRDGRPGRRVGPGILRGNGLE
                     ALAAIDAVGADAKNLFATRGCRKLDHGPLPVSFGQPTVRFRGLAVEPSR"
     gene            complement(140491..141588)
                     /locus_tag="LILAB_RS00630"
                     /old_locus_tag="LILAB_00665"
     CDS             complement(140491..141588)
                     /locus_tag="LILAB_RS00630"
                     /old_locus_tag="LILAB_00665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935240.1"
                     /db_xref="GI:503701164"
                     /translation="MQVRSLLASTLSAAVLSACGGSSAPPPPVLDADAPFTDLPARRV
                     PVSGVIFDPEAMFYSFVMWPPDPNDPEAGPPLPALLYGMPTVMRASAWGAQVSMVGPT
                     GEVVDTSGPAMPPWGNFQTEGIPADPTVPYLMRAEPAPGMSVGGNDMFPVEEGYAPIP
                     EVPYHATTTLRPIAATGTQCLIQSPAIVGEAGALGALAQVISEETGTSVSPASLADAA
                     SGRSVALLWVYSPSPVLDAFLFPSGDIAAETTAGALYAIDWAPPGSFPGQTEMGYFAI
                     PNGMSSLGYYAVVVPPGAASALTVSFVDTLEDAEQGRPWEVPPFFVQGLPPGVSFTRL
                     FAMAPMPPMEENPYEEPAPPPDFGFLCYPEG"
     gene            complement(141606..143510)
                     /locus_tag="LILAB_RS00635"
                     /old_locus_tag="LILAB_00670"
     CDS             complement(141606..143510)
                     /locus_tag="LILAB_RS00635"
                     /old_locus_tag="LILAB_00670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708926.1"
                     /db_xref="GI:760025790"
                     /translation="MRVTRALMKSLCKRLLLSLVVFSAGCDVFNIGDAEGTRGRGARA
                     FDPYSSSASGAIALSLLYYNGCAILPTGEPVSPGSLNLPDYPAACEAMNMMGQPVPPS
                     ARFEVTPGVNYFIREFTAVDAITGVHTDFNDHHAPSFWMRKQSRFKDLDWSGVTVGRD
                     EWTNDYDSTFQRETYYENAAWMRSLDDTFLIEVLDADGAVRTSVTYSRRDFMGESATT
                     GRTRASWMVADLARPRFPGDPEVSLLPDGTEPTYNTMVKASFSGATDPFKTLAMPQLT
                     GEGLIRVTWSLLPLQPFVFPIVFTPEAERPATCYRLDETGLATDEQVPCGFGLTQAVR
                     VNRPANGSFFMPGDSVDFMVSLRDGDGNGLHPRNRMPSYNEYMGESSNGLAYFNEQML
                     LTYREASSSESGFKVVGPLQDLQVSRGSYDLPYFSFPTFSEPHFYLPPGSNLLAGGGD
                     AQPPTHYSVQLPPNAKSGTYAIILKGHRSYMGERLNRLDPFFFQVGQAQPTTYPGRVG
                     NCQVCHNGVNSLSNVHHGMSVDHVEACKTCHIEEGYGYLPDVIHRIHNSSRKYNQNKG
                     DCTMCHLTRESTLWPSLMSCNGCHVSSHGTEYFDLRFEPMQNTPNGYGNCAESCHVTT
                     PPAEHILPPR"
     gene            complement(143595..144566)
                     /locus_tag="LILAB_RS00640"
                     /old_locus_tag="LILAB_00675"
     CDS             complement(143595..144566)
                     /locus_tag="LILAB_RS00640"
                     /old_locus_tag="LILAB_00675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_013935242.1"
                     /db_xref="GI:503701166"
                     /translation="MRSSLLFLLLALSACQRNESPPPAKAPAAAAPAPSTPKAPPAAV
                     AVDTAKLERGRYLVENVLACGSCHTPRDWSRYGGPVSGPALSGACWEDASWELPGRVC
                     APNITPDPEHGIGRWTDAELLRALRDGTGRDGKTLFPLMPFLLYRELSDADAHAVIAW
                     LRQAPASPRDGGRSAIPDEVYAQYKDLAAPVKAVVPEPAADDVSRGRYLATVAQCAAC
                     HAGMDEAGTPFAGGRPLPTPHGPEVVANLTPHARGLGALDEAAFVARFTAFKDLTPAP
                     AKAGQVNKLTMPWVFFAGLAEADLRALYRYLRTVPAMAPPAPSASGK"
     gene            complement(144581..145579)
                     /locus_tag="LILAB_RS00645"
                     /old_locus_tag="LILAB_00680"
     CDS             complement(144581..145579)
                     /locus_tag="LILAB_RS00645"
                     /old_locus_tag="LILAB_00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_013935243.1"
                     /db_xref="GI:503701167"
                     /translation="MRSYVDAFSAYWHPVAFSNALTAAPLAVQLLETELVLWRTGSGV
                     AVSHRRCSHRGADLSLGVVTPEGLRCGFHGWTYGADGRCVRVPSQPSAPIPARARVSA
                     FQATERYGLVWVCLAPEPAAPLPEWPELEDGTLATVPLPVLDWDVAAGRMIEIVLDVA
                     HLSFVHEGTFGNPEQPEVAPYEVERRPTGVSARIVYPALAPSTDGLPPRVDRTTLTYD
                     VTLPFAAKLAFKPTLFYVHTVYAIAAPLSEEKMRCFYFASYHPRLRNHFPDMFVKSEL
                     AILEQDRRTLEGVRPRAQPLDFAGEVHSPADRLPIEYRRGVIALRLGRPVDGPAPE"
     gene            145864..147852
                     /locus_tag="LILAB_RS00650"
                     /old_locus_tag="LILAB_00690"
     CDS             145864..147852
                     /locus_tag="LILAB_RS00650"
                     /old_locus_tag="LILAB_00690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708928.1"
                     /db_xref="GI:760025792"
                     /translation="MRLVYAQGAPVMMPLLSVRALAAAVLLWSLAASAEPWNGTEPGV
                     TTLQQVLLSFGAPTRQVHKDGEVVLTYQRKAAPGGTRSTSFHFDARQGVLRRIEVIPT
                     RPPTPAGLTALYGPACDAAKPPDAGLDCREEEAAPARQRWWHYRERGLSVRLDARQRV
                     KSMRYIEPLAPVRGSPARGPLPQAGSEGTTVPAAATPDDAPRAAPASGERPPDAGSAA
                     GLATAAVDPGEAGAPAGFEDLLDAPAPTAAPAGAGPSGTLVEGWQGPGGEAADPWHEN
                     PQERQPDVLAVGGIYFQRAEVTGLRSRGKTSYAPVLPALADIYLDATPSKHVRGFMMG
                     RLAYDPLSTEANGPAAALGQMWLKFDVAQRLFVTAGRQEIRWGSSQIWNPTDFLQAPN
                     PDPLNIFDLRTGVDMVRVTVPWESMAANLSLLGTANVEDAGEDLRRVRYGGGVRAEMA
                     VGTGEIAATAMFDQSRRPRYGLDATMALGLLDFNAELAWVGDGNTRLWARQGDGFVER
                     TLESRKLLVSAGVSATFNFAELYRAVVRVEGFHNPLGYDDRAFLPWLSEQGDFRPLFH
                     GRYYALGQVNIGRRGMSQLSLIFTTIANVQDASYLSRLAFNSSPFDIRDIFVQTFVEV
                     PYGERGSEFRFESLPADPTVPGSGLGVFRAGVSLYVRI"
     gene            <148049..>151162
                     /locus_tag="LILAB_RS00655"
                     /old_locus_tag="LILAB_00695"
     CDS             <148049..>151162
                     /locus_tag="LILAB_RS00655"
                     /old_locus_tag="LILAB_00695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935247.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_043712242.1"
                     /db_xref="GI:760029191"
                     /translation="LSPAQERMWFLHQLRPDTATYVVPWAAMLESPVDEGALDGALRA
                     LLARHPLLRARFPAEAGRPQLRYLDIPERVLDVEDATGASEAALSRRLREEASRPFDL
                     EQGPLYRFRLLKLAGQRQVLTLVFHHLVTDGASINVLMRELGVLHAAHARGEAPALAP
                     LPLEYADAAAWQHTPDATAQEPELLAWWKRQLEGAVQGLELPTDKPRPARRSDRGALT
                     ERVTLPPALTRALRAFCRERQVSPFMTLYAAFAALLYRYSRQDDFCVGTPVSGRTHPS
                     LEELVGLFVNTVVLRTRVNAADAFTALLDQVRATTLGALGHQALPFERLVQALGVERS
                     LSHSPLFQVMFDLYRVEHSLAGAFPEAQARDLPMDTGACEFDLHVTLFESASGFELFA
                     RYSTDLFEASTARRMLGHYLQLLTHALRAPDTRVDALSLLPEAERARVLADSNPPRRP
                     FPLDAPFPEHFSAQAARTPDHVALASASARWTYAELEAHTNRAARRLVAQDVGLESVV
                     AVLGRRSEATVRALMSIHKAGGAYLPLDAQLPAARLARLLAESRAPFVLPLGPVESLL
                     AEVLAELPAELRPRVLSLEGLDAERSERLAPRATPDSLAYVLFTSGSTGTPKGVMVDH
                     RGMLNHLLGMREALGLDGYDVVAQIAALSFDISIWQMLGALPGGGTTYLIEDDVMRDP
                     PRLADALEQGRATVMEMVPSVLQAILEGARPEQDFPDMRWVVLGGEPVPPALCRTWLE
                     RCPGCRMADAYGPTESSDVASLHFINEAPEGTFTPIGTPKANMEVYVLDDALQPVPAG
                     VVGELYLGGLGVARGYVGRADLTAERFVPHPFSTTPGARLYRSGDLGRWLPDGVLQFV
                     SRADLQVKVRGMRIELGEVEAALASLPGVRSAAVTVQRRGPSDSWLAAWVVPSSPDTD
                     VHSLQAALARLLPAFMLPSRWVLRPQLPLTSTGKLDRKALAALPLDEAPSLSEGGPPR
                     GPLEELLAQLFCQVLGVERIEREASFFHLGGHSLSATRLVARVRHSLGVQLPLSSLFT
                     SPSVASPS"
     gene            151366..164964
                     /locus_tag="LILAB_RS00660"
                     /old_locus_tag="LILAB_00700"
     CDS             151366..164964
                     /locus_tag="LILAB_RS00660"
                     /old_locus_tag="LILAB_00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_013935247.1"
                     /db_xref="GI:503701171"
                     /translation="MLQPASSSLPPSASAPSLSQAQERLWFIHQLQPDSGAYHIPQAV
                     ELRGAVSAEALDSAVRWLLERHPVLRTTVVSQQGQARVEVSSVPARVLQTEALRSAPE
                     ALDLRLQQESWRPFSLEQGPLYRFLLLDIGDDRHVLLAVFHHLVVDGLSLDILLRELG
                     EAYAAFQRGQAPSLASVTLHYSDVAAWQRSEPVQARDAVQLDYWKQRLSGAPALLQLP
                     TDKPRPAVLTHQGASTGTQALPAALTDAVQRASREHDATPFMVLYAAFAALLYRYSQQ
                     DDFCVGTPVSGRTHPSLEGVVGLLANTVPLRTQVEPSTSFASLLAQVRSTTLDALGHQ
                     DVPFERLVQALGVERSLSHSPLYQVMFDLHRVQGSLADAFTGLEARPVPVDIRASPFD
                     LALSVIEQGGHVELFLRYSGELFEAETARRMLEHYQRLLAQALTEPHLPLSRLSLLSS
                     DEQAVVLRHARPTPLAFGLDTCLPERISAHARNTPDQVALASADAQWTYAQLETQGLR
                     AARTLRAQGVGHESVVAVLGRRSEATVRALLSLHKAGAAYLPLDAQLPASRLARLLRE
                     SRAPFVLPLGPVESLLAEVLEELPAELRPRVVSLQPMAAESDAPLTSFVTPDSLAYVL
                     FTSGSTGTPKGVMVDHRGMLNHLLGMQHSLQLGASDVLAQTAPLSFDISIWQMLGALA
                     AGGTAYVVDDDVVREPARLIAALQQAGATTVELVPSLLQALLEEPGDAPLPALRQMLT
                     IGEALPPSTCRAWFERYPSVPLVNAYGPAECADTATLWRMLAPPASASTPIGTPKANM
                     EVYVLDDALQPLPPGVPGELYIGGTGVGRGYVGRADLTAERFVPHPFSTTPGARLYRT
                     GDRGLWNTNGTLSFLGRVDFQVKVRGMRIELGEVEAALASLPGVRSAAVTVQRRGPSD
                     SWLAAWVVPSSPDTDVHSLQAALARLLPAFMLPSRWVLRPQLPLTSTGKLDRKALAAL
                     PLDEAPSLSEGGPPRGPLEELLAQLFCQVLGVERIEREASFFHLGGHSLSATRLVARV
                     RHSLGVQLPLSSLFTSPSVASLALEVASLQRSASSAPSVAGPTRDAGALQHAASSAPS
                     VAGLTNEAGALQRAASASTAPSLSQAQERLWFIHQLQPDSGAHVVGQAAEWTGTVDVP
                     ALDAAARWLLERHPVLRTTVSSRQGQPQASVAPVPASVLQVEPLPPGADAPARQARRL
                     TEEGNRPFDVEHGPLYRFLLLEAEQARHVLVVVFHHLVSDALSAGLLMHELGEAYAAF
                     QQGHAPSLAPVALHYSDVAAWQRSEPVQARDAAQLDYWKQRLSGAPELLQLPADKPRP
                     AVLSHRGGNTGYHPLPPSLSESLRALCRQQQVTPFMVLYAAFAALLYRYSQQDDFCVG
                     TPVSGRTHPSLEGVVGLLANTVPLRTQVEPSTSFASLLAQVRSSTLDALGHQDVPFEQ
                     LVRALGVERSPGHAPLVQVMFDLHRTELSAASGFHTLGARRVPIETWTCEVDLFLTAI
                     EVGEGFEVYFQYSTDLFEPGTVERLRNHYVQLLAHAVASPRTAVGELALLSAAERAQV
                     LQSFNATERPFDSEGTIVSLIEAQVARTPDAPAVVAPEGTLTFRELHTRASRLAAHLT
                     AAGAGPEAVVGLCLERSLDAVVSLVAIFISGAGCLPLEATHPPARRAALLRQARARLV
                     VSRPGLFAGVEPGVPLVSPDVRGDVVAVPRPPRAEHLAYLLYTSGSTGEPKGVELTHR
                     NVVHCFAAFDTYYATQPGDCWASSGSLSFDIHLEELLFSITRGARTVLREVGPLGLGR
                     DILRHGITHVVITPSSLATALEEPGAPEAFRALKVLVTGGEVLPDPLVRQLALTQTRL
                     VNTYGPTETSINVAAEITLPDRPVRLGRPLDRCRLYVLDASGAPVPPGVPGELYIGGT
                     CLGRGYRDRPDLTADRFIPDAFSGTEGARLYRTGDRVRWNGDGSLGFLGRTDFQVKVR
                     GVRVELEEVEAALLRQPGVRQASVVVRGSQRDARLESFLVLDDTAPGVEARLREGLSR
                     ALPEALVPSRFTVLNALPMTTSGKVDRKALAALPVQDMEPEAAPGARPRGAVEELLAL
                     LFCQVLGVPQVRREDDFFHIGGHSLAATRLVARVRQAFDVEFPLQAFFTEPTIAGLAR
                     ELEARRDGAALLPAPVPRPVDAALTLSPTQERLWFVQQLHPGTSAYHLAEAVELAGPL
                     DVAAMEDALRWLVTRHPVLRLAVPARDGLPAPVQAPVPARVLDVEASDAPEQWARDAV
                     HAPFDLARGPLYRFRLLRTAPEQHVLLLAFHHLVVDGLSLDVLVHELGEAYAAFHHRR
                     VPTLAPPRLEHADIAAWLRTPPARERDEAQLTYWKQKLEGVPGLLRLTPDKPRPEAPL
                     LTGAITGGHALSADTVRALQAFCREQQATPYMVLLAAFSALLHRYSGQEDFCVGTPVA
                     GRTHPALEGVVGLMLNTVALRTPVAPDAPFSTLVARVRATTLEALAHQDVPLDRVVQA
                     LGVERSATHSPLFQVMFDLVRTDRTLADAFPDLRARPLQPELLTSPFDLSLWVAESAT
                     GYTLALRYGTELFEVTTAQRFLGHYLRLLQHALEAPGTAVSALEVLPAAEREHLLQTW
                     NGADADFPREHTVHALFEAQAARAPDAPAVLHGADVLTYGQLNARANQLARHLRRLGV
                     RSQTLVGLCLRRSVDMVVAVLGVLKAGGAYVPMDASHPPARLNFLLEDTGAPVLITED
                     AVADTLPVSQALVLCLDSEWERTAGREPDAPLEAVSSAEDLAYLIYTSGSTGRPKGVM
                     VEHRGVVNYLHWARTAYAVDDGAGAPVHSSLAFDLTVTSLLLPLTAGRPVTLVPEEEG
                     VDGLAAALRTGADFSLVKLTPAHLQMLAAQLAPEAREGRTRAFVIGGEALTSAVVEPW
                     RRHAPGTRLINEYGPTETVVGCCVHTVDADTAVEGAVPIGRPIANTRLYVLDASLRPV
                     PAGVPGELYIGGEGVARGYWRRPELTAERFVPDPFSSVPGARLYRTGDRVRLRPSDVL
                     EYLGRVDFQVKVRGHRVEPGEVEAALMELPGIAAATVVLREDGVTGPRLVGYVTGHDA
                     VPDTEPLRAALTQRLPAHMVPAALVALPQLPLTPNGKVDREALPAPEAQAAPGEDFVP
                     PSTPTERALAQLWEALLGVPRVGARDDFFELGGHSLLSVQLASRVRERLGVELPVATL
                     FATPTLAELAARVDASPRVVEVVDAAPRARPERVPASLVQERLWYAMQLPEAPPFVVV
                     AALVLEGDLDVARLETALEAVLEHNATLRTTFHLEHGAVVTHAHPITRPVLVQTDLSH
                     LPAAEALDAARAIATRHDREPFAVDQGPLYRFELARLDATGTRHVLVASMSHLVNDGI
                     GMGAFLEELAQAWAAATPLLPPAPRTYADFALWQRSPEHLREVDAAVASWKDALAHAP
                     SVLDLPLDFPRRAPALNANMRPEPLSLGAEAMTALQALARREGVSPFTAVLALMQLWL
                     HRLSAQPHVVVASPFSGRVLPRSERQVGYFANVLPLCTEVAGAPSFRALLRRAWEVVG
                     HATANQEVPFKRIADTAQPDAPRTAPPLAQALLLLDSPASLSFGELRTTYLDGESIFP
                     AYDVVLHLIERPEGGTLGFLATDSALFTAATAQRMARAFEQLLTEAVRAPDAPLARLS
                     LLSSQQRAQVLATLDGGPQAIPEGACIHTLFEAQVRRSPQAPAVAHGESTWSYAELNA
                     RANALAARLLSQGMQPEERVGVVMEPSNQGMAALLGILKAGGAYVPLDAGWPEPRKRS
                     VLARAGVRRLWVDAEALEAHAGLVPDVEVPPQPAHIAEDLEPGPRHVPASQVAYIVFT
                     SGSTGEPKGVMVEHRSVVNHNVALAARFGLRPGDRMLQFAPLSFDAAAEDLYPPLVVG
                     ATVVMRSGLVPAHVMTPYLEETGITLISLPPTYIEEWIRQMESHGQRVPARLRLLAPG
                     GDVLKRETYEAWVRVGGGHAPWLNVYGPTECTITSATCDIPGAEGLGTEATFPIGRPI
                     PRVRIHLLDEHLEPVLPGLPGRVYIGGAAPARGYLGAPDLTAERFIPDPFSPEPGARM
                     YHTGDLARMLPDGRLRFLGRADHQIKIRGFRVELAEIEACLRQFPGVEEAVVLARTGG
                     SGQTQLQAFIQAPPAQVRVEALREHVASRLPSYMVPTALVVMEALPINANGKVDRQAL
                     PDASTQPAAPAVQETPGEHHETPFRTTLEMALERLWREVLGRTDIGASDDFFQTGGDS
                     ILAMRLLSRMEEELGVPVPLATLFQYPVFRETADAVQELLAEGPPRSSVVSLSGKQTP
                     KSAPPFFVFHPADGELHYYRNLTPLLEPGLRCYGVQAPETQSKHGHATFDARIDAYVR
                     DIREVQPHGPYRFAGYSFGGYPALGVAAALEAQGETVELLALVDALPATEGPQTPEDP
                     VRSMADEFGILDAALEAELASLDDAARWERVTALGRELGMLAPHSRAADLRRIWHVLG
                     EVLVPQVLGWKVPSVRARVQLFTSAPSRALHGETLGWERHLSREQLDVVPLTSSHFGT
                     LQPPCVQELANHLLEVLKRQGR"
     gene            complement(164965..165768)
                     /locus_tag="LILAB_RS00665"
                     /old_locus_tag="LILAB_00705"
     CDS             complement(164965..165768)
                     /locus_tag="LILAB_RS00665"
                     /old_locus_tag="LILAB_00705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708930.1"
                     /db_xref="GI:760025794"
                     /translation="MMNARRPLSILLLGWALLLPAAALAEAAPKPAEAAPKLAPDALL
                     RHIDEKMSFTSDYKGVIRLYETRKDGAKRAMEVHVYRREADNDLLFLSTKPRHLAGMG
                     TLRIGRNLWDYEATTGSWRRNTQRTNLLNTFTCEADFDRSRLAEDYAGKDEGDDTVNG
                     VAYRKLLLTAKNDQVTFPLMRIWVDPQNNIVKKVGYTASGRTLRTDIVRSYQRIKDPL
                     SGKHVLHYKEVLETEEQEGTQMVVRYDEVVLAPLAANIFTKAWLESRLR"
     gene            complement(165765..167057)
                     /locus_tag="LILAB_RS00670"
                     /old_locus_tag="LILAB_00710"
     CDS             complement(165765..167057)
                     /locus_tag="LILAB_RS00670"
                     /old_locus_tag="LILAB_00710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_013935249.1"
                     /db_xref="GI:503701173"
                     /translation="MRALLQIAFRNLLAHRERGLLLLIVLAGASAVLVGVMSVSAGVA
                     RAQREAVRTFLAGDLNVGGYFKEHPDSIFPVVGDTSKVRSVLQPHVPASCQVRERGRG
                     SATAGAGKHRVRSYLMSLDVAAEGNAGFRVRTGSLEALAKPRTVALSTSLAERLQVEV
                     GELATLFVQMPGGKRNAVDVEVVALLERAGVLGESAGLLVSNAMLRELYGFRPDSASV
                     IQLLCEDSTELEPLAGTLRGALQKAGFEVLPPAHEAYGDKLGPLLREGWAGQKLDVST
                     WEDEAAFLDFVGQGLGLLLVLVGAVVFGVVVVGLFVSLNVSVRERTREIGTLRAMGMQ
                     RRSLVAAFMLEGLLVGGAASLVGASVAAGLGVLLRDVLPVPDALATLFFSGTLPLAPS
                     LGHVVAAVLLVTIGAGLASIVPAFRAASLPPRSAMESL"
     gene            complement(167062..169134)
                     /locus_tag="LILAB_RS00675"
                     /old_locus_tag="LILAB_00715"
     CDS             complement(167062..169134)
                     /locus_tag="LILAB_RS00675"
                     /old_locus_tag="LILAB_00715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_043708932.1"
                     /db_xref="GI:760025796"
                     /translation="MALDSGVRVTLWWLTVQGVVARPRSWVVGLLAAGAAALLTPGVS
                     LMGSIHEGTRRSLIESGAGDLQVYAAASTGTPQVVVGPGGVPDLKPIPDYSALEPRLR
                     ELPGVREVVPLELGMGAVFRGNALDEKLAVLREAARAPTSEERDARLRRLGEDLRRTL
                     ARVARNADRRGEAFAEEPAFADDLRVLKDAAQPAFWERLTEDPQGLLEVLENRVARQA
                     GEGEELPVDYLGTDVARFARAFPRFELVTGQLPPPGTRGLVMGHATYEQYFKHPIAVR
                     MDTLRRERERGLTLAEDEQLRTLVERNVAEVPDLVARLDIERATSLQAGLARVLGETG
                     ELEALLARFLSVDDATFDTRFAQFYGELAPSLPLYRLKPGDTLSLKTPLESGTAVPVR
                     VYGTFRFQGLGGDDGRVNMMSVVDLVTARHLSGRFTEAQQEEARALFETFGMEGEAMA
                     PPESLEAFHPPDIVDAEARTVDTEQAPVFERARALPDTFSEDELSRGAVLQAAVVLEP
                     GTAVEDVEARIRALPGGEALATVGWQEAGGLLGGLVVMLQAVLLLFALLLSSFVALVA
                     AGTLLLLARERVAEVGTLRAVGMQRREVFASLLLEGTLLGGIGSVLGAAVGAALLRLA
                     TGGGVAVEDGSLQFFLGGTVLRPELALGGTLAVVVAVTAVVLLATLVPAWRGSAVAPI
                     EAMRKGEG"
     gene            complement(169204..173154)
                     /locus_tag="LILAB_RS00680"
                     /old_locus_tag="LILAB_00720"
     CDS             complement(169204..173154)
                     /locus_tag="LILAB_RS00680"
                     /old_locus_tag="LILAB_00720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_013935251.1"
                     /db_xref="GI:503701175"
                     /translation="MVQLVEEFLRAEGRVRDVWVSPEVAWVVPRRAVRAAELDALLHE
                     RLGARVPAVALVDALPRLDSGAVDEAALRRGAPPVPARLQSLEDALRQQGIEAVALVG
                     PQRDEEVHTPLDALLPADLLSKAGGVSPVSSKRSVAEARAHTEARPSLIDSGPRRMPD
                     GAPRTLVELLRQAVEHGPQLAITFIDVQGQRETLTFSALWDEALRLWGGLRARGAKAG
                     DRVMLAMERPGDFVRGFWACTLGGVVPVPLALPASLERSQPGVARLLSVSERLGAPLL
                     LTDGRASSALTEGGLRALALESLAGAAPGRPADVAPESPAILSFTSGSTGRPKGVVLT
                     HANLMAMGEGMVAGGWYLPGDLGVSWMPLDHVAGTSYPHLLALRTRTPHVLVARDYVL
                     ADVLRWLDLLTEFGGTMSWAPNFAYGLVADRLERGERRAWRLHQVRVLGCGGESVLPA
                     TLRRFSEPLRDNGLREDAVCPAWGMAETSSYFTMTRGVRGHPVEGATELGPPPVGAAL
                     RVVDDADVVVPEGQVGHLQARGAQVLSGYLDDAELNARSFTADGWFRTGDMAVIQDGQ
                     MAIAGRQKEVLILHGNNVYPQDIEEVVESVPGVLPSYTVACPTRSGAAQTDELAVCFV
                     PAPDAPPLAELLRSIREKVGRVLGFHVAHLLPLARQQVPRTELGKRGRTELRRRFEAG
                     ELVAEHHRALSILGGPATMPPCLAVARWVPRPLASSVSKAETQGAVVVIADEAFAGAM
                     REQMRGREVVRVAPEASGDLVHVLGALAERGLPCGDVVVRLPDVGGEAPAPDAVHQRP
                     VSGAGDAEARRVVLAASVAPLLRALQALSAGPGVRVLAVLPETGTGTHGAGTQAALLA
                     PGLLWAAAAEVPGLEARVTWAPSDASAAAHAAAREVTSQDAAREVAWRDGTRWERLFT
                     PWTPPPLAAPQRLKREGLYLVTGALGGLGREWARQLRQGVDARLLLVGRRAHGPEARA
                     LEAELGAAKYLSVDVTDEAALREAVRHAEAHFGQPCDGAFHFAGTLTPTPVADETPES
                     FVQGAAAHALGALSIAAVLEGRPQAVCVFAASLMGTLGAGRHAAYCAGTAFLERLAER
                     LTAQGRHAAAVSLSQVRETGLARALGTAPPGYRVLEPSQALASVALAGEHAPAHLLVG
                     VVASAWPWRQAGLGSGRYLDAAHVFLVPPPRPEGLSGAVLHPLTEWPRRADSSVDREA
                     LAADLSGTGDGTPAGPFETVVMEAFREVLGAQGVGAGSDFFTLGGSSLQATRVVARIN
                     ERTGLRLREVALFEHPTATALADHVRRVVDLTQLDISVLSDAQVDLLLRVLAPT"
     gene            173239..174762
                     /locus_tag="LILAB_RS00685"
                     /old_locus_tag="LILAB_00725"
     CDS             173239..174762
                     /locus_tag="LILAB_RS00685"
                     /old_locus_tag="LILAB_00725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_043708934.1"
                     /db_xref="GI:760025798"
                     /translation="MGTSCALMAAPHEPISLAQSLHFWARNASNESALFQTALRVGLL
                     DALPVEGREAPLPAEALAERLGCSARGLRSLLELLVCLDFVRMDDARRFSLAPHTATL
                     LGDGAFRKQLEAELPWWGPMGRLADAVRSGDAVDFEGQRWDVLGHLRERLVAPTAFAT
                     PAHEDFFDRFARSALRTQVLLAAGEGGLLAALAEGPRAEQALAEATSSRAPGVLLEAL
                     AALGMTRRQDDAWALTPEAKTLLEGKALAYLVRSLSVSARYWEALGRLDETVRDERYV
                     LDLKDPEVSGRFYADNSQQITAVFATHFQLSRRAAATLASVRPLEGAAVLDIGTGSGV
                     WGAAFARASSSTHVTYFDQAVVLEQVRRNVAKLEVADRARFWPGNLFTEDFGAADFDV
                     IILPQVLNVLSPKDIPGIFARVARALRPDGILVIAEYVLNERRDGPLDHLYFGLRRFM
                     TNEGDLLSASEYAKLLADVGLTTSVCIPLPTQELVFAARDGVRLPTTLAAPPRPPSA"
     gene            174882..175859
                     /locus_tag="LILAB_RS00690"
                     /old_locus_tag="LILAB_00730"
     CDS             174882..175859
                     /locus_tag="LILAB_RS00690"
                     /old_locus_tag="LILAB_00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_013935253.1"
                     /db_xref="GI:503701177"
                     /translation="MSAALQEDSDAQPSSTARPVRGVHPASIAARLRAEYAREVAALG
                     YHAHSVPGALAHLALHLGLAVAVAAAFELLLSHAPRAAWLGYPLVAFLIATRFRAVGN
                     MLHEACHGMLVRGKRHNRNLGHLLAVLDLTALDPYRRDHFTHHLHLGDAQKDLDFQPR
                     RRFGFADPGRPFVKSHLLRPLLLIHLPAFIRPVLFHREDPVWVTLTRWAFIGGLLAVA
                     HFAVGWDVFLRAYLVPYFVAYQVIRYWSDAVDHAGIISSADEFHRSRNHVFAWGWLNR
                     LLFPRNDEYHLTHHLFPAVPTPFQGRVHRLLLRDAEYAARDHAFSALTR"
     gene            complement(175856..177022)
                     /locus_tag="LILAB_RS00695"
                     /old_locus_tag="LILAB_00735"
     CDS             complement(175856..177022)
                     /locus_tag="LILAB_RS00695"
                     /old_locus_tag="LILAB_00735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I"
                     /protein_id="WP_013935254.1"
                     /db_xref="GI:503701178"
                     /translation="MEPLRTFFMEDYLEGSRFTARFNLGESGGRPVTVGELLLGSGVS
                     AERAAEVFLSTPLNDSPNWGRADLRDAVAAMHPGATRDNVLITTGTSEALLLLFRQLR
                     PRKVALAWPAFQLLYELPQRQGAEVVRLPVRWDTRGVPSVDADLWLERLEREQPDTVI
                     INNPHNPSGLVLDAALLAAVDRWAERTGATVVGDEHYRFLSSETSVLGASVYRPGPRH
                     FVTGSFIKCLGCPGLRIGWTVGDTAMLARMQNEKNYTTHTVNPVTEWVAREVLRDLNS
                     PALSRAREDWLRNRATLAAFLERSRGVYGVAPRGGLVTCIGLREARDDAGAEALLKAL
                     SDAGVFVLPLSAMEAGSPEGTHPLARGHGFRLGLGISPERFPEALEAIEGATAR"
     gene            complement(177041..178540)
                     /locus_tag="LILAB_RS00700"
                     /old_locus_tag="LILAB_00740"
     CDS             complement(177041..178540)
                     /locus_tag="LILAB_RS00700"
                     /old_locus_tag="LILAB_00740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013935255.1"
                     /db_xref="GI:503701179"
                     /translation="MSQPVSAPSPAFVQQLNFHARDASNEAAALQAAFSLGLFEQLPE
                     TGAGAPVPLEALAKRVGGTWRGTRSVVEPLVALGFVHLEDGKGYSLPAATAAFLRDEG
                     FTAELREARRWWHPLALLPQAVRAGGPVAWGGGTWDVLGWCRALFLAPPPSTPSAEAR
                     DFHDRFARNPARTLALVAAGELDVLARLVRGPVTLDALARDVGAPAEALEVLLGALAA
                     MGIAQAHDAGWGFTEAAGRALDAQSLPYFQRALPATMAYWEALGHLDEAVREQRFRLD
                     LRDPETARRIYQENASRISSIFASHLRLSRQAAALVRSMRPLAQARVLDVGTGSGVWG
                     AAFGLADPTSHVTYLDSPHVLDAVRPHLAKLKLEARSELWAGDCLSVDYGESRFDVIL
                     LPQIIPALPSAELPGFFARLARALRPGGLLLISGYLLTDRRDGPLDALYFALRRYVTN
                     EGDVLSLPEFRALLGPVGLTQARGFDMPIQQVVIAHRGDVAWPAAAPAA"
     gene            complement(178561..179586)
                     /locus_tag="LILAB_RS00705"
                     /old_locus_tag="LILAB_00745"
     CDS             complement(178561..179586)
                     /locus_tag="LILAB_RS00705"
                     /old_locus_tag="LILAB_00745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013935256.1"
                     /db_xref="GI:503701180"
                     /translation="MSALGQLVLMRLRMVMRQPEVVFWTFIFPVVTTLFLGLAFRNDA
                     LGPVRVAVADGAGAQALVAKLEGVPELSAEVADEASARRRLARGQLSLVLLPGAVPEA
                     LVDPSQPEGRTARLLVAQALAAPEGTPAPEVMKATPVSEPGNRYVDFLIPGLLGLSLM
                     SSSLWVVAGSLVAMRGGKLLKRLAATPMRRSHFFMSYLLARVGFALAEILFFCAFARW
                     LFSVPMFGSYFTLTLVGLAGAMCFASVGVLVATRARTEEAVGGLVNLVSLPMMFVSGV
                     FFASGNFPSWLQPVIRALPLTAINDSLRAVMLEGAGLASLGPPMLVLAVWTVVPLVLA
                     LRWFRWT"
     gene            complement(179586..180536)
                     /locus_tag="LILAB_RS00710"
                     /old_locus_tag="LILAB_00750"
     CDS             complement(179586..180536)
                     /locus_tag="LILAB_RS00710"
                     /old_locus_tag="LILAB_00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="WP_013935257.1"
                     /db_xref="GI:503701181"
                     /translation="MTHQDELAIEVKGLVKRFGDVTAVDGVDLDIRRGECVGLLGPNG
                     AGKTTTVEILEGLQTATSGEVRLLGLRWEKDAAALRERIGMTLQETRLVDQLTVEEMV
                     RLFTSFYPRPLEVEALIGLVQLGEKRHARVGKLSGGQKQRLALALGLAGDPEVLFLDE
                     PTTGLDPQSRRALWDVVAQLKARGCTVVLTTHYMDEAEVLCDRLVIIDRGRVIARGTP
                     RDIITSLGAEQVIELEAAPAPDLERLRPLPAVVAAQRHASRITLRVRELHLALPEVLR
                     EISAAGGQLLHLSTRRPTLDDVFIDMTGRSLRESAEEKAA"
     gene            180652..181473
                     /locus_tag="LILAB_RS00715"
                     /old_locus_tag="LILAB_00755"
     CDS             180652..181473
                     /locus_tag="LILAB_RS00715"
                     /old_locus_tag="LILAB_00755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_043708936.1"
                     /db_xref="GI:760025800"
                     /translation="MALTDSLEARVDRLELPFNEFGVDPYGISKSHVKHALRVFGAIY
                     RYYFRVRCYGVEHIPPRGRGMLVGNHSGGVAVDGAMVLTSTMLELDPPRLAQGMVERF
                     LHNFPVSSLWASRTGQFIGLPEHARRLLEDDRLLMIFPEGARGTAKLYNERYSLVDFG
                     TGFVRLALQTRSPIIPFAFLGGGSAVPTVFNAYTLGKLLGVPYVPLTPYLLPLPLPVQ
                     LEIHYGEPLVFHGTGDEEDHVIEGYVEKVKQRIAGLIERGRAQRHSRRLGRNLLP"
     gene            181470..182408
                     /locus_tag="LILAB_RS00720"
                     /old_locus_tag="LILAB_00760"
     CDS             181470..182408
                     /locus_tag="LILAB_RS00720"
                     /old_locus_tag="LILAB_00760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_013935259.1"
                     /db_xref="GI:503701183"
                     /translation="MRVLIPGISGGIARQLALHLHARGHQVAGIDTRPWAEAHAAGIQ
                     VYRGDVRKRAAEDVFRRWRPEAVVHMATVTAFTVPGKERGRINLDGTKAVFDHCAAHG
                     VKQVLFVGRHTFYGAAPDSPLYHSEDEPPRALEAIPELADLVAADLYAATALWRLPKM
                     TTAVLRLPYTLGAPGTGTLSSFLKGRRVPLVLGYDPLFHVLQEEDVVTALTLALEKQV
                     RGIFNVAPPPPIPLSVIVRETGRTAVPLPAPLLSLLLGRAGLPRLSVGALDHLRFPIV
                     VDNRRLLDATGFEYRHSVADTLRIYRESAPILPAGA"
     gene            182455..184038
                     /locus_tag="LILAB_RS00725"
                     /old_locus_tag="LILAB_00765"
     CDS             182455..184038
                     /locus_tag="LILAB_RS00725"
                     /old_locus_tag="LILAB_00765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PheA/TfdB family FAD-binding monooxygenase"
                     /protein_id="WP_013935260.1"
                     /db_xref="GI:503701184"
                     /translation="MSADIEEVDVVIAGAGPVGVLTANLLGLQGVRVLVLEREAAPHG
                     QPRAFSCDDEALRIYQAAGLLDALKPDLRQGRHVTFTGVGGQPIARLPLGELDFGYGY
                     TPVWFFHQPLLEKALREGLGRFAGTELRTGTDVESLEQDGAGVTVCYRTSPSGERRRV
                     RARYLVACDGGRSTVRALLGIPMEGRGEQEPWIAICGTVADEDAHPECHVVCDPVRPG
                     FVGRGPLGRFRWEFRLRLGETGEEMTQPGTIRRLIGPYVNPDRVTVERAQLYRFHSLV
                     AQRWQVGRTFLAGDAAHQLPPFMGQGLVSGLRDAANLAWKLAWVIQGRAPEALLDTYS
                     VERRPHVRALLDATARLGAVFTSRSTPMAWVRDTVLRGLQAIPAARRFVEGVQFKPAP
                     SIEEGWLLGGRRSGRRAAEGSYLPQPRVRRASGEERLLDDSLGSGFAVLSRGGSPGTE
                     VARELAESLGARAVTVRSAGVPGVDVDSVEDHTGRLSEWFREHGADVAVVRPDRFVFG
                     AVPLARMPELRAALGVEEA"
     gene            184232..185455
                     /locus_tag="LILAB_RS00730"
                     /old_locus_tag="LILAB_00770"
     CDS             184232..185455
                     /locus_tag="LILAB_RS00730"
                     /old_locus_tag="LILAB_00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_043708938.1"
                     /db_xref="GI:760025802"
                     /translation="MQPTLDAALLDALDRHARRRAQGIATLSTLVGPPERALRVWTEW
                     LQRRGQSVVLVDGDDVRAVVSAWAAAIARERDLVGDAEAFVARSQPQGQARMLQFRGK
                     TAHQRRVLMEGLTPPQGQSAAWELCRALLESPVSTPSGALPDVVGQAIGRAPLPALQA
                     LMAMVPAANTPALRVRSSASDFRALRTAAALCSAAPALTTGCVLSTEVLAEHLRREES
                     HALAMLREGRLDLAEPAPDEDAPEFPEAVVASTAARLRQEGSSAQVVALYESAVRTIA
                     SASREANGRARSEAERFLHARLQEHAPTRGLFVLNGTLDLGDGGRALEVDLLCRALHL
                     AVEIDGYFHFRSPDGFRRDRRKDVALQRAGYWVVRFLADDVVTRLEEILETLDTLIAT
                     RRGELTGKDASNGKR"
     gene            185442..186443
                     /locus_tag="LILAB_RS00735"
                     /old_locus_tag="LILAB_00775"
     CDS             185442..186443
                     /locus_tag="LILAB_RS00735"
                     /old_locus_tag="LILAB_00775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935262.1"
                     /db_xref="GI:503701186"
                     /translation="MGSAEQRLSGIALSWLMTRGERRGTRKELEAALRSFVEHRLSRS
                     EWKARFESLLESLLGGGTVALRGRSGLALTPTGRTAVLRFLHLDQPPRGLTWKKLKAT
                     HLVALSLDLPASKAVVARMKDADGVRAAALQRQHGLDAEEGLTLAQTRDRLLWRELGV
                     ETDRPFTLSAVQAHLLGKMLDTETKDPRKGVEQLAARAAGASRADAEAVRLSLLRRFA
                     VAQADDASEDEPEVRAAPGSEAQAAPAAFAERVLSVARDLPTGRFGANKVFISHVWKA
                     LQPEWRTREAFNAALLEANRTRLLSLTRADLVSAMDPKDVAESEVQSFGASFHFVVV"
     gene            186464..189988
                     /locus_tag="LILAB_RS00740"
                     /old_locus_tag="LILAB_00780"
     CDS             186464..189988
                     /locus_tag="LILAB_RS00740"
                     /old_locus_tag="LILAB_00780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_013935263.1"
                     /db_xref="GI:503701187"
                     /translation="MANDPRLEPFLDDSREVFTSVEQGQHIWQADPYDVETLNAPARR
                     AFKRLLDKASSDSPPSAGKLLLLLGESGSGKTHLVRAFRNTAHGQRQGFVGYMPMTVD
                     VTQYDRYILSNLIDSLDKPFDEAGDDDDSGLMHLSDALMAQCTSAYALHLKDEQILEG
                     EELHGTIRVVADELLMDPRFRDVEVDLLRALIYLHRRDPRLNRRIFHWLRCESLSEAD
                     QRVIGNLIPRTADDAPARMVEHLGRLMGGLGQALVLCVDQVEDVSDFEQRPQMENSFR
                     RAMNSLAAIASKVPRAVVVFCCLTDYWMKMKPLLNRSTVDRIENDPEPVMLEATVTAD
                     TARDLAARRLQALFEQRGFTLSPSDPTWPIPADGFEVLGGHRARDVLNECRRYRDRAI
                     QDGKLPASFPLQRPQELGKPHTPAEPRHQVLKPDMDQLWTDFRATLRIDPPEEPADVA
                     ELLAWAIEAGSKELGDARRFDVKPKEKEMLDVQLHPEGSKLLIALCEKDSRGGGLGKQ
                     MTEALKKASGKTPVIVRTTDFPPARPGGVIAEQLGALLRKGGRRVVVGDTELRDLMAL
                     RTFREKHAGEAALTEWSRTARPITRLKSVGDMLGLEKPDTTPPSPGTKSPNKPAPKNG
                     GASPMGNVGARSTATKAQSELFASPRTQPDGAPLAPDVLSGAKSKPSTRAETSAREAR
                     DVREHREPAVSQGHQHGSAELLAEDPLTGITVESQMLTGRTLTPPRGLKATIGFKRNE
                     PTAASPPSARPTETLTGPMRIGTSEGVFSQIVTVEPSELTRHSAFLGTTGSGKTTLAL
                     NVLEQLLLRGIPAILVDRKGDLAAYARDLSWEEHLDDPALIERRRLLRERVEVALYTP
                     GRSDGRPLAIPVIPRGLESQSPEEREQGVQQAADAIAGMLEYKTSPNDKAARALLTQA
                     LRLLVQRPPGSELTLEMVQKFVAEQDESLRQETGGLPPKTFAKLAQDLEVLRLDLRPL
                     MATGGERLDMNELLGLGAARKPGKTRLSIISTKYLGDLNRIRFWVSQLLLEANRWTSQ
                     HPASKLQAVVLFDEADIYLPATSKPATKQPMENLLKRARSAGLGVMLGTQSPGDLDYK
                     CRENVRTWFVGGVKEDNALKKLKPMFTEARIDAETRLPGQKPGQFHVLREGKVQQLRA
                     DRSAIRTDQLSEDDILKEARRTLERSSE"
     gene            190454..191908
                     /locus_tag="LILAB_RS00745"
                     /old_locus_tag="LILAB_00785"
     CDS             190454..191908
                     /locus_tag="LILAB_RS00745"
                     /old_locus_tag="LILAB_00785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="para-aminobenzoate synthase"
                     /protein_id="WP_013935264.1"
                     /db_xref="GI:503701188"
                     /translation="MSRPPSPTRFPDRTSFQAFVAQGYNQVPVVRRLPLGALRPVDLL
                     RTLPAEGRFLLESTRVSAEGRYSFLGAQPYLRFTAQGGQCFIDGTLQQGSPREVLRTL
                     LRRWRGVRHPGMPLFCGGAVGFFGYEAAHCFESLPRHPRDDLHLPEIALSFVDTFLAV
                     DHHEGHLLAVATGADWEDCERRLDTLEAHVRSATPTAPPTPPAMEGPSARYRSNFTQE
                     AYLDAVERVREYIRAGDTYQVNLSQRLEVDFPGEPLALYETLSAINPVHFASYLEGDG
                     FHVVSASPERLVRVEDGRATTRPIAGTRRRGTPEEEARFVHELRTNEKERAEHAMLVD
                     LERNDLGRVCAYGSVAVTKLMDIVEYAHVLHIESEVVGQLAPGVEPLDVVGALFPGGT
                     ITGVPKIRTMQLITELEPHARGLYTGSLGYLSFTGDLDLNIVIRTLVVKDHRAYAQVG
                     GGIVHDSQPRQEYKETLNKARSQLLALASVGRTG"
     gene            191905..192474
                     /locus_tag="LILAB_RS00750"
                     /old_locus_tag="LILAB_00790"
     CDS             191905..192474
                     /locus_tag="LILAB_RS00750"
                     /old_locus_tag="LILAB_00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935265.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_013935265.1"
                     /db_xref="GI:503701189"
                     /translation="MILVIDNFDSFTFNLVQALGAQGAELKVVRNDAITVAQVEALRP
                     DHILISPGPCTPHEAGVSMAVLRELGGRVPMLGVCLGHQCLGQVFGAKVIRAPVPVHG
                     KTAAIEHSGQGVFRGLPVPFTAARYHSLVVDTDSLPACLEVTAWQDGLIMGLRHRELP
                     RLEGVQFHPESFLTPQGPRLLANFLEPAR"
     gene            192492..193316
                     /locus_tag="LILAB_RS00755"
                     /old_locus_tag="LILAB_00795"
     CDS             192492..193316
                     /locus_tag="LILAB_RS00755"
                     /old_locus_tag="LILAB_00795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase IV"
                     /protein_id="WP_013935266.1"
                     /db_xref="GI:503701190"
                     /translation="MFSTVAVNGEVRRWEDLPLRDFAQGFFFGAGFFTTFRIEAGRPW
                     FLARHLARLRASLDAFPGAVRPPPPEHLTEDAVRESLQRCLRADAALGPAFQGVGKLS
                     ASDGRVLLTFRAHSPDLERLHHEGRALDSQEPGAYRRGDPTLNHKGLSYFRQYRVMER
                     LPLLGNEAGEVCELPTANVFVQWDGALVTPPLSAPCLPGIIREVLLEAGHVGPLPVLE
                     RPVPFARLSQASACVFTNAAQVATGVPSLLGRALPDSLALAHDLRRLVEGIAARER"
     gene            complement(193322..194884)
                     /locus_tag="LILAB_RS00760"
                     /old_locus_tag="LILAB_00800"
     CDS             complement(193322..194884)
                     /locus_tag="LILAB_RS00760"
                     /old_locus_tag="LILAB_00800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935267.1"
                     /db_xref="GI:503701191"
                     /translation="MDVSAARERGGISARAFSLGVFGVTAAFGLFCLGLQYTPDSLHY
                     LSVARGLLSGSGLSGTLLAVDTAAPRPLDLWPPLFPMAWAALLWLGPDAAVITLHLLC
                     FAVLAGALFSMAPAGQGARYLWTCAVLIILYRPFGHVAAAAWSEPLCVALLALALARE
                     VRGADGAGRSFLVGALLGLAVLTRYAALFVVPGLLSWRFVWAREAGGPWRRHVVNAVA
                     LGAGLGLVVAPWFIRNVALFGQALGPPRAPRGAGLVASLLSGVETLLGDASFGAFGVL
                     CVAATVWLLLPALRGVKGALPPDDALARLRPAALMAVSYVAGLFWSATRTQMDTLDGR
                     LLAPLGVGLLPVTAAVLVALVERSRLMSAPVLVATGVVVVAGHLWAPLHARVRQPRQG
                     FHHLRERIAPVPAWVEAHVTERDLLLGPQLWWVHPFSRAPVVADGYPERGFLTLQTLG
                     PYLREHGAAYERFFWLGTQPPPVDAASFEVVEVARLETNAYWSTVWNAVWEIRPAGRV
                     TPMDRHKARPAP"
     gene            195254..195667
                     /locus_tag="LILAB_RS00765"
                     /old_locus_tag="LILAB_00810"
     CDS             195254..195667
                     /locus_tag="LILAB_RS00765"
                     /old_locus_tag="LILAB_00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708940.1"
                     /db_xref="GI:760025804"
                     /translation="MGSVSDGSIQGSRYAQRPEGGPASGMGQAGKEQAKQLGSAAKER
                     VYHQVESRRGDLAKGIRGFVSTLESLSDRDEAKVARPLLGGAAGLLRRTSERLENETT
                     DELLADAQSRVRERPGLFIAGCVAAGFALGRLIKA"
     gene            <195721..196110
                     /locus_tag="LILAB_RS00770"
                     /old_locus_tag="LILAB_00815"
     CDS             <195721..196110
                     /locus_tag="LILAB_RS00770"
                     /old_locus_tag="LILAB_00815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935270.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712243.1"
                     /db_xref="GI:760029192"
                     /translation="GALFSEFTAQARRLVRAEVSLARTELRAEARKASAGARLLAGGG
                     VVLLLGALTFVAFLVAVLAEALPLWASALIVAVVLLAVGGGVAWSGLQRMKQVHGPER
                     TIQTLKEDGQWASRTAHAMKSQIHGHA"
     gene            196107..197069
                     /locus_tag="LILAB_RS00775"
                     /old_locus_tag="LILAB_00820"
     CDS             196107..197069
                     /locus_tag="LILAB_RS00775"
                     /old_locus_tag="LILAB_00820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014445133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935271.1"
                     /db_xref="GI:503701195"
                     /translation="MSHLADELARRAEPDRLKALASEKAAALKERAREVATHKATELT
                     QHAKEAAVEKATELKTQARETVMQRSMELKERADTPKGWSLLGALVGAGVGSALMRKA
                     FTRRAARQYDESDGGRDERWRYDGPRAGRDDLRSTREEALGAGIGGIPERRAGGEEAL
                     AGMRASASDKAHEVKGRAADKATELRERTTDVVHKARERASHMRERVPSREDVQHRAS
                     DWFDRTADEQPLLLAVGGITLGMLASTLLPVTGQERKLVEPAKRRAKEGVSQLGGQLH
                     EKLQGEEQPASGGAGGPALAPSDASSVSARRVETTRQEDSRETH"
     STS             197065..197832
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            197207..198466
                     /locus_tag="LILAB_RS00780"
                     /old_locus_tag="LILAB_00825"
     CDS             197207..198466
                     /locus_tag="LILAB_RS00780"
                     /old_locus_tag="LILAB_00825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935272.1"
                     /db_xref="GI:503701196"
                     /translation="MCAAVAVPPELLTAASHPPPPGAAVAFTIRLGEALHRYGTPAHR
                     LELLMQRVSERFGLEGRFFSTPTSIFSSFGPPEALRTSLVRVEPGDMDLERLALLDSL
                     ADDVIHGQVPPAEGAQRVEAILAQPDRFGPALQLLCWTLAGGAAGRLFGGGLKEMAVA
                     AFSSLLIGALGVLTRKQPTTARVLEPVAAILSSAVAAVAASLMGPLSAQVATLAGLIV
                     LLPGLSLTVAINELATRNLISGTSRLTAAALVFLQLGFGVALGSRLSLVLPAPPVAPL
                     PPAPPDWTQLPMLLVAIFAVCVLFRARPWDWGWIAGACTFAFAGARLGSLLLGAQLGA
                     FVGSLLLAMGSNALARLRNKPSITTLVPGLMLLVPGSVGFRSLSSLLERDVVAGVDTA
                     FSMLMVAVALVAGLLSANALVPTRKVL"
     gene            complement(198481..198897)
                     /locus_tag="LILAB_RS00785"
                     /old_locus_tag="LILAB_00830"
     CDS             complement(198481..198897)
                     /locus_tag="LILAB_RS00785"
                     /old_locus_tag="LILAB_00830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935273.1"
                     /db_xref="GI:503701197"
                     /translation="MPPFDSTPFTVWLLQALCAVFLAILFLQSGLDKVIDWKGNLGWL
                     TGHFAKSPLRGVVPLMLATITLLELAAGALSAAGLVALVATGSAALAFWGALLSAVSL
                     VALFFGQRMAKDYAGAGGLVPYFLLTLVAVYVTRLG"
     gene            199019..200209
                     /locus_tag="LILAB_RS00790"
                     /old_locus_tag="LILAB_00835"
     CDS             199019..200209
                     /locus_tag="LILAB_RS00790"
                     /old_locus_tag="LILAB_00835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043708942.1"
                     /db_xref="GI:760025806"
                     /translation="MATEQTARRVFTGLIILSIILLALVVRPLAKAFFLAAVLAGTFY
                     GLYSRLSRKLRGRHSLAAGVIVSGVILALLLPLGGLTAFVVTEVSDGVKFVSDTVQRE
                     GVEGLIGKLPGPVRSAVDGLLERVPLEQAELDETLQQQVSSQGGTAARAVTGVVAATG
                     SIAFQTVMMLIALFFLLTDGAKLVGWLESVSPLRRGQTGEILREFRGVSVAVLVSSVA
                     TAGVQAAAALVGFLIARVPASLFFAGVAFFMALIPAVGAAIVVLVAAALMFFSGHPWA
                     ALFLVIWGTVVVGLVDNVVKPLLAKRGMHQHGAIVFFALLGGLAAFGTVGLLLGPLIV
                     AFFLALVRIYERDYGRPTPRPGDPSTPGGQGSGEESPIIRPSTLPAESSERAPLSPTP
                     PERH"
     gene            complement(200286..202019)
                     /locus_tag="LILAB_RS00795"
                     /old_locus_tag="LILAB_00840"
     CDS             complement(200286..202019)
                     /locus_tag="LILAB_RS00795"
                     /old_locus_tag="LILAB_00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_043708944.1"
                     /db_xref="GI:760025808"
                     /translation="MRDDATPSSHGLSTWRRHAAALLLAVLAACGGEDLAGGPEGLDG
                     ADVGQRQDALGEVRLRLLAANTSSGNGQDYDPGHGIRIFQGTDADIVMIQEFNYRSNS
                     AADLRSFVDTAFGTQFHYYREGGAQIPNGIISRYPIIASGEWDDPYVSNRDFAWARID
                     VPGPKDLWAISVHFLTTSSGNRNSEASSLVSRIRANIPAGDYLVVGGDLNTGSRNEST
                     FSTLSQVVRTAGPHPVDKNGNGNTNAGRNRPYDHVLVDADLYAHQTSVVIGGSTFTNG
                     LVVDTRVYSPLSDISPALYGDSAASGMQHMAVIKDFLIPGDGASGDDASVTVTAPNGG
                     ESWAAGSVRNITWTSTGVTNVKLEYSLNGSTWSTLAASTSAAAGSYAWTVPSSATTTA
                     RVRISDASNASVSDTSNAAFSITTAPSGGTGKVLINEVMVNEPGSSVAGEFVELVNTG
                     TGAVDLSGWTVSDAVSVRHTFPSGTSLAAGGVIVVFGGAAGIPSGTPSAVTASTGTLG
                     LSNSGDTVTVKSATGAVVESAVLSSGVSGTDGVSANRNPDLGATAAFVLHSTLSSLKS
                     SPGRRVTGAAF"
     gene            complement(202178..202648)
                     /locus_tag="LILAB_RS00800"
                     /old_locus_tag="LILAB_00845"
     CDS             complement(202178..202648)
                     /locus_tag="LILAB_RS00800"
                     /old_locus_tag="LILAB_00845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712245.1"
                     /db_xref="GI:760029194"
                     /translation="MPDPSVLATWGLPGLFLLAMLAGSIVPVPSEALLAALVYGGTSP
                     ATAVLIATTGNVLGALSLYVLGRWVAAGGGGALGRWYARRREREGPRLQRVEAWTRTW
                     GAPVLVMSWLPVVGDAFVIAGGMLGVRLLPFVFFVTVGKGLRYLAVALSAAAAL"
     gene            202872..204029
                     /locus_tag="LILAB_RS00805"
                     /old_locus_tag="LILAB_00850"
     CDS             202872..204029
                     /locus_tag="LILAB_RS00805"
                     /old_locus_tag="LILAB_00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase"
                     /protein_id="WP_013935277.1"
                     /db_xref="GI:503701201"
                     /translation="MSSTVAPVPSPSQSSDLRLVPVEIAPETFWVGKREPGNIFYANP
                     YLLRFRGTDKKTQRPTEFNLLVDPGSSSDFSTIHTKVTSLIGGMDRLSAMFINHQDPD
                     VGSSASIISARYAPRAGLLCSEDTWRLIVHQNLPRHRFIPTEKFAQGLSVPTGHRLLP
                     VPSPFCHFRGAVMLYDPQTRVLFTGDLFGGLTDSNARGLWADESDWAGIRAFHQIYMP
                     VNAALQRTVAAIRKLEPGVDIIAPQHGRIIRGPLVQQFLERMEKLQVGLDIMDEAQDK
                     THLQAWNAVLDRVLALARGYLGDSVEAKLAASQELSDTSQYDGARLVVTRLGKWTLEH
                     VVDLLCHGEPPEIAGPIIVEATSAAAEYNLPTPHLDIEGVGAPSHVSLLDP"
     gene            204067..205260
                     /locus_tag="LILAB_RS00810"
                     /old_locus_tag="LILAB_00855"
     CDS             204067..205260
                     /locus_tag="LILAB_RS00810"
                     /old_locus_tag="LILAB_00855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013935278.1"
                     /db_xref="GI:503701202"
                     /translation="MHSTDDEDRVAYLGGAALEPQPRVTPPPAIVKPPPRADFPPAPP
                     RAETPPEAAFRPVTPPPALSLGETLRPVTPMSPHGTLLQGIAVPAPSSVMRGLVPGQT
                     VAQRYRVERWLGAGGSSTVYEATDLRQDVRVALKVLAVPHADDALVARFHQEVEHARA
                     LEHVNILRVFDAGVDGERHFLTVELLDGVDLRQRLLERRATLAEALRWLTHATVALEH
                     AHGRGVLHRDVKPANLFITRTGVLKLMDFGLAKSTHVMGTTAQGAVLGTPEYMAPEQV
                     TGNPAVSPATDLYALGVVAYELFTGQLPFRHPEPVPLMFLHVQERPAPPRTLRPDLPE
                     PFERVVLKLLEKRPEDRYRTATELRSALARLWPRALQGPAPTLAAPAPPRASLRTPDP
                     GGHTG"
     gene            complement(205399..206772)
                     /locus_tag="LILAB_RS00815"
                     /old_locus_tag="LILAB_00860"
     CDS             complement(205399..206772)
                     /locus_tag="LILAB_RS00815"
                     /old_locus_tag="LILAB_00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013935279.1"
                     /db_xref="GI:503701203"
                     /translation="MDGSGVTAEPMVSARPGVARRTATGAVLLALVVSAFEGTVVTSA
                     MPTITRELGGQHLYSWVFSAFLFASTVGVLISGKLADRLGRKPVFFAGMGLFLVGSAL
                     CGLADSVPGLIAFRVIQGLGAGALQPTTLTISADLYTLRERAAVQGLFTGAWGAGNVV
                     GPLIGGWLVMHATWRWVFLVNVPVGLFAAALLYLSYRDPPRRPEVRMDRWGPVLAGSS
                     AALLLFSLEPGAASLRWACALAAAGAGWLLVRQQRTTAAPLLPAELLRDRAVLCGVAG
                     GMAGGALLYSMAAWVPLWMTEQGGHTPLAAGLALLPMLLGWSVGSTFGVKLLVRGGMR
                     LSAGVGFAVAALGAGWLSLAAARGWGVPAALVGLAVLGLGLGPAASTSLIGPQSRAPW
                     HHRGIVTSALYATRLLGGSLAVAVLALASGHFAVQFGLAAGLTAVAALGLALLAPGRT
                     EPTVSGA"
     gene            206843..207778
                     /locus_tag="LILAB_RS00820"
                     /old_locus_tag="LILAB_00865"
     CDS             206843..207778
                     /locus_tag="LILAB_RS00820"
                     /old_locus_tag="LILAB_00865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013935280.1"
                     /db_xref="GI:503701204"
                     /translation="MTSEQLRAFLEVARAGRLATAARGLGLSQSGLSRQLQSLEAALG
                     ARLLVRTPGGAVLTDAGERFLPHARRALDALTAGTSELERLSGTPHGVVSLGTLHTVG
                     AYLLPDIIPAFARQYPEVRPRLSEGLAPTLEEGVARGGLDLAILSLPVRRADLVAQRL
                     WEEPLVLAVPRGHRLTKAGRPLALEDAVEEPWVVIPGMSGTRALEAACEARGVTPRLA
                     LETDNAEAMRRMVERGLGMAVVPQLMARDHRAQGFDVVPLERGGLKRQVALIHRGEGY
                     LTAAARALKAFIVERVRAMPEPWGTRKAAPGPRVR"
     gene            207811..208191
                     /locus_tag="LILAB_RS00825"
                     /old_locus_tag="LILAB_00870"
     CDS             207811..208191
                     /locus_tag="LILAB_RS00825"
                     /old_locus_tag="LILAB_00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein TfoX"
                     /protein_id="WP_013935281.1"
                     /db_xref="GI:503701205"
                     /translation="MARTDSFVEYTLELLEKVGPLQARAMFGGWGIYAAGRMFGLIAG
                     GQLYLKVDEVTKPDFQAAGCRPFVHDTAARPVEMGYWTPPADAADDAYALLPWARRAV
                     DAANRAALKKAAKKPRAKKRVKPS"
     gene            complement(208178..209827)
                     /locus_tag="LILAB_RS00830"
                     /old_locus_tag="LILAB_00875"
     CDS             complement(208178..209827)
                     /locus_tag="LILAB_RS00830"
                     /old_locus_tag="LILAB_00875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding protein"
                     /protein_id="WP_013935282.1"
                     /db_xref="GI:503701206"
                     /translation="MAHSPVPSYAHGTSATPLLGETIGQNLRRTVERHGDREALVVAS
                     QGYRVTYQRLWALTTQVARGLMALGVQKGDRVGLWSPNRFEWVAIQYATARIGAILVN
                     LNPAYRTSELEYALNQSGGKVLLYARGFRQTDYRAMVREVQPRCTGLERALVLEDDWQ
                     GLLDGGKDVSEDALAAREASLQFDDPINIQYTSGTTGFPKGATLSHHNVLNNGFFIGE
                     ALRYGPEDRVCIPVPFYHCFGMVIGNLACTSHGATMVIPAEAFDPLTVLQTVQAERCT
                     SLYGVPTMFIAELDHPRFGEFDLSTLRTGVMAGSPCPVEVMKQVQSRMHMREVTICYG
                     MTETSPVSTQSALDEPLDKRVSTVGRVHPHLEVKVIDAGTGEVVPRGAPGELCTRGYS
                     VMLGYWANPEATAAAVDAAGWMHTGDLAVMDEEGYVKVVGRIKDTIIRGGENISPREV
                     EEFLHTHPGVSETQVIGVPSQKYGEEVMAWVRVKPGAALTGEELTRFCSGRIASFKIP
                     RYWKFVDAFPMTVTGKVQKFKMREASVAELGLEDAAAIKTA"
     gene            210035..210880
                     /locus_tag="LILAB_RS00835"
                     /old_locus_tag="LILAB_00880"
     CDS             210035..210880
                     /locus_tag="LILAB_RS00835"
                     /old_locus_tag="LILAB_00880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="WP_013935283.1"
                     /db_xref="GI:503701207"
                     /translation="MDDSNARLVTALLEARQRHCFPADVRRAAPEFVGQVLGLLFPHF
                     AERLECTAAAVHRDVTTVEASLHRIRDTLAPLYPGIEPDLPARFMERLPGLYEWLRQD
                     ADAIFEADPAARTVDEVILTYPGFTAIAIYRVANALHVLGFPLLPRLLTEYAHQRTGV
                     DIHPGATIGRRFVIDHGTGVVIGETTLIGDNVKLYQGVTLGALVVEKGLTDKKRHPTI
                     EDDVVVYANATILGGETVVGRGSIIAGNAWLTQSIPSQSVVTRRSEVRQRGADGSLDA
                     LEFHI"
     gene            210901..211821
                     /locus_tag="LILAB_RS00840"
                     /old_locus_tag="LILAB_00885"
     CDS             210901..211821
                     /locus_tag="LILAB_RS00840"
                     /old_locus_tag="LILAB_00885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_013935284.1"
                     /db_xref="GI:503701208"
                     /translation="MKVNNILETIGNTPHVRINRLFPSRVTVHVKLERANPGGSIKDR
                     IALSMIEDAEQRGLLKKDSVIIEPTSGNTGIGLAMVAAVKGYKLVLVMPESMSIERRR
                     LMAAYGATFELTPRAQGMKGAIARANELLSQVPNSWMPQQFDNEANIEVHRRTTVQEI
                     LKDFPEGLDYLITGVGTGGHITACAEELKKVWPKLKVFAVEPTKSPVISGGQPGPHPI
                     QGLGAGFIPKNLHKEALDGAIQVAEEDAFEFTRRAAREEGIFMGISSGAALSAVNQKL
                     GEMTDGSRVLVFNYDTGERYLSIEALFPAQ"
     gene            complement(211833..212969)
                     /locus_tag="LILAB_RS00845"
                     /old_locus_tag="LILAB_00890"
     CDS             complement(211833..212969)
                     /locus_tag="LILAB_RS00845"
                     /old_locus_tag="LILAB_00890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase V"
                     /protein_id="WP_013935285.1"
                     /db_xref="GI:503701209"
                     /translation="MTRPLESYRDLFPVLKEQLYLNHAGVAPTSLRAAEAVRGWMEDL
                     VHHGIKHERGWEAHCERVRELAARLINAEPGEIAFVRNTSHGLGLVAEGLDWRPGDEV
                     AVASSLEYPSNVYPWLHLRDRGVTVREIQTPEGGVTPEAVAAALTPRTRVVAVSSVQF
                     ATGYRTDLDAVGALCERAGVLLCVDGIQSVGCIPVDVKKSRIHFLSADSHKWMLGIAG
                     IGFVYVAREVLPRLRPVLVGWRSTTDAWNFNRSHFELRPDAGKLEEGSAAYTGIYALG
                     AALELLHEVGMDAISTRIRELLGRLETGLRGLGCDVGPAPAHRAGILTFLPPEGDARS
                     LGAWLAGRDVALSVRRGRVRLSPHFYNLPEEMDRLVELVRTYPG"
     gene            213109..214791
                     /locus_tag="LILAB_RS00850"
                     /old_locus_tag="LILAB_00895"
     CDS             213109..214791
                     /locus_tag="LILAB_RS00850"
                     /old_locus_tag="LILAB_00895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_013935286.1"
                     /db_xref="GI:503701210"
                     /translation="MRRPPLDALRNTLLAGATLLAGCAGTVHAPYPPIRADLSPAALE
                     RGAAIFHASCESCHRGGDAETASGAPLRELPSYMGRFYAANLTAHAEAGIGGLTDEEL
                     ARAIRYAVSRDGRLMVMPSYGMGDADLAAVLGFMRSGHPLFTPAPEPAPPSKFSFFGG
                     IGFRFITGNEPVERPASGIPVPPKAATLEYGHYMAHDVYDCASCHTDGFSPRKTEGDD
                     VFAGGMAFVDPEGRKVHSSNITFHETGLAHWTLEDFTRAVRDGLAPDGSVLRSPMPRF
                     RGMDAVEAQALYDYLRSVPHRENAVEGARPRLTATSARPDWVAETHGAETPLDGAHAQ
                     GRPDAAPASGAKHAKASEKGAAGSQAPQASSDAKASEQDAAGSQAPQASSDAPAQGSD
                     DTARQAPSQAGPGTTPVTSPAGPDVGTSPTPAPRAAADTSASPEGSNASTPSTSATRI
                     DAAPGSSKPASKPAPRRKPRPAVPQVDAAGLFVKLGCASCHAPGARYHDRLAKVATRS
                     EAELVRWVRNPEQFLPGTPMPTYAELIDEKTARALVRWVKAGGPASLTSTSR"
     gene            215042..216331
                     /locus_tag="LILAB_RS00855"
                     /old_locus_tag="LILAB_00900"
     CDS             215042..216331
                     /locus_tag="LILAB_RS00855"
                     /old_locus_tag="LILAB_00900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="WP_013935287.1"
                     /db_xref="GI:503701211"
                     /translation="MTECLLNIDLGELPGEDEQLYALAHVANIACGGHAGDDASMRRA
                     LTLCERHGTRAGAHPSYEDREGFGRRALDVTPEQLRAQVATQCGRLAKLASERRLPVA
                     YAKPHGALYHAANATPDLARAVVAGVVEALGRAVTVIGPGAGALRDAARAAGLPYARE
                     GFADRGTRPDGSLIPRGQPGAVLTDHAQARANTLRLATGDSVDTVCVHGDTPGAVELA
                     REVRATLDALALRSEPLGDGALRLVLPEGLERRATREALRALPGVLDAVITEEHACVY
                     FAPDAPPEEPRLALARLLRVPAPVAGRPLTTISVRYDGQDLNAVAERAGLTGDEVARR
                     HAAREYTVRCVGFLPGFAYLGEVDPSIAAPRLATPRTRVPALAVGIAGGRTGVYPFAS
                     PGGWNLIGTALDFTAFTPEQGSVLQLGDRVRFERVDG"
     gene            216328..217212
                     /locus_tag="LILAB_RS00860"
                     /old_locus_tag="LILAB_00905"
     CDS             216328..217212
                     /locus_tag="LILAB_RS00860"
                     /old_locus_tag="LILAB_00905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea amidolyase"
                     /protein_id="WP_013935288.1"
                     /db_xref="GI:503701212"
                     /translation="MTGWLEITGVNAPVSVQDAGRPGQMQHGVPPGGPLVPELLALAN
                     HTVGNASGAAALEVFGRVELRARGRGVRVSVDGRAVTLPDGDRLTLPAPESTSVRYVA
                     VDGGFAVPEVLGGRGTLLVARLGGHEGRLLRAGDMLPLGEAREPVAAKAPGAALDATA
                     PIRVTLGPDTRRFEPATVATLLSGAFAVSAATDRVGMRLQGPALTHGDEGTGTSRPMV
                     RGAIQVTLSGAPIVLGPDHPTTGGYPLIATVIRADWGRLCARRPGAAVRFQEVSIDEA
                     RHAWRQYAEHFGIGTGPT"
     gene            217500..218780
                     /locus_tag="LILAB_RS00865"
                     /old_locus_tag="LILAB_00915"
     CDS             217500..218780
                     /locus_tag="LILAB_RS00865"
                     /old_locus_tag="LILAB_00915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708946.1"
                     /db_xref="GI:760025810"
                     /translation="MKTPRSEASVPVPPTESGEPTRPARNELRTQNQTLADPLQGPRV
                     APGSYPSPEEIRAICAMQDLVARNHAVTQSYSDLSIAMGQLLGMENANWSTFATWASK
                     QAGVSVRGEDLPKRFTDLLKRFDAITRPLTKVDDLLRKLGVPVLPLGDLGSAGNDALQ
                     DVSNAISEGNKKVFEEVGQELSRFVTTFQGATQYDAAKVAQYLSEFPADKPVLEEAFG
                     HYTQAMFETDANTKAELILMANTKVGLHEQRRLQPQIEQALDAPVKATFHGILRQTIE
                     ANINALLFPANLAGKAALKSGVVDAVLNPVVDSMASAFRRFSTEHMMKLAVPGSALSL
                     GNDVPPPGMETTLFPPHLRTIETPELRTLLRAFDKSPDSLTGSGAEDWSRLDQRMNYI
                     IDLFRTRQSDPALFDPPFGRRGTYSVTPPAPRVA"
     gene            218830..220191
                     /locus_tag="LILAB_RS00870"
                     /old_locus_tag="LILAB_00920"
     CDS             218830..220191
                     /locus_tag="LILAB_RS00870"
                     /old_locus_tag="LILAB_00920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935291.1"
                     /db_xref="GI:503701215"
                     /translation="MSPPKIRPNVSVRPPEPREPLRPARNEVKPQAPVTPRPGTSGVS
                     RFEAPSARQQPVALNAPALPARGPSVTPGSYPTAAQVRDIAAMTDPVARNQAITQGYS
                     DLSNAMGKLLGTENANWSTFATWASKQAGVSIRGEDMPKVFTDLLKGADAVGGPLSKV
                     DDLLRKLGLPSLPLGDVASAGNQALQNVSKAIADGNKAVFEEVGQEFARFVETFQGDT
                     QYDAAKTQQYLSGFPADKPLLKEAFGHYAQAMFEKDPNKKAELMLLANNKVGLHEQTQ
                     LQPHVEKALNSPVKDTFRDVLKQGIEAQINALPFPANLAGKAALKTGVVDAALNPVVD
                     GMASVFRRVATEHMMKLAVPGGALKLGNDLPPPPGMESTLFPPHLRTIDDPELKALLG
                     QLDKSPDSLTGTGAKDWGKLDQRMNYIIDLFRSRQSDPSLFDPPFGQRGTYPVAPSAP
                     RVS"
     gene            complement(220208..221803)
                     /locus_tag="LILAB_RS00875"
                     /old_locus_tag="LILAB_00925"
     CDS             complement(220208..221803)
                     /locus_tag="LILAB_RS00875"
                     /old_locus_tag="LILAB_00925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013935292.1"
                     /db_xref="GI:503701216"
                     /translation="MQDDFSGATDGANDARDLIELATAEGSVGDLLRRGLDWLTRVVR
                     FDLATVFLLKEGRLVSVAARGPLANAKVRQHTLQLSEFPSLRQALETRRAKAFTEEDH
                     AHGDGDPFDGVLDLPPGHSCMVVPLCAGERCYGVLSLDRAECETYPQPVVELVEVYGQ
                     MLATAIQSAEQRATFERLHRQDHEHAKLLEAQLGGDSEGILETSRSPVMRDLARRARQ
                     VAETDTPVLITGETGTGKERLARAIHRWSARADQPFVTLNCAAIPAGLLESELFGHVK
                     GAFTGATKDRAGRFQMAHGGTLLLDEVGELPFDLQAKLLRALQEKTFEPVGSDKTVRA
                     DVRILAATHVDLQQAIAQKRFREDLYYRLSVFPLRLPPLRERREDLPQLCDFLLEEQA
                     RRTGRRGMRVTPEGLTRLAAYDWPGNLRELANALERATILTRGTALGPESFDVPTRGA
                     AVVAALPEEPAPAAEGAKRGPVLTLAAVQREHIMRVLTLTRGRVYGANGAAALLGLKP
                     STLQSRMKKLGIARLEQFVVDEA"
     gene            222251..222805
                     /locus_tag="LILAB_RS00880"
                     /old_locus_tag="LILAB_00930"
     CDS             222251..222805
                     /locus_tag="LILAB_RS00880"
                     /old_locus_tag="LILAB_00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_013935293.1"
                     /db_xref="GI:503701217"
                     /translation="MLTVGDKIPNFKVKATVSLEKGKEFQDITNETFKGKWLVLFAWP
                     KDFTFICPTEIAEFGKKNKDFADRDAQVLGLSTDSEFVHHAWRTHHPDLKDLPFPMLA
                     DLKHELCNALGILHKEEGVALRATFIADPEGIIRHVTVNDLSVGRNVSETVRTLDALQ
                     TDELCPCNWTKGEETLTQKLAKAG"
     gene            222812..223336
                     /locus_tag="LILAB_RS00885"
                     /old_locus_tag="LILAB_00935"
     CDS             222812..223336
                     /locus_tag="LILAB_RS00885"
                     /old_locus_tag="LILAB_00935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015347278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_013935294.1"
                     /db_xref="GI:503701218"
                     /translation="MASLEVVRSELADSHKDTRLNLQSVLEGGSLTPEQRWGTAVACA
                     FAVRNERLKEAMLNEAKKALANPEPVIEDARAAASLMAMNNVYYRFRHMIGKESYSTK
                     RAGLRMNRLAQVLTNKVDFELVCLAVSAINGCEMCMQSHEKVVLEGGLSEEQVHDAVR
                     IASVIHAAAVGLES"
     gene            223468..223944
                     /locus_tag="LILAB_RS00890"
                     /old_locus_tag="LILAB_00940"
     CDS             223468..223944
                     /locus_tag="LILAB_RS00890"
                     /old_locus_tag="LILAB_00940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_013935295.1"
                     /db_xref="GI:503701219"
                     /translation="MYRSPSPLPEKARAAIADSLNERLADGLDLHSQIKVAHWNIKGP
                     QFASLHPLFETFAVSLATHNDSIAERAVTLGGKAYGTSRHVGKTSRLPEYPQETTRDL
                     EHVKLLAERIEIYLDGLRKSRALFVENGDTDSEGLTTDIITEFEKHAWFLRASLEG"
     gene            224124..224930
                     /locus_tag="LILAB_RS00895"
                     /old_locus_tag="LILAB_00945"
     CDS             224124..224930
                     /locus_tag="LILAB_RS00895"
                     /old_locus_tag="LILAB_00945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935296.1"
                     /db_xref="GI:503701220"
                     /translation="MRRITCLALTVLVTTACGGAPTQEEVDAARQRVERVVAASHQAR
                     GALEVLGVLPVYTCGEPRPEFLNTAVRTVRTRWACARATVEPHDSVTDRVVLTFDEGG
                     CDVHGLRVAGQAAFLYRGGEDLMEVEADLRGLTVDGHPLQAEVGYGTCGDETRLWADV
                     RGGVPGREGHTFHVDGRVGMRAGLPVIGGTSLVLDGPGELTGPDGTDRLTLTGLHYEV
                     GEYLPKEGTAVLETADGRRVEARFQPVLWRLGKAEVTVDELEPVTVPIVR"
     gene            224974..226263
                     /locus_tag="LILAB_RS00900"
                     /old_locus_tag="LILAB_00950"
     CDS             224974..226263
                     /locus_tag="LILAB_RS00900"
                     /old_locus_tag="LILAB_00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_013935297.1"
                     /db_xref="GI:503701221"
                     /translation="MSDDVSLPAFRAVPRTGVIFVTAEATRRGYRSSDPEWCNLGQGQ
                     PETGDLPGAPPRLNQVTIDVADMEYAPVAGLWEVRESIASLYNRLYRRGLPSQYSAEN
                     VCLSGGGRAALTRAAASLGAINLGHFLPDYTAYEELLDVFKAFTAIPILLEGERGYAF
                     TAEDLRREVQGRGLSALLFSNPCNPTGKLVHGEEMARWVSVAREHECTLLVDEFYSHY
                     IWTGRPGHLPVESAARYVEDVNKDPVVLFDGFTKNWRYPGWRMTWTVGPRQVIEAVSS
                     AGSFLDGGGSRPLQRAAIPLLQEEPVVKETLAIHNAFREKRDRFHSRLERIGIRTDRA
                     PDGTFYVWGNVSGLPAPLNDGMGFFRAALEQKIIAVPGEFFDVNPGKRRARPSRFRGY
                     VRLSFGPSMETLDKALSRLEDLVLHYSRTPGKPQPAP"
     gene            complement(226313..226918)
                     /locus_tag="LILAB_RS00905"
                     /old_locus_tag="LILAB_00955"
     CDS             complement(226313..226918)
                     /locus_tag="LILAB_RS00905"
                     /old_locus_tag="LILAB_00955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_013935298.1"
                     /db_xref="GI:503701222"
                     /translation="MKRMMGVLMLTVGVAASAAGVSTAQQNVTVQVRGASGSAVRAPE
                     VPFVPTPEGAVEGMLALAGVKPGDTVYDLGSGDGRIVISAVQKHGAKRAVGVDINPER
                     ISEANQNASQAGVKNKVEFRQGDLFDADIGDASVVTLYLLPSVNERLKPKLLAELKPG
                     TRIVSHSFDMGDWAPTKTVESEGRTLYLWVVPERGTGGAPR"
     gene            complement(226915..228357)
                     /locus_tag="LILAB_RS00910"
                     /old_locus_tag="LILAB_00960"
     CDS             complement(226915..228357)
                     /locus_tag="LILAB_RS00910"
                     /old_locus_tag="LILAB_00960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_013935299.1"
                     /db_xref="GI:503701223"
                     /translation="MEHVTMQEQQAGDEAVKRGEGAPSPSLRVVDVMALTVGIVLGAG
                     IFKAPSLVAAQSASGEAMLLTWLLGGVASLVGALCYAELASAWPHPGGDYHYLYRALG
                     KGPAFLFAWARLTVIPTGSIALLAFVFGDYATQLFPLGPYSSPLYATALVVGLTAVNI
                     AGLRQGTRTQNLLTALEVLGVGAVIIVGLLFTPALGPAEAAPAPAASSGTAWGLAMVF
                     VLLTYGGWNEVAYLSSEVRGSRRTIAWSLLASIGLVTALYLLVNVAYLRGLGLAGMAD
                     SEAVAADLMQRAVGSGGALVLSVLIAISALTSANATVLTGARTHYAFGRDSVLFNGLG
                     RWHAKANGPSRALLVQGAITLALVGLGTLTRQGFETMVEYTAPVFWLFFLLTGVSLMV
                     LRVREPAAPRPFRVPLYPLTPLLFIGICAYVLYSSLAFTGLGALAGLAVLGTGGVLLA
                     VETARTRRATTAASPKARSSPRLQRTKEAT"
     gene            228551..229816
                     /locus_tag="LILAB_RS00915"
                     /old_locus_tag="LILAB_00965"
     CDS             228551..229816
                     /locus_tag="LILAB_RS00915"
                     /old_locus_tag="LILAB_00965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_043708947.1"
                     /db_xref="GI:760025811"
                     /translation="MRLPPPRLALLCMLYFVQGLPFGFQATALPVYLRAQGASLTTIG
                     LLGALWLPWALKALWAPLVDRYGSARIGRRKSWILPMQAGLVVTCAAAAVVASRDALL
                     LLLAPIFLMNLFAATQDIAVDGFAVDTLRPSELGLGNTAQVVGYKLGMLTGGGLLVWA
                     SARIGWPGLFVAMALLCLAAFIVMLFAREVPPEPRAEPSALPARREPGWRELFQRLKA
                     ALLLPGAGWLLLFITTYKLGESMSDVLFKPFLVDMGITPAQIGLWVGTWGTGASIMGS
                     LAGGVLASRMPLLGAVGLTATLRVVPLVGRWLLATGNVSDTGVIGVTMAEEFFGGALT
                     TVMFAFMMSRVDRRIGATHYTLLASLEVWGKAPAGPLAGWLADARHGLGLGYANVFLL
                     GIGLSVVFLALLVPMRCQRHAPATALNTA"
     gene            complement(229824..230498)
                     /locus_tag="LILAB_RS00920"
                     /old_locus_tag="LILAB_00970"
     CDS             complement(229824..230498)
                     /locus_tag="LILAB_RS00920"
                     /old_locus_tag="LILAB_00970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="WP_043712247.1"
                     /db_xref="GI:760029196"
                     /translation="MPRPPPDVIRHPTYYTPAVRRALTRADPTLGALMKRVGPFRLQV
                     RPLHSPFGALAESIVYQQLHGKAAATIFGRVCERVGSGRKFTPEALLAVPDTSLREAG
                     LSANKLAALQDLARKTLSGTVPPLAKVRRMDDAELIEHFTQVRGIGQWTVEMLLMFQL
                     ERPDVLPVDDYGVRKGFMRAYGLPEMPKPKALLAYGERWRPWRSVASWYMWRSAELPV
                     EPPAED"
     gene            complement(230562..231050)
                     /locus_tag="LILAB_RS00925"
                     /old_locus_tag="LILAB_00975"
     CDS             complement(230562..231050)
                     /locus_tag="LILAB_RS00925"
                     /old_locus_tag="LILAB_00975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemerythrin"
                     /protein_id="WP_013935302.1"
                     /db_xref="GI:503701226"
                     /translation="MDAIELLTQQHDEVKKLFKKYEKLSDGAEAKRQGLFEMISDRLS
                     AHASIEEQYFYPAAKAQDTEDLLREAAEEHLSAKRLIADLLDLEPSDEEFDAKMQVLQ
                     EQIEHHVEEEEGELFKKVRKLLSKEQLVDLGVQMQQEFEELMEGEPRTQVPAETEHAA
                     PI"
     gene            complement(231110..232624)
                     /locus_tag="LILAB_RS00930"
                     /old_locus_tag="LILAB_00980"
     CDS             complement(231110..232624)
                     /locus_tag="LILAB_RS00930"
                     /old_locus_tag="LILAB_00980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_043708949.1"
                     /db_xref="GI:760025813"
                     /translation="MDDEQRAHRSLWTVTAPPRDFPALPGDVTVDVAIIGGGMAGLTT
                     AWLLKRAGKRVAVLEMHRILSGQTGQTTAHLTEVLDTPYTTLKHDFGEKGARLAASSS
                     RAAIEQIAALVEELGIDCDFQRVPMFRYAETERELAELHAEVAAAREAGLLATFTQDV
                     PLPYPVKGAMRVEDQALFHPRKYLLALADRIPGDGSHLFENTKVTEIHDGAPCRVVTE
                     RGTVTAAAVVEATTTPLNRVAMHTKLYPYRTYAVAGPLNGPLEPGQYYDSQDPYHYIR
                     TQQVNGRPYVIVGGEDHKVGTEEDTARCYAALEAYTLRRFPVTDITHRWSGQVIEPAD
                     GLAYIGRNTASRHVYVATGFSGTGMTFGTLAGMILSDLILEQQNPYAALYAATRVKPQ
                     AGAKDFLQENAEVAFHFVADRLARPEGHRLADVAPGEGKVLEVDGQKVAVYRAEDGTP
                     HAVSPVCTHLGCHVHWNGAERSWDCPCHGGRFSPTGKVLNGPAVKDLPAKKLPT"
     gene            232839..233030
                     /locus_tag="LILAB_RS00935"
                     /old_locus_tag="LILAB_00985"
     CDS             232839..233030
                     /locus_tag="LILAB_RS00935"
                     /old_locus_tag="LILAB_00985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935304.1"
                     /db_xref="GI:503701228"
                     /translation="MPVERMAGSASLVDVLDRVLDRGLRWDDNVRGQALQDWPPASTR
                     PIVVKFVEVRTPPPHPHGA"
     gene            233014..235140
                     /locus_tag="LILAB_RS00940"
                     /old_locus_tag="LILAB_00990"
     CDS             233014..235140
                     /locus_tag="LILAB_RS00940"
                     /old_locus_tag="LILAB_00990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_043708950.1"
                     /db_xref="GI:760025815"
                     /translation="MPTEPDAVAPPVALTTPLSEPDVEARLALAEHLLACDEPRLCAQ
                     RVVDWLTRQRPSDVAACLARDGGTGRWVCLAARNLSESERAALAFQPGTSTHPLAEAP
                     HQDGPRFFAAPRAPLPPGGCITLPLGRPGAPAVGLLLLSADSPTPSPDAAWVSAHFGP
                     RLASALPTLSREVAGGELLRRIIDTVVDPVLLTDLEGRPHIANARAEVLLVAGPDASE
                     GRRRATELNQQVFSAALASFASGGASAVRRREVPLVDPVEGIDLLFEVVSTPVVEPDG
                     REALVSVLRNVTDLGRATQALGESYRRLRATEREARSERHRLDRVLDSVPDPIILSDP
                     AGGMVMMNGPAEKLFATPPDSGEDALRRLRSNNAGFASFLANLMDAEGRPRWRGQLAL
                     VNPATGATLPMEAVASKVLGDAGELTGIVTLFHDRSEALEKARLLERVKEGSVHLEAR
                     VQAATAELAEQNEMLRRQAIQVEQASAAKSQFLANMSHEFRTPLNAILGYTNMLLQGV
                     SGELNPAQKRNLTRIDSNGRHLLEVINEILDITRIEAGRMPLNLSDFGIPELFQEVMA
                     EMDPIIARSKLTVSTELGPRVPAVYSDRQKVKQIVLNLLSNALKFTHEGSVQVRAEYV
                     AATSTLAISVTDTGIGIDPANQEKIFDDFQQVDSSPTRAYGGTGLGLSICRRLATMLG
                     GRVTLQSTQGEGSTFTLHFPRRARRA"
     gene            235137..235547
                     /locus_tag="LILAB_RS00945"
                     /old_locus_tag="LILAB_00995"
     CDS             235137..235547
                     /locus_tag="LILAB_RS00945"
                     /old_locus_tag="LILAB_00995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_043708951.1"
                     /db_xref="GI:760025816"
                     /translation="MTTPSETPKPLVLVVDDYQDAREMYAEYLEFSGFRVAEAKNGQE
                     ALDKAFELHPDIILMDLSLPIMDGWEATRRLKNDDRTRTIPVVALTGHAMTGQSDEAK
                     GAGCDSFVTKPCLPDALVDEVRRVLATHGGAQPR"
     gene            235556..236389
                     /locus_tag="LILAB_RS00950"
                     /old_locus_tag="LILAB_01000"
     CDS             235556..236389
                     /locus_tag="LILAB_RS00950"
                     /old_locus_tag="LILAB_01000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GvpL/GvpF family gas vesicle protein"
                     /protein_id="WP_043712249.1"
                     /db_xref="GI:760029198"
                     /translation="MPRTTRPRKGAARGGKRAPQAARPPPPEPEPVTPDGPRYLYGIV
                     RATAALELGRIGVGTVPTQVYALHESGLAALVSEAPGRVVDPTRAHLLGHQRVTEHLL
                     REHTVLPAAFGTVLASEAQVRDLLRTAHDALAGVLEALEGKVEMGLKVLWHREHLVQR
                     LLLEDAQLARRDDEPEAEHEQRLASAVEDRAGRDMRALLEGLRPRAVALREHPPVGER
                     MLLNAAFLVERTGLESFEEKVRSLAARSDTYAFRFTGPWAPYSFVDVRLGPRDEDAVG
                     T"
     gene            complement(236411..237529)
                     /locus_tag="LILAB_RS00955"
                     /old_locus_tag="LILAB_01005"
     CDS             complement(236411..237529)
                     /locus_tag="LILAB_RS00955"
                     /old_locus_tag="LILAB_01005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935308.1"
                     /db_xref="GI:503701232"
                     /translation="MKVRDLALQGALAAAALVAAFVVWQREPSAGPGEVTVVDVPVRA
                     LDSIRYEDDTRFVDVFRDASARDQLWVRLGSKSPRPGSGGAKDGAKDGATDAGSGDAG
                     TATAAVEPDAGPGAAAPAQSPVAAREAPPPPRELRANEVADKLFSRFAPMRAMRALGE
                     LDAKKLEEVGLATSPRKLTLTVGGKARVFALASPVGGWGTPYLRSEEDGRVYLLGPAM
                     LPDLENASSRLVDRRLHTFDLGDFDAVSIRAGGITRAFRATGKAPGPVALAPEEAPEQ
                     PDDFARNWHDRVWRMMPLDLLGRDEAPPGGEPQEAFRVEYLRAGRPVGHVTVAKAEDG
                     YYARTEHTSGWARLHSGMDALAEEAARVTAPVSSASGK"
     gene            complement(237526..239394)
                     /locus_tag="LILAB_RS00960"
                     /old_locus_tag="LILAB_01010"
     CDS             complement(237526..239394)
                     /locus_tag="LILAB_RS00960"
                     /old_locus_tag="LILAB_01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_043708953.1"
                     /db_xref="GI:760025818"
                     /translation="MSARSSSGGLPVTLAFVAALLAVFIGERIFGIGTGRTVLSSLGV
                     AVAVGALGWRLTRMRSASADRRAVEAWVSGLYGVGLLALGLYFLQSDAGSALFGGPLS
                     QKAPRLAVSLAALFPALLACCLLPLAMVEVAAAAMTRAPLLETGRVRSALYSGLGLAF
                     VLIFAFASMFVATQVDVTWDLSYFRTAKPGDGTRKVIRGLNEPLQVTLFFPPANEVGE
                     AVGQYFRDLAVESPGLLNVERLDQAVEPVRARSLGVHSNGTVVLARGDRKEPLTVGLE
                     IERARGQLQRLDQEVQRRLLTVARPRRVVYFTAGHGERAESRAVPGETMRPSVEKLKE
                     LLRAQNVDVRPLGVSEGLGTEVPRDAAVVVVAGPTQAFLPEELNALSEYAARGGRLWL
                     ALEPDGPDLQPLLEPWGLKFLKTPLANDQVYFRTSRKQSDRGNLGTATFSSHPSVTSL
                     SSLAGQMPTVFVSAGALEQLQPLPGGIAQNVSVRAHGATFADANGNFTLDAGETRRPW
                     PLVIAVEKPAPAGQEAMRAVVMADADAVGDLLLGNMGNAYLALDTLRWLTGEESISGA
                     VSSEEDTPILHTREQDVLWFYATVFLGPALVLAVGFVTTRRRGRRAPRPAVAGGER"
     gene            complement(239391..240113)
                     /locus_tag="LILAB_RS00965"
                     /old_locus_tag="LILAB_01015"
     CDS             complement(239391..240113)
                     /locus_tag="LILAB_RS00965"
                     /old_locus_tag="LILAB_01015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013935310.1"
                     /db_xref="GI:503701234"
                     /translation="MKALLIARRELSAYLRTLSGYVIIAVILALNGLFFNAYALGGAS
                     RRSAEVLSQFFYYSSGFTIVASVFISMRLLAEERQTGTLPLLYSSPLRDRDIVLGKFL
                     AGLAFLALYVACTVYMPLLVMVNGKVSFGHVAAGYLGLLLLGSASLAVGTFGSALARN
                     QLLAAITSAVMLVALILCWLLARITEQPLADVFSAMSLWNQHFPPFQAGLIHVRDVVY
                     YLVVTYVALFAATRVLEARRWR"
     gene            complement(240110..241039)
                     /locus_tag="LILAB_RS00970"
                     /old_locus_tag="LILAB_01020"
     CDS             complement(240110..241039)
                     /locus_tag="LILAB_RS00970"
                     /old_locus_tag="LILAB_01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013935311.1"
                     /db_xref="GI:503701235"
                     /translation="MIQVEGLTKYYGEHAAIRELAFTISQGEVIGFLGLNGAGKSTTL
                     KVLGCVLLPTSGRVVIDGHDVVSNAHEVRQRIGYLPDVPPLYDEMTVGEYLAYVAQLR
                     GVTARDTASRVGEAEEKTGLRDVHGELISTLSHGYRQRVGVAQALVHKPALLILDEPT
                     SGLDPRQIVEMRDVIRGLKGAHTVLVSSHILPEISQTCDRLLIIHKGMLVAQGTEEEL
                     AAKMGGRGTIELEVRGDKARAVEVLQGFGAVEVDRAADGLVALTVRASPDQRPRVAQA
                     VVGAGLELLRLDQGAGQLESIFLRLTHGQEVRA"
     gene            complement(241112..242533)
                     /locus_tag="LILAB_RS00975"
                     /old_locus_tag="LILAB_01025"
     CDS             complement(241112..242533)
                     /locus_tag="LILAB_RS00975"
                     /old_locus_tag="LILAB_01025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="WP_013935312.1"
                     /db_xref="GI:503701236"
                     /translation="MGKSHVFDARSRMPVTAHELFAWHAREGAFERLAPPWERMEVLE
                     RTGDGIRTGARVVVRMRVGPVPQRLVAEHTAYSEGAMFQDTQRSGPFTKWVHTHRMWP
                     EPTTGTSILDDEVEYILSVGPLGSLFGGGFARRTLERMFAYRHRITREDLKRHAAFVG
                     QGPLTIAVTGASGLVGSALVPFLTTGGHTVKRLVRGKADPARNEVAWAPDKGEVDTDA
                     LEGVDAVVHLAGVNVAGQRWTPEYKDAILKSRTQGTRTLAEALARMKRKPKVLVSAGG
                     SSIYGDRGDELLTEESSTDGEGFLSQVSREWEAAAAPAEAAGIRVVHLRIGPVLDARE
                     GALAKMLPAFLAGGGGPIGSGRQWMSWVALEDVLGLIHFSVFTEAARGALNTVAPGAV
                     RQADFARTLGKVLRRPAVFPVPSPVVRTLFGQMGQEALLDGARIVPQAAQRLGFAFLL
                     PDLEGALRFTLGRTTEGPEYRHS"
     gene            242595..243527
                     /locus_tag="LILAB_RS00980"
                     /old_locus_tag="LILAB_01030"
     CDS             242595..243527
                     /locus_tag="LILAB_RS00980"
                     /old_locus_tag="LILAB_01030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="WP_043708955.1"
                     /db_xref="GI:760025820"
                     /translation="MELLRRGGVVALPTETVYGLSANAEDELAVRRVFAIKGRPATHP
                     LIVHIPGVEHLGAWAHEVPEAARKLAEAFWPGPLTLVLKRTARATDAVTGGQDTVALR
                     VPNHPVALAVLRRLGGGLAAPSANRFGKVSPTTAEHVREDLGGDVDLVLDGGPCTVGV
                     ESTIVDLSSEEPAILRPGGLAAEDVERVLGRKVPVRTTSKVRVSGSLESHYAPRAGVV
                     LVEPGQAVARVQELRGQGLRVGVLGPASLVLPAAVPRFDVPDEPAGAARVLYARLREA
                     DAQGHDVLVACLPAESGLGIAVRDRLSRAAAPRG"
     gene            245205..245870
                     /locus_tag="LILAB_RS00985"
                     /old_locus_tag="LILAB_01045"
     CDS             245205..245870
                     /locus_tag="LILAB_RS00985"
                     /old_locus_tag="LILAB_01045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935316.1"
                     /db_xref="GI:503701240"
                     /translation="MSTTRLHSRSLGVLFLLPFFAYGVGTALVTSILQEPEHLAVVAG
                     QRTLFVGGALLLLLNSILVVGIGVLCFPILRARSPSIAVAYVCTRVMEALVLIIGVIF
                     LLCILQLGASAQGQPAPELVTLTRLLSKGNFWAYQLAMIILGTGSVAFCLSLYRARLL
                     PSLLPLVGALGYGLLALGAVLELFGLPWGIFFSGPGGLFELFLGGWLIAKGFRTVTPS
                     VAA"
     gene            complement(245848..246453)
                     /locus_tag="LILAB_RS00990"
                     /old_locus_tag="LILAB_01050"
     CDS             complement(245848..246453)
                     /locus_tag="LILAB_RS00990"
                     /old_locus_tag="LILAB_01050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_043708957.1"
                     /db_xref="GI:760025822"
                     /translation="MKHRLVDYFRRIAPLSDEEAQAILDSMVVKTCPKGTHLLMAGQV
                     CTEAYFVLQGCVRQYSVVDGEERSGGFFTEDEWVLSIHSMVNQIPAEHFLVCVEDTTV
                     VVGTEQREGDLYRRFPRFESISRMVMQKVLAEQQERFASYLTDTPEQRYLKLSKTRPD
                     MLQRIPQYQLASYIGVQPESLSRIRKRIATRGKPATPRRKG"
     gene            complement(247239..247973)
                     /locus_tag="LILAB_RS00995"
                     /old_locus_tag="LILAB_01055"
     CDS             complement(247239..247973)
                     /locus_tag="LILAB_RS00995"
                     /old_locus_tag="LILAB_01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013935318.1"
                     /db_xref="GI:503701242"
                     /translation="MSHDLVHARVREHLGRLRLGHLAERLDALLREEIGAKQKKRVSM
                     GITIAHFPAVKTLEDFDFKAQPSVDSKLVRELATGRFIAQAENVLLFGPPGVGKTHLA
                     IGLGRAAVEAGHSVLFTSATALLAALAKAESEGALKDKLNYFAKPKLLIIDELGYLPF
                     EKRSAHLFFQLVARRYEKGSLLITTNQLVGQWGGVFGDDVLAAAILDRLLHHSHTVLI
                     QGDSYRLRQKRKAGLLGRSAPPGNHG"
     gene            complement(247970..249418)
                     /locus_tag="LILAB_RS01000"
                     /old_locus_tag="LILAB_01060"
     CDS             complement(247970..249418)
                     /locus_tag="LILAB_RS01000"
                     /old_locus_tag="LILAB_01060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013935319.1"
                     /db_xref="GI:503701243"
                     /translation="MVEQEVVRQVRVLAKAGWGAKRIAREVGVARNTVRRYLRAGSAA
                     DTQVRPKARRLTESEQQRAVELWDSAAEGNAVVVKALLAQEGVEASVRTVQRAVELWD
                     SAAEGNAVVVKALLAQEGVEASVRTVQRAVELWDSAAEGNAVVVKALLAQEGVEASVR
                     TVQRAVEKRRRQVHAAQTATVRFETKPGQQMQVDFGEKKVRLGGQVVKVFLLVAVLSF
                     SRRLFVRAFLNQRGDDWREGVAAAFVHFGGVPLEVLSDNARPLVEENNRQAGTVRFHP
                     AWVQFCRDWDVMPKACGPYRARTKGKTESGVKYVKRNALAGRDFEAFGAMEAHLAQWM
                     GEADERVHGTTHEPPLERFEREEKAALRPLPLRVLPRRHQRLKRKVANDALVDVDTVR
                     YSVPHRLVRENVEVQVGDDEVRIFHAGALVATHARHRQPHARVVDPAHWEGLWRPRAE
                     KRSEKDSSLTGLGRSLEDYAAVVEQDSKRGAA"
     gene            249572..249808
                     /locus_tag="LILAB_RS01005"
     CDS             249572..249808
                     /locus_tag="LILAB_RS01005"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708959.1"
                     /db_xref="GI:760025824"
                     /translation="MDSLKGSAVFWWTASAVLATAALIWLCMKRGSPGWMRMAVSGLA
                     SAVLLVFLSQWANDSYVNPILPWRSLLLRQLITQ"
     gene            249923..250426
                     /locus_tag="LILAB_RS01010"
                     /old_locus_tag="LILAB_01070"
     CDS             249923..250426
                     /locus_tag="LILAB_RS01010"
                     /old_locus_tag="LILAB_01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PBS lyase"
                     /protein_id="WP_043712251.1"
                     /db_xref="GI:760029200"
                     /translation="MRAIVGSDRATIVSAATLLSGDPTTTDRLIPLLDTASSADSRQG
                     ILYALSWHGDIRIWRLMVRILANPQEAPVVRGQAAEGIAYMFSQVRPGTAEFELAAKA
                     LLSALMDPSLEVRFGAIFALGASNHLPFVPVLEALVNDQTPVPGWVETIGEKAAAAIE
                     SLTWGKT"
     gene            complement(250727..251101)
                     /locus_tag="LILAB_RS01015"
     CDS             complement(250727..251101)
                     /locus_tag="LILAB_RS01015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708961.1"
                     /db_xref="GI:760025826"
                     /translation="MDGLNWNDVRDLARRVAQGEPLLLTAVTRSILLRVAPQVGIAPG
                     NAERALQSGATAEELLQEVSRRISNGSRRLSRTLADVERCRVAGDIDGARQLLNDVLA
                     VEVVPHYQDILRANLAALDDES"
     gene            complement(251643..255188)
                     /locus_tag="LILAB_RS01020"
                     /old_locus_tag="LILAB_01080"
     CDS             complement(251643..255188)
                     /locus_tag="LILAB_RS01020"
                     /old_locus_tag="LILAB_01080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase SNF2"
                     /protein_id="WP_013935323.1"
                     /db_xref="GI:503701247"
                     /translation="MSTPLDESVTPLFDTASDALAWLRAQGLEHLSRLSLAVLMPLVD
                     AAWLPQARPVLARRRLVELLSTDSLARWMTEAMPSPRMKELLPTLAWRFVEAERLGAE
                     ASRASLEERLAPPGDSRTHRVHGLLLALRARVPASVAPRPVHALVPDLMQYDAPLPGF
                     RLRETRISELPVGAHAGFILPEARLIFSPTEVTGDCSCGATFCVHLLAVIDTALLWLR
                     QPWSETFGEELEELVRPGWERALRALERAVDDSPGGPGGGEVSWRLDVINGYGVELAP
                     YVHKRNKKGQRSTGAKVSRRKLLQEHGSQLSAADARLAALLPESEAPASRALLFELVG
                     HPRIHLDENPDLLVRIERAKVGLVAEDRDGVVIVSAGVDGATLPSAMLERVRRAPPEE
                     GLYVWDDHQRVLTVLDAGPEVRALLTALNRHGNAFPPESHVALLDQLSKLSLRVPVAL
                     PRSVMGESVPLRYVSVVRMEAHASGAVRVELRARPLPDSPTFIPGEGARDVHIRRGTG
                     AVHAVRDFVQERDTAELLQARLPLDTAEPEELPFTFRFTSAQGGLAVLAACTEVEPRP
                     ELEWVGAPVRLFQAPSPQALKVILERKRDWFGVLGGLSVEGERVELARLLDAARRKER
                     WVQVDATSYVEIEGALREHLERLADHAHATRHGLEVGPSAVEALTALQDAGADVEADK
                     TWQSLVERIFAAKELKPRVPAGLKTALRDYQQEGFRWLTRLASWGAGGVLADDMGLGK
                     TVQALTVLLDRSKLGPALVLAPTSVAFNWMEEAKRFAPSLRMTLFSEVADRGQTLERL
                     GPKDVLVMSYGLLTRDIERLSKLRFSTIIFDEAQTLKNATTHRFRAARALQGDFKFAL
                     SGTPLENHLGELWSLFAVVFPGLLGSWEAFRSRFAAPIERGVDPTAAPALARVLQPFL
                     LRRTKAQVEAQLPPRTDIRVPIVLSSEEWALYEDARLAALSDLETRKPKLKEQERRIE
                     ILAALTRLRLLASHPRLYDAGSKLESAKLERFMELVRELRAEGHRALVFSQFTSHLAL
                     VREVLDAEGIDYEYLDGQTPAGARAERVRAFQEGDVPLFLISLKAGGFGLNLTAATTV
                     IHLDPWWNPAVEDQASDRAHRIGQERPVTVYRLVTRGTIEEQMLSLHEHKRALVAGVL
                     EGKDAAGRLSTHELLGLLSQRLAPPGEEEGPRTRH"
     gene            255361..255951
                     /locus_tag="LILAB_RS01025"
                     /old_locus_tag="LILAB_01085"
     CDS             255361..255951
                     /locus_tag="LILAB_RS01025"
                     /old_locus_tag="LILAB_01085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935324.1"
                     /db_xref="GI:503701248"
                     /translation="MTMSPRFASVLMLLVLTGCTSQRQTLLERTSSHVVYDMPARQVM
                     KAAEAVLGERGYALLPSTDPLFLITPWKVSGNYDVFTHWSRIYVEGHKRPDGRFTVRA
                     YQMAANMPARTQSMPVPENTAAVAPEEKQNIMPTVLLSAEPVLVRSARPDLRRDLELE
                     WAIMERLDPDFAGRVKTQVDIYLAHSSPKRPGDVLE"
     gene            256000..257013
                     /locus_tag="LILAB_RS01030"
                     /old_locus_tag="LILAB_01090"
     CDS             256000..257013
                     /locus_tag="LILAB_RS01030"
                     /old_locus_tag="LILAB_01090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935325.1"
                     /db_xref="GI:503701249"
                     /translation="MKRSVYGLVLALSLTACKEEPRGKMEPIPRPPGMKDAPPPPEAA
                     PAQAAEPPEDPSKVVLRWKLTAGAPTSYRLDIERTGGAPEEGSSTRKGRGKGKEKPAA
                     AAPAATLPDALTYALERTDSGDYRLRVIPEGSNAEVDVGTLSERGFVLDGLQGATRNT
                     ATLVLELPREPVGTGDTWSLGTELILSEALGAQFQAGQPERRNRVKLASLTPADGGEQ
                     VATLEYDISEKLGGTLHAQEAPPTSPARAAEEEAEAADSENPRRKPSPETSASAEVTI
                     TGRGEFLVKAGRWRSWEGTITSVTKGGFPTAALQVPTGTMKLRLSAAEAAPAPAPTAQ
                     PQQ"
     gene            complement(256991..258052)
                     /locus_tag="LILAB_RS01035"
                     /old_locus_tag="LILAB_01095"
     CDS             complement(256991..258052)
                     /locus_tag="LILAB_RS01035"
                     /old_locus_tag="LILAB_01095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_013935326.1"
                     /db_xref="GI:503701250"
                     /translation="MPTPTSKRGLLLVNLGTPDAPQPGPVRRYLREFLSDPRVIDIHP
                     VARWALLNLVILPVRPAKSAEAYRKIWMKEGSPLLVYSQALAAQVAERLAGEYEVVLA
                     MRYGSPSIPDGIAALKARGVSEFTVLPLYPQEAASSTASSLARTYEVLAQSWDVPFVR
                     AVPAFFEHPGFLDAFTTVARPVIDEARADYVLFSFHGLPERHMRKSDPTGAHCLSTAS
                     CCDALTDANRHCYRAQSYATARGLAQRLGLPADGWSVSFQSRLGRTPWVKPYTDVVLP
                     ELAKQGVKRLAVMCPAFVADCLETLEEIGLRAREQFVEAGGESLTLVPSLNAHPAWVD
                     AVVRMVRESDGPPTAAAAP"
     gene            complement(258052..258438)
                     /locus_tag="LILAB_RS01040"
                     /old_locus_tag="LILAB_01100"
     CDS             complement(258052..258438)
                     /locus_tag="LILAB_RS01040"
                     /old_locus_tag="LILAB_01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter ApaG"
                     /protein_id="WP_013935327.1"
                     /db_xref="GI:503701251"
                     /translation="MSSSATTDGIRITVKPSYWPERSAPESGQFAFMYTVEIANEGDA
                     PAQLKARHWVITDATGKVEEVRGEGVVGRQPHLGPGERFEYTSWAMLRTPFGTMRGSY
                     DMARPDGTRFEARIAEFALTLPNSLH"
     gene            complement(258509..259459)
                     /locus_tag="LILAB_RS01045"
                     /old_locus_tag="LILAB_01105"
     CDS             complement(258509..259459)
                     /locus_tag="LILAB_RS01045"
                     /old_locus_tag="LILAB_01105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013935328.1"
                     /db_xref="GI:503701252"
                     /translation="MNTQVALWVGFNVFVLAMLALDLGLFHRKDHAVTPKEAGLWTLV
                     WITLSLIFCAGIWHYQGPTVGLQWLTAYVVEYALSVDNLFVFLMVFSYFRVAPEHQHR
                     VLFWGILGAFVMRAGLILAGTALVKQFHWLIYLFGAFLVFTAVKMLVSKDEEIDPEQK
                     GIVKFARRVLPVARLGEGSRFMVQEDGRSKFTPLFIVLLVVEATDLLFALDSIPAVLG
                     ISQDAFIIYTSNVCAILGLRSLFFVVASLMDKFHFLKVGLSAILGFVGVKMLITFFDI
                     HLHIGISLGVIAGILLAAIIASLVWPKQPDPGQDRESAKT"
     gene            complement(259580..261721)
                     /locus_tag="LILAB_RS01050"
                     /old_locus_tag="LILAB_01110"
     CDS             complement(259580..261721)
                     /locus_tag="LILAB_RS01050"
                     /old_locus_tag="LILAB_01110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching protein"
                     /protein_id="WP_013935329.1"
                     /db_xref="GI:503701253"
                     /translation="MRRAEVLPGKPYPLGATFDGHGVNFAVFSEHAKKVEVCLFDPED
                     PAKETRRFPLLETTHQVWHGYVPGLAAGTLYGLRVHGPYEPKKGQRFNPHKLLVDPYA
                     RAIHGQVDYQGPIYAYTPGAKEDDLAFDARDDAAAVPKGVVLGPDTFDWEGDAPPAVP
                     WHDTLIYEVHVKGFTKLHPRVPEALRGTYAGLAHPASIEHLKKVGVTAVELLPIQHIV
                     DEPFLIEREKVNYWGYNTLGYFAPDARYSGSGSLGGQVDEFKRMVKQLHRAGIEVILD
                     VVYNHTCEGNQLGPTLSFKGVDNAAYYRLTDKDARYYMDFTGCGNSWNATHPYALKLI
                     ADSLRYWVEEMHVDGFRFDLATTLGRDRYGYDTRAAFFQIVHQDPVLSRVKLISEPWD
                     VGDFGYQVGNFPVLWSEWNGKYRDTIRRYWKGDDRQAAEIGYRLTGSSDLFSMSGRKP
                     TASVNFVTAHDGFTLHDLVTYNDKHNEANGEENRDGANDNHSWNCGVEGETTDAKINA
                     LREQQKRNFLATLFLSQGVPMLVAGDEMGRTQKGNNNAYCQDNELSWVDWELNDTQRA
                     LLDFTCALTKLRREQPVLHKRRFFRGAHMWDSELKDLAWFRPDGKEMRKDDWEKPYVR
                     SLGILLGGDAIAAPDDEGNRIVGDTVLVLMNAHHEPITFMLPAVEWGADWELVVDTAV
                     SGESPRTHTPAGGTVQVVGRSLAVLRRPATE"
     gene            complement(261718..264744)
                     /locus_tag="LILAB_RS01055"
                     /old_locus_tag="LILAB_01115"
     CDS             complement(261718..264744)
                     /locus_tag="LILAB_RS01055"
                     /old_locus_tag="LILAB_01115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose synthase"
                     /protein_id="WP_043712253.1"
                     /db_xref="GI:760029202"
                     /translation="MAEGLYSRVQAELAARPHTPLSTYRVQFHKGFTFEDARQVVPYL
                     ARLGASDLYASPYLKATPGSTHGYDCVDHQQLNPEVGTPESHAALCAALREQGMGQVL
                     DVVPNHMGIERDNRLWFDVLENGPSSVYAKFFDVDWSPVKEELRDRVLLPILGDQYGI
                     VLERGELKLSFQEGAFFLHYYDHLLPVAPRQYARILRHGLERLESRLGGEHPGMVELL
                     SILTAIDHLPARTEVERPKVVERHREKEVIKRRLASVTAEFPEVLAYIEDNVRVFNGE
                     PGNPRSYDLLDSVLSACSYRLAHWRVAGEEINYRRFFDINGLAALREEDPDVFQEAHA
                     LIFRWLREGLVTGLRIDHPDGLFDPTAYFLDLQEAYFVERAHALFLQAHAEDDTRWPA
                     VERALRERWRAEVTQQPDSPLRKALYVVVEKIQGGRERMPESWAVHGTTGYRFANAVS
                     GLFVQPDAEKPLTELYERFVGGQADFAELVYQKKLLIMRVSMASEINVLAHELNRISE
                     MNRRTRDFTLNSLRRALVEFIALFPVYRTYVDGWRPELDGRDVQYIEWTLQRAKERNA
                     TTNASIFDFLRDILLRRYPEHVDARERDVMLRFAMKLQQVTGPVMAKGLEDTVFYIYN
                     RLVSLNEVGGEPERFGVHANTFHLRNQERAEQWPASQLTSSTHDTKRSEDVRARINVL
                     TELPEAWRKRVRKWARQTEKAVSQLPTGPAPTANDIYLFFQTVVGAWPMGESHSAEEL
                     ADFQRRVREYMGKAIKEAKVRTSWTNPDSAYDDAVARFVDACFDPKVTGHFLEDARDF
                     KRSIERAGQHNALGQLLLKMASPGVVDTYQGCELWDLSLVDPDNRRPVDFAQRARLLE
                     ALDAEVKQDRGALSRRLAANLDDGQVKLYVLAESLRLRQRQAALFREGGYRALELTGP
                     RAKAAVAFAREHGDSVVVACAPRYTLSALASPEGLAGAYGSTFLDLPEAYAGMMFREV
                     FTGRQVRPERGPGGAVLPLGPLLAEFPVILLERSTG"
     gene            complement(264985..265302)
                     /locus_tag="LILAB_RS01060"
                     /old_locus_tag="LILAB_01120"
     CDS             complement(264985..265302)
                     /locus_tag="LILAB_RS01060"
                     /old_locus_tag="LILAB_01120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011551643.1"
                     /db_xref="GI:499870909"
                     /translation="MAAKKAAAKKAPAAKKAPAAKKRTPNASFMKEMTPSAALAEIVG
                     AKPLPRTEVVKKLWAYIKKQGLQDAKNKRQINADDKLKPIFGGKKSVTMFEMTALVNK
                     QLS"
     gene            265649..266629
                     /locus_tag="LILAB_RS01065"
                     /old_locus_tag="LILAB_01125"
     CDS             265649..266629
                     /locus_tag="LILAB_RS01065"
                     /old_locus_tag="LILAB_01125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_013935331.1"
                     /db_xref="GI:503701255"
                     /translation="MRALITGAGGFLGTWLAKALAARGDSVTCLLRPGGDASGLAGVS
                     HSRVDGDVTVPSTLAAAVAGQDVVFHLAGARRGATRDDFMRVNAEGTRHLCEAMVAAG
                     HRPRLVLTGSLAACGPSTPTRPHVEEDAFHPHEWYGESKAEAERIAFSYGDRLPVTVS
                     RPPRILGPGDRENLTFFKMARRGIRLELSGGPRPLTMIDVEDVVDVLLLQATHPAAVG
                     EAFFCAGPGAPLSLEQVQDLGARALGISPRTVRVHPAVLRALATAADGVSQLTGRKLA
                     LSRKLAKQLLAPAWTCSGAKAERLLGFHPRRDLADSIRRSVTWYQEQGWL"
     gene            266719..267384
                     /locus_tag="LILAB_RS01070"
                     /old_locus_tag="LILAB_01130"
     CDS             266719..267384
                     /locus_tag="LILAB_RS01070"
                     /old_locus_tag="LILAB_01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_013935332.1"
                     /db_xref="GI:503701256"
                     /translation="MSAKAAFFDVDGTLVKTNVVHVYAYYAMNRGSVLGIAGRTLSTA
                     LSVPLFGVMDALDRKTFNEFFYRYYAGLSEDRLVTIAEDMFEDVLQPALFEQTQDLID
                     QARRSGCKIVLVTGALDFTMRPLARHLGADDMIANKMQFVGGKATGKVIPPIIEGANK
                     ANAIRAYCTKEGLSLDKCHGYSDSASDYAMLAVVGRPTAVNPDLRLRSIARAYNWPIL
                     DLK"
     gene            267399..269009
                     /locus_tag="LILAB_RS01075"
                     /old_locus_tag="LILAB_01135"
     CDS             267399..269009
                     /locus_tag="LILAB_RS01075"
                     /old_locus_tag="LILAB_01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935333.1"
                     /db_xref="GI:503701257"
                     /translation="MRPFKTLQKLYDEESQVVITEKGSPPRVLFHGENFLQEDLPVGT
                     RVIFPRPPLAGVPNVKAAIRYAINHPEGMEPLHALLKPGMRLTCVIDDISVPLPPMVT
                     PDVRQTILEIVLELAADSGVDDVHLVIANALHRRMTEGEMKRMVGEKIFDAYYPDRYY
                     NHDAEDPDGMVALERTSHGEEVSVNRRVAESDLIVYVNVNFVPMNGGHKSMGTGVSNY
                     ASLRHHHNPKTIRASDSYMEPKTSALYKSNERIGRNIDKHLKVFHIETALNNRMFGGP
                     TDFLAKKEEDYTEGDRLKFQAMRFALSKLPRAAARKVLNSVPAPYDVTGVYAGATEPT
                     HAKTLETSYKQYVVPVEGQSDIVIFPIPFISPYSVNSILNPLLVQVMGLGYFYNLNRG
                     VPLVKKGGVLILLHPAYDEFDPEHHPSYIEFFHRLLPETRDSMKLEHKYEREFAENPS
                     YVHLYRKGNAYHGVHPFYMWYWGENGRQHVGKVIVAGAENNHVPALMGWERTDTLTEA
                     IEEARGFMGRSATISLLRIAPTVMVDVK"
     gene            269018..273430
                     /locus_tag="LILAB_RS01080"
                     /old_locus_tag="LILAB_01140"
     CDS             269018..273430
                     /locus_tag="LILAB_RS01080"
                     /old_locus_tag="LILAB_01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_013935334.1"
                     /db_xref="GI:503701258"
                     /translation="MAPLPELNVTQTFTGKRLLFAGATGFVGKVTLSMLLSRYGQDLD
                     KVYVLVRKGSAASAERRFFDKVATSEPFQPLRDSLGDAGALAFIQQKVEVLDGDITDP
                     WMGLEEARVAELTGQVHAFINCAGLVSFNPSLEVGLNVNTHGLKFAAELALRWSVPLI
                     HMSTAFVAGNRSGLVFEDEDIRGYFPKRDEMDGRDFSLEQELQDAARVVARLREQAED
                     RALTSTFRKKALDRLEEEGRDTNDEKTLRLAVGRERKLWLSGELVRAGMERAAHWGWP
                     NTYTYTKSLGEQVLAATPGLRYSIVRPSIVESARHFPFPGWNEGFTTSAPLAFAGIKG
                     PGGIPAGESTILDIIPVDQVAGATIGITAHAMDVEERRIYQLASGDENPFYAGRSVEL
                     VGLYRRRYYRNRESGNALMNKLRSRLEPQPVSKKEFELFSAPMLSRGARFLKKAIDEV
                     RPAWGAPAVQAMLDKAKVSLDEVEENAQGIIALTELFLPFLYENRYVFRCDNTRSVYA
                     RMAHADRLKVPWDPEHIDWREYFLGTHLPGLEKWVFPGMESEREKRTVIPAHRDLLEL
                     LEATVHAYRHRVAFRMVAGEREERFTYGEVHRYAARVGSFLLAKGIKHGDRVLLVSEN
                     RPEWGITYFGILRSGATVVPVDPALSEAELVNIARRAEARACLVSEDAARDYPGLFAA
                     LGEGVTVASLAEAMTGDPAHPDRIGPVRKSAAADDLASVIFTSGTTGTPKGVMLTHRN
                     FASLVAKLAGTFDIGVGDGVLSVLPLHHTFEFAAGFLTPFWRGAEITYIDELTSDRLG
                     EVFETGRITAMVGVPALWQLLHRKMTQEFASRPPFIEQALKALMATHGELRNRNNINL
                     GKLLFWPVHRKFGGRIKVLVSGGSALPDDVHKAFHELGFNITEGYGLTEAAPVLAVTK
                     PGNKRQPGTVGRALPGIELRILNPDNDGLGEVLAKGPNVMPGYFGDREATEAVLKDGW
                     LHTGDLGRLDAEGRLYLVGRAKDVIIDHNGKNIYPDELEELYQDHPHIKELSVVGLPD
                     EAGGEKVACLCVPDYGDRPREEVRRELEEHFRKVGSGMPFYRRVKVLRLWDGELPRTA
                     KRSVKRKQVVEELKRQERMAASASKAREKAANPTTGGVADWLFPLIAEVSHRPVTDVR
                     PDALLSGDLGFDSLMLTELSSALEAAGVPLPAVEDLTQVQTVEDLRKVVASSGKRPSV
                     ETRAKDISKENERAEEVEIPVPDVVADVGRQLLSFGQKVLYGGVFDVKVTGKPFIPQN
                     RNFLVIANHSSHLDAGLVRTALGEQGERLVSLAARDYFFNTPLKRAWFENFTNLVPIE
                     RQGSLRESLRMAGEALRQGFNVLIFPEGTRSPTGELMEFKSTLGYLALTYHVDVLPLY
                     IGGAFDALPKGSVLPRTKTPLRVNIGPVLGHADLRTRVQGMARSEGYRYVTRIAEDSM
                     RALRDGRVLSLERVDLPPAGATSRTSSSTEGKDS"
     gene            273427..274455
                     /locus_tag="LILAB_RS01085"
                     /old_locus_tag="LILAB_01145"
     CDS             273427..274455
                     /locus_tag="LILAB_RS01085"
                     /old_locus_tag="LILAB_01145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_013935335.1"
                     /db_xref="GI:503701259"
                     /translation="MKLLVTGGTGFLGTHLVPRLVAAGHEVRLIGRSQPTGAAYAGTE
                     YVPGDLKNRDAVRRALEGVEAVYHLAGLVSFQPKDARKMFELHVDSTRELLSDVREAG
                     VKRVVLASTSGTIAVSKEERVLDERADYPITVVGQWPYYLSKIYEEKLALAYCRKHAI
                     PLVVLNPSLLMGPGDDRLSSTWTVVKFLNGEIPAMPGGGISFVDARDAADAFVQALTR
                     GEVYGRHLMGVNLSMTDFFQRLERLSGVPAPKLKLPSKLNVLGGKLLERWAKVRGTTP
                     ALDPQEIDIGEHWFWLDASKAEAELGFRARDIQETLSETVRHIYGKMPPQSLPGTKGR
                     LAELRENT"
     gene            complement(274675..275556)
                     /locus_tag="LILAB_RS01090"
                     /old_locus_tag="LILAB_01155"
     CDS             complement(274675..275556)
                     /locus_tag="LILAB_RS01090"
                     /old_locus_tag="LILAB_01155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_013935337.1"
                     /db_xref="GI:503701261"
                     /translation="MAGDETRVTKISTLNVHAHRSTECCLVQIHGPELGKKYLIEDAE
                     LTIGRDQHNHIVVDLDNVSRRHARILGRGGKMLVEDLGSTNGTFLNDQEVLQASPLRS
                     GDLVKVGGSIFKFLDGDNIETQYHETIYTLTIADGLTGINNKRYFLEYLEKEMGRSTR
                     YQRTLTLMMFDIDHFKQINDVHGHLAGDYVLRELAQSIKRLVRREQCFARYGGEEFAV
                     VLPEDGPDKARLFAEKIRRLIEGKSFVYDDKEIPVTISIGVAEQTPDMLEPTHFIKVA
                     DANLYKAKKSGRNRVVG"
     gene            275815..277044
                     /gene="glgC"
                     /locus_tag="LILAB_RS01095"
                     /old_locus_tag="LILAB_01160"
     CDS             275815..277044
                     /gene="glgC"
                     /locus_tag="LILAB_RS01095"
                     /old_locus_tag="LILAB_01160"
                     /EC_number="2.7.7.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DC47.1"
                     /note="catalyzes the formation of ADP-glucose and
                     diphosphate from ATP and alpha-D-glucose 1-phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="WP_013935338.1"
                     /db_xref="GI:503701262"
                     /translation="MSKVLAMILAGGAGTRLEPLTRERAKPAVPFGGRYRIIDFVLSN
                     FANSGVYRMKVLTQYKSDSLNNHLSRAWRMTAFLGHYVEAVPAQMRTGVDWYKGSADA
                     IYQNLNIITDEEPDHIFVFGADHVYRMDTRQMLDFHCAKKAACTVAAIPVPIEQGREF
                     GIIDVGPDGRMLQFLEKPKDPPPMPGNPKMCLASMGNYLFNTDTLVQEVVRDAANEAS
                     AHDFGKSIISELYKRAPVYVYDFAQNEVAGQEAKERGYWRDVGNIDVYYQSNMDLVEV
                     DPTFNLYNDRWPIHTQPNNYPPAKFVFADEQNHRVGHAMDTLVAEGCIISGGSVRRSV
                     LSPKVRVNSYSEVEDSILFENVTIGRRCRIRRAIIDKNVEIPPGMTIGFDPVEDRRRF
                     HVTPAGVVVIPKGMKVT"
     gene            277052..>277453
                     /locus_tag="LILAB_RS01100"
     CDS             277052..>277453
                     /locus_tag="LILAB_RS01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935339.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_043712254.1"
                     /db_xref="GI:760029203"
                     /translation="MGADGLLLRPAKESDRRTLWRIHTQAVEALCPRAYAPHEVRTWV
                     RLLRPEGYLRPERPRTVLVAERGRRAVGFGQVDAALGELEALYVVPDEAGHGVGATLL
                     WALESTVWRGDAARLGLDASLNAEHFYQRHGY"
     gene            complement(277569..278111)
                     /locus_tag="LILAB_RS01105"
                     /old_locus_tag="LILAB_01170"
     CDS             complement(277569..278111)
                     /locus_tag="LILAB_RS01105"
                     /old_locus_tag="LILAB_01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708964.1"
                     /db_xref="GI:760025829"
                     /translation="MACSPVSEWNGLAAGSPPPRHLTRHRGELGTMENTYGTMNSPGG
                     PGAQEAVSLPAILLMVLSGITVLLGLVNLLQSFGGTDPAVTEALQNPDLPEGARRLIA
                     GLSSTGGKVMFALLTIALNGLIFFGALKMKNLQSHGLAMTAAIISVIPCCSPCACLGI
                     PVGIWALVVLNKPEVKASFT"
     gene            complement(278149..279573)
                     /locus_tag="LILAB_RS01110"
                     /old_locus_tag="LILAB_01175"
     CDS             complement(278149..279573)
                     /locus_tag="LILAB_RS01110"
                     /old_locus_tag="LILAB_01175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935341.1"
                     /db_xref="GI:503701265"
                     /translation="MQPKLNRLLRALAREGLEVAYDGRLYSVRLQGDAHAPPAEVLLP
                     PDLPVEGKAFQQLAHLAALRHPSGGQVLRVRATPDFHPGDSGVAIGSVLHTRGLVVPG
                     AIGTDINCGMRLHVANVSVEAFLAKRTAFVERMKGHYFFGTRDVTMGSRASEALLRDG
                     VQGWLVETLERPLGCAGRADLAQLDAEVARIHLGGGLKGHPRWAPESFTREGLVRDAG
                     LATIGGGNHFVEVQRVEAVEDRARAWGWGVREGQLAFMIHSGSRDVGKHVGVAWQDRA
                     RQAWPVGAPLPESGILPLGDARLVEQYLEAEATAANYAFLNRLLLAELLRQTLRELFG
                     DVEAPLVYDVPHNLTLPYEGGWLARKGACPAGAEQPVIIPGSMGATSFLMVGCGDARA
                     LESASHGAGRARSRFSLSRGGADQSEAALGLAGVDCITLRAERRVEEAPAAYKPIRPV
                     VDAQVEAGIVREVARLAPLLTFKA"
     gene            complement(279735..280514)
                     /locus_tag="LILAB_RS01115"
                     /old_locus_tag="LILAB_01180"
     CDS             complement(279735..280514)
                     /locus_tag="LILAB_RS01115"
                     /old_locus_tag="LILAB_01180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013935342.1"
                     /db_xref="GI:503701266"
                     /translation="MDLELGGKVVLVTGGSEGLGAAVARRLVREGAKVALCARGVERL
                     EATAAALRAEGGDVLTVQADVSRAWEVEHFVDAAHARFGRIDALVNNAGTAAGRPFAS
                     VSDAEWEADLQLKVFAAIRASRQALPFLKESGGGAIVNVLAIAAKTPGANSTPSSVSR
                     AAGLALTKALSKEFGPHDIRVNAVLVGIIESGQWERRAREVGKPVESFQQEMARHAGI
                     PLGRVGKAEEFADTVAFLLSPRGGYISGAAINVDGGLSAAV"
     gene            complement(280595..281755)
                     /locus_tag="LILAB_RS01120"
                     /old_locus_tag="LILAB_01185"
     CDS             complement(280595..281755)
                     /locus_tag="LILAB_RS01120"
                     /old_locus_tag="LILAB_01185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_013935343.1"
                     /db_xref="GI:503701267"
                     /translation="MPTIRDDEIPNATGIPSSARRTDFMPPPTLAVTEELLRALPKTD
                     LHCHLDGSMRLKTILELAEQQKIKLLADTEDGLAKAIHMGEVCESLEEYLVAFDVTLS
                     VLQTAEALYRAAYELAVDAAAENVRWLEVRYSPALHLQKGLKMTTVIDSVLEGLRAAK
                     RETGIKCGVIVCGIRHINPQTSMRLAELAVAYKNRGVIGFDLAGAEASFPAKDHRDAF
                     QLILKNNVNCTAHAGEAYGPESISQAIHNLGAHRIGHGTRLREDGDLLNYVNDHRIPL
                     EVCPTSNVQTGAVSSLSAHPLKFYFDYGLRVTINTDNRLITDTTVTKELWTAHSELGL
                     SLEDLTTILVSGFKSAFLPFREKQDMLRAVNEEIARTLAAFDQKRHPVKQPA"
     gene            281791..282882
                     /locus_tag="LILAB_RS01125"
                     /old_locus_tag="LILAB_01190"
     CDS             281791..282882
                     /locus_tag="LILAB_RS01125"
                     /old_locus_tag="LILAB_01190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043708967.1"
                     /db_xref="GI:760025832"
                     /translation="MSSRACPCTPLLPALALTLVAAMGCREPATSAFRYSTDASSRAG
                     LVALTDGVLTANEAGTVVRLERSGRVAWRVPLDREVATRPALLADSVIAGTVGGDLVR
                     LALDTGAVRWRLSGEPPVLTAPVADAAGKYVFLVAPDGAVRALFTDTGKTDWERPPPG
                     KPGPAAAPRAFPTPVLRDGLLVVALGDAGVMALATQDGARRWQRDVRDVLGMTLWRDT
                     LYVSTRQGRVLALRLGDGTPLWERAPAAALSSPPSLALGAVWVGTGGAEPLLVGLSSE
                     DGEEVARATLPDALVAGVTPVREDLLLVPTSGRQGRLVALKTGTWQPAFSVRADTPLR
                     TQPVALGDQVIVLGLDGRVLSWRLRTPTR"
     gene            complement(282913..285264)
                     /locus_tag="LILAB_RS01130"
                     /old_locus_tag="LILAB_01195"
     CDS             complement(282913..285264)
                     /locus_tag="LILAB_RS01130"
                     /old_locus_tag="LILAB_01195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013935345.1"
                     /db_xref="GI:503701269"
                     /translation="MSPANPHETALLEDLNAPQREAVLHGDGPLLVLSGAGSGKTRVI
                     TRRVAYLVKVHDVYPWRILAVTFTNKAAREMRERLTQLLGAQANELVVSTFHSAAAQI
                     LRREAEHVGLTRSFVIYDDSDQLNVVKRAMREAGIESMQPREILHRIDQEKNAARLPE
                     HMQVAPGDERGQLVRKVYAAYQERLRAANAVDFGDLLLLLVTLFRTRPDVLENYRRRF
                     THVLVDEFQDTNPVQYALLKQLAPPPSANLVVVGDDDQSIYRWRGADVDNILSFPRQY
                     PGAKVVKLEQNYRSDQNILDAAHEVIRKNTRRMEKKLWSERPRGQTLDLLLNRDERAE
                     AQEVARQILALQREGFIKLSSMAVFYRANAQSRVLEEALRLARVPYTLVSGRSFYDRA
                     EVRDASAYLRLMVNPRSDADLLRIINIPARGIGDTTVERLTDFANTRGVSLYEALSQP
                     EQVPALNGAAVKRLKGFRNLLESLTAFAQTNEEAAGAVDQMLRETKLVETLLAEGSDE
                     AQTRAENLREFLGAAQEFDLNRAAAAVAAAANPPPEVPPEVDAAPLTADVPALQAFLE
                     QISLVGEADAEVGDGRVALMTLHAAKGLEFDAVFLTGMEENVFPHARAVKSETTFLNE
                     DASADGEPSEEMAEERRLCYVGFTRARKRLFVSLAQCRSLFGELRYNAPSRFLRDVPS
                     PLFGISEQELPEAPRPRVPSMPRRRPHDEDDGPRIDRSYSQASSDMDGVGGDVRGMRV
                     RHEQFGVGRVVSADGNGPNAKVTVEFGGGVGLKRIIARFLMPG"
     gene            285383..285868
                     /locus_tag="LILAB_RS01135"
                     /old_locus_tag="LILAB_01200"
     CDS             285383..285868
                     /locus_tag="LILAB_RS01135"
                     /old_locus_tag="LILAB_01200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_013935346.1"
                     /db_xref="GI:503701270"
                     /translation="MSDSSSGAPSKPSQADLDRYAEQFSQSLTLRLFGARLSFPEGRK
                     VVVSIPALRPEHRGGAGSASAVNGGILAALFDYAIGCTGALVDPGRRCATVQLSMSFE
                     RAVTGDHLRVESEIDSQTVSLLFATARVYDGEGRVCGRCQGVVKLSNLRWASGDSPAV
                     N"
     gene            285872..286639
                     /locus_tag="LILAB_RS01140"
                     /old_locus_tag="LILAB_01205"
     CDS             285872..286639
                     /locus_tag="LILAB_RS01140"
                     /old_locus_tag="LILAB_01205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708968.1"
                     /db_xref="GI:760025833"
                     /translation="MPTTPHILPAPIDMSGTDTRSGDTGEQACAPDASERREDGMSAA
                     VQGLRMTTLRLSKEADEPDAATAPGGDEALLARRALAGERAAWDALVARHHRRVVVSL
                     LARGVRVDRAQELAQETWARLIQQQQRGLLTELRLPNLALTQAAFLAADDARRARRES
                     IAGAVEELPERHHPVDPAVSAERRLLSEEQLSRAHAALAQVSPSARNVFLLACDGQEL
                     PHAEVASRVGLSVQRVRQILCEVRKKLRTALEEETHA"
     gene            286632..287186
                     /locus_tag="LILAB_RS01145"
                     /old_locus_tag="LILAB_01210"
     CDS             286632..287186
                     /locus_tag="LILAB_RS01145"
                     /old_locus_tag="LILAB_01210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935348.1"
                     /db_xref="GI:503701272"
                     /translation="MLKPHLTRDSAEQYILGALAPEKAASLEAHTLECEPCARLLQEE
                     ALLSEQLHEVASTCSPAAAVIRPARWDARRHVAGLAGAALAAAAAVVFVVLPGERPPP
                     ASPRTIALDVTPPTVGLETEVAEPQAIVVACPDLATQASCTQAAEERGLLVQYPWGTG
                     EVPRYEARTGLPEGALSARRPVSL"
     gene            287198..288361
                     /locus_tag="LILAB_RS01150"
                     /old_locus_tag="LILAB_01215"
     CDS             287198..288361
                     /locus_tag="LILAB_RS01150"
                     /old_locus_tag="LILAB_01215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013935349.1"
                     /db_xref="GI:503701273"
                     /translation="MDFRKKLAALLLALASTGAGAQPSEGTQKLPVGWYVTESAPKRY
                     EAGVDSSATCEGSRSAYLRSLSPDSNGYGTFMQAFGAQDFRGKRLRFSGALRIKDVEG
                     WAGLWMRVEGPDPKQPLAFDNMQSRALVGTAGCKRYDVVLDVPKEATTIMAGLIMSGT
                     GQAWLDGVRFEVVDASVPVTDLLASRPVVAASSPSGLEDAPEPVAKNDPLPLGRVGDV
                     WFNQGRIAADKPYTRRKDGVWVSILGEEVYEHGIAVTGTLGQRALDLKLKAGGRRTLV
                     EGTWGDEPVDIQLTPEKLTLRWGRNTRELARHLDPQVDATCNRYQKTEGPRVTDQLDV
                     CGAALGTRPPSAQLVIALLANGFSPTLPAGSAPIPQPPVRSRQALDTERTAVP"
     gene            complement(288421..289608)
                     /locus_tag="LILAB_RS01155"
                     /old_locus_tag="LILAB_01220"
     CDS             complement(288421..289608)
                     /locus_tag="LILAB_RS01155"
                     /old_locus_tag="LILAB_01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935350.1"
                     /db_xref="GI:503701274"
                     /translation="MIVGDTLSRYAARRSQLLSGMASPGEVLEAAGDLLRRRSRLETE
                     GVDAALRGLGRPQVEAWLKSQKPQSLQPVLLRAAEEAVEVVLDGGEEADMWRTSALEG
                     LSARDRAASAAHALAVWEGFHGALDGDAAQLRDRFLAALQSLDSALSSRARWFIPLNP
                     QRRQERDLLEPAEQDAAWWFSARAGCDDLVATWTASPQTLTPHLQECEACRADMADAA
                     PVDMPPRRHLTADDLWRLDMGLLSEDERTRLDAHTARCGECAQAVLALDEGEAAIDEA
                     LDMEEDGTVARSARTSRAPVSHRAHAARLPEQREVLDERRDFRVVLVRERQRVRLLVQ
                     PLAGRAVTAAVFLSPGRPSLKPAHGPEGIAFDLTSASATGARSAHLSVQAGSETLERD
                     FAF"
     gene            complement(289657..290325)
                     /locus_tag="LILAB_RS01160"
                     /old_locus_tag="LILAB_01225"
     CDS             complement(289657..290325)
                     /locus_tag="LILAB_RS01160"
                     /old_locus_tag="LILAB_01225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma 70"
                     /protein_id="WP_013935351.1"
                     /db_xref="GI:503701275"
                     /translation="MYEQLTDDELFAEVVRRRATNEPYQGPLGALVQRWARPSRYVIS
                     KIQASYGRGSPADSDELFQDAVGKFIDRGLDQFRGVSEQMPGRSASPKTFFLRIVKHV
                     AIDFYRKHREELAAPPADPDDAMEEPPSQVARAVEFGKRREERAEAQELYWAAFARLQ
                     QEHPKEASAWDLYHHEDVEDHEECARRLNITVVNSYKRVSRAQAYLKLYLLDLQRESY
                     GEGA"
     gene            290760..291467
                     /locus_tag="LILAB_RS01165"
                     /old_locus_tag="LILAB_01230"
     CDS             290760..291467
                     /locus_tag="LILAB_RS01165"
                     /old_locus_tag="LILAB_01230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_013935352.1"
                     /db_xref="GI:503701276"
                     /translation="MSRRTIVIGDLHGCYDEAVELLDKVGATSSDRVIFAGDLVDRGP
                     KRRECVELAMRHEAVLGNHEEKHLQQRHRADERLLPDHLETRRVLEAEHYAWMAGLPH
                     YLRLPEHNAIVVHAGMLPGRPVEEQDAYHLLHAQCIRPPATKSYWPSKAPAGWTFWTH
                     HWKGPERVIFGHTAFDAPLVTEYAVGIDTGCVYGHSLTAVVLPTWEFVSVPARSTYRG
                     GKRVARIAVHGDVSVFS"
     gene            291634..293403
                     /locus_tag="LILAB_RS01170"
                     /old_locus_tag="LILAB_01235"
     CDS             291634..293403
                     /locus_tag="LILAB_RS01170"
                     /old_locus_tag="LILAB_01235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935353.1"
                     /db_xref="GI:503701277"
                     /translation="MTTQTQHPNALLPEAQRGPAERLLDLVLSGSAHLWHNRPGLEVN
                     GIWHAAAHATPFQREKGRPVKPGLFVPAAVRLYRQLLDIYKLNAELMAHFASYALTQT
                     DWRDLKVATCALMLVQEHAGQPVRDEQGGVAFHDDDWRAIGEAMVLHYERKSTRMLTP
                     KAVLRVAELLEHPEIARLNREAGFGDPASRKAPLGRWRRVASKWLAAREANLPMLQGL
                     VKAGYKETLKKLARKAGYKPRAQGFFEVLGWKQKQSAQGHREVGLNGLTLVKRERFDG
                     LSEAEICEWIDLERLSYKEVVGRLPKDVGLTPAIMVALLPSLSDRDLRLMTPTLEDLG
                     LLTDPAIRARWEKAVQTATDQRALNIAKNVRGEALRARLEEASDNAARQAVAEATAET
                     DVRVMFLVDKSGSMEGAIESSKEALSRILAGFPMDKLHIAAFDTLGTVLRPKAASRIA
                     VQHMLAGLRASGGTAHASAVYALHRAGVQVPEGAKLVVIVVGDEAGEAGDQFARAFRD
                     LRIPVSAMALLVSVAHARGSTVRTCAAQLGVPFSEVDVAQFEDPYQVPRVLKALLDAP
                     TLPGARQSGWVERVLRTPLLKVA"
     gene            293434..294402
                     /locus_tag="LILAB_RS01175"
                     /old_locus_tag="LILAB_01240"
     CDS             293434..294402
                     /locus_tag="LILAB_RS01175"
                     /old_locus_tag="LILAB_01240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935354.1"
                     /db_xref="GI:503701278"
                     /translation="MDYRKFLGKVESRVLPYFGGGTVDSASRRLRVTTPVKPGWWRFD
                     VKGRDATPREPSEPEGLEVLPRVRGHVWGRRLVREGAVAEPLALMPEEEPPRLAPVSA
                     RRWVDGALLFESVDFESEAEGAARLALEEDQPLSGIRGVSASLRAAFGYALLAQVSRD
                     VGIRFVPAEVRGRILAVAEGGRVPAEDCLRRLSLEREAHASRLRQAQAHAERRALSAR
                     LVAEAQRRTGHLGASEDGMQRAQQALLNAGARPLGLRRLADQRLEVTYAFMGERFVSI
                     VAADSLQVLDAGICLAGADGEVTLESLPSVIREAIETEVLVVTRYA"
     gene            294395..294784
                     /locus_tag="LILAB_RS01180"
                     /old_locus_tag="LILAB_01245"
     CDS             294395..294784
                     /locus_tag="LILAB_RS01180"
                     /old_locus_tag="LILAB_01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708970.1"
                     /db_xref="GI:760025835"
                     /translation="MPEERAMPTREVCLLISGDGEVLWCDASDSPLQLPDSRARWEAI
                     WRLRDVLEEVAHSHPEGPLGFSAEDESTMAALTSALGKPLRFSVVAPEGMVARRQGRD
                     VLVADEPWWAEALRGASGIRHTPGGLA"
     gene            complement(294789..295361)
                     /locus_tag="LILAB_RS01185"
                     /old_locus_tag="LILAB_01250"
     CDS             complement(294789..295361)
                     /locus_tag="LILAB_RS01185"
                     /old_locus_tag="LILAB_01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712256.1"
                     /db_xref="GI:760029205"
                     /translation="MLLPDGVGTVRRTRHFMKEGQPMPNDREQGKGAPQGSERQTSRR
                     DTPIEVRRRLRHESRTSQTYAAFIKHLCERGGMSPAVAEKAAVAVLCALEQRILSEEA
                     SDLEDQLPRKLTLLLHRCEKHEDELPPKFHREHLLRRVGEDLSLQPDAVEPVVRAVMD
                     AVRDQITEGEAEDVMGQLPPDIRDLWTRTV"
     gene            complement(<295392..297748)
                     /locus_tag="LILAB_RS01190"
                     /old_locus_tag="LILAB_01255"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(297945..298646)
                     /locus_tag="LILAB_RS01195"
                     /old_locus_tag="LILAB_01260"
     CDS             complement(297945..298646)
                     /locus_tag="LILAB_RS01195"
                     /old_locus_tag="LILAB_01260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_013935358.1"
                     /db_xref="GI:503701282"
                     /translation="MELQPEVSRWDVTPSEAVALQRRLREQLVLRPPPGLKVERVAGA
                     DISTEKGKDTGFGGLVVLDVATLAPVARSGAAVTLHFPYVPGLLSFRELPIIAAAWER
                     LTVRPDVVIFDGQGTAHPRRMGIACHGGLLFGVPSIGCAKSLLVGTHGPLGETRGATA
                     PLLHRGEVVGMAVRTRKGVQPVYVSPGHLMDLPTAVDLVLKVSPKYREPETTRHAHRL
                     VNALRRADGEAAELE"
     gene            298963..300270
                     /locus_tag="LILAB_RS01200"
                     /old_locus_tag="LILAB_01265"
     CDS             298963..300270
                     /locus_tag="LILAB_RS01200"
                     /old_locus_tag="LILAB_01265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_013935359.1"
                     /db_xref="GI:503701283"
                     /translation="MNRHTLKLFVSVGMMLLMGACASRQVPCKDRTVSRPTVGQKRAG
                     KFIAVKKKIPGEYIVVLKSPAQSLEQVQVQQATANLTTAYGGTAFAMYENALRGFAAK
                     MTEAQARAMADDPAVDYVQENGVVKIAESQQGPTWGIDRMDQRKLPLDKLYTFTATGQ
                     GVHIYILDTGVRFSHREFGGRASVGFDAIGDSMRGNDCNGHGTHVAGTAAGASYGLAR
                     NAIVHSVRVLGCDGSGATSGVIAGVDWVTRNHVSPAVANMSLGSDVDPALDDAVRRSI
                     AAGVTYVVAAGNEDNDACKHSPARTPEAITVAATDNKDKRATFSNWGDCVDVFAPGNK
                     IKSSWHYGDKESRELSGTSMATPHVTGLAALFLEANPTAKPEAVASAVNANATPDTVS
                     NPGWCSPNLMAYSGFITAIPGLPVVQLKDYLPKPAVVSSSEPR"
     gene            complement(300296..303928)
                     /locus_tag="LILAB_RS01205"
                     /old_locus_tag="LILAB_01270"
     CDS             complement(300296..303928)
                     /locus_tag="LILAB_RS01205"
                     /old_locus_tag="LILAB_01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015244071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="WP_013935360.1"
                     /db_xref="GI:503701284"
                     /translation="MRTAPEASAKVLSSRRRTEEEEVLGDFSIDVDLEPEAPAPPRRV
                     RPAPAPRAARAPGLAGRLRDRWSAWVPEESTSGARIAAVFLLVNAALTVAGHFLYPHS
                     RVVDVSGWVSSAVDVALAVGLLVGARRAHSLMLVRLFLGLLLMLGTAAFAAPSVVVLQ
                     AGGMLGLLLLLVGAPGARRQTAGALVSGATCLILVVLLSSRFTQTSPLDGWVLRLDGA
                     LEPGAVTDVQGLDADYTLTFPATGWRQARPEHVAKMSPGFDRVWLLPARGAVVSTRVL
                     HVPGAGGVDLDEAAEKMLESRPDAEEGAEDTEVVATEPIDGTFDAARRYHLRLRKDGQ
                     PMEAHAAVVVQGDYAFFIDAVAPRHRFASLDQELADIVASFAFQVVTPRLEAGVLDKV
                     RQAAVQVLSGEASGSGFVIHSENERTLVITNDHVIREKGEVPRFVKVVMMTRSGRREV
                     FDAIVAASDEEQDLALLSLTEAFGTWPALDFRHTAKLPPRSPLFVVGFPFGGSLAVRG
                     TYPEVSLNAGWMASRTPAPLLEKGLRVVDVGINPGNSGGAVVDASGRVLGVAVAHVQG
                     SATSVVISTETVSDWLRRAKDFTLTFDDRELDVAEASQHALHAEGEARARAATVLVRS
                     AQGSTAGVIVGRKGEHHLLVIASLDALGEAWRPGTALPEMTVRFRPAQPESVDRKAEV
                     LRASAEAGMVLLSVVGRPDDAEPLEPASASKHDSGTPVRVLGYRLGEDGKLLRKNPSA
                     QAAAGAVASVQRDSNQQVRFLHVDVGVNYGQTTGPVLDAQGALVGLAVARVKNTNVSL
                     VLPGENLVGLLRGGIRSGGWKLFRDRDGRCALSVLAVLDNPLGVSQTVQVRMSREPVY
                     GEPSGPAGVKPLGEALIAADAGHRSQLELTAEVDCAAVAPSVQLGLVDSQGSRYTAPG
                     RGEHRSGGMLMGLVAGTSGAGDEADDMVEFFLSPVPAPGAWGQECAEGDAVLCRQQCD
                     VAQSRPCLRLGRLHLEASRHAEALAAFTRSCSLGNLNGCIELGLASQSMGSRRGSIAW
                     PDESEERLRKVCQASSQHPDSRRACWALRPESYDTALSSAVRLCASSRVQCTELGHLY
                     LAGSWNPQRFGTSAAKAFSMGCETGDAQACLSLARLQLEGVGVPRNIRVAMNTFEKHC
                     QQGRYLGCEDLARMHATGLGVPKNLAESRRLMREICRTGVSRSPHCEFVRHQARNERL
                     GTARRE"
     gene            304478..304726
                     /locus_tag="LILAB_RS01210"
                     /old_locus_tag="LILAB_01275"
     CDS             304478..304726
                     /locus_tag="LILAB_RS01210"
                     /old_locus_tag="LILAB_01275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935361.1"
                     /db_xref="GI:503701285"
                     /translation="MATLNITYDGMSADVPVELDGPVPDADIRRIATELVRSGGVPGL
                     HLSQLRDDAFAHFVVDRLRGARGVERIYLRPKVPFGAR"
     gene            304736..305305
                     /locus_tag="LILAB_RS01215"
                     /old_locus_tag="LILAB_01280"
     CDS             304736..305305
                     /locus_tag="LILAB_RS01215"
                     /old_locus_tag="LILAB_01280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiF"
                     /protein_id="WP_013935362.1"
                     /db_xref="GI:503701286"
                     /translation="MRILFCGVGAIGSLAAVLCRNLEATLVFVDFDRVESKNLLSQAY
                     VKPSVGRNKAEALKLQFLNLHGVKAEAHGVRLTRDNAEALCGGADLLVDCMDNHHSRQ
                     VLIDYARQAGKPLVHGAVSADGTFGLVRWDDRFVPDAEDAPGQATCEGGAHLPLLGLL
                     AATLARAIQDFVKQGTRRDSLVNLSAVVS"
     gene            complement(305323..305916)
                     /locus_tag="LILAB_RS01220"
                     /old_locus_tag="LILAB_01285"
     CDS             complement(305323..305916)
                     /locus_tag="LILAB_RS01220"
                     /old_locus_tag="LILAB_01285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonic semialdehyde reductase"
                     /protein_id="WP_013935363.1"
                     /db_xref="GI:503701287"
                     /translation="MSEARSEELALLFREARTHNAWLDRPVDDALLARVYELARMGPT
                     SANAHPMRLVFVKSADAKAKLLPAVLPLNFDKVRTAPVTAIVAYDSAFYEFMPQLFPA
                     RPEMRDVMAGYPAEGRAKLAEQSAFLGAGYVILAARALGLDVGPLGGFDPAGVDAAFF
                     PDGKWRSVLLLNLGYGDSSQLHPRNPRLSFGQACRVA"
     gene            306018..307037
                     /locus_tag="LILAB_RS01225"
                     /old_locus_tag="LILAB_01290"
     CDS             306018..307037
                     /locus_tag="LILAB_RS01225"
                     /old_locus_tag="LILAB_01290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_043708971.1"
                     /db_xref="GI:760025836"
                     /translation="MPPRPNKVSSRPVELDLEDPRGDALADVLGVSLLRNALYKRIEA
                     RAPWGIRLRTHERAVFYLIARGAGRLEVEGERPLDLSVGDAAFLPHGTGHVLRDALTT
                     PPLDAHDGRRCTEPGPRKLGGSGAPTSILTGFFDLGGRPPSLLASLPRVVALSPNDRA
                     TVPWVSATLQLLLAEAAHPGPASMLVLQRLADVLFVQALRSLATTGGTSGHVCRHPGI
                     AALGDDAIREALGLIHQRPGAPWTVASLGTQVGLSRSTFAARFTELVGEPPLEYIARW
                     RMTRAAEFLRDTDLAIDDIAARVGYESVPSFSRAFVRFRGERPGAYRRSARERARLDA
                     EPTPG"
     gene            307417..307491
                     /locus_tag="LILAB_RS01230"
                     /old_locus_tag="LILAB_t36737"
     tRNA            307417..307491
                     /locus_tag="LILAB_RS01230"
                     /old_locus_tag="LILAB_t36737"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:307452..307454,aa:Pro,seq:cgg)
     gene            307498..307571
                     /locus_tag="LILAB_RS01235"
                     /old_locus_tag="LILAB_t36739"
     tRNA            307498..307571
                     /locus_tag="LILAB_RS01235"
                     /old_locus_tag="LILAB_t36739"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:307530..307532,aa:Lys,seq:ctt)
     gene            307575..307647
                     /locus_tag="LILAB_RS01240"
                     /old_locus_tag="LILAB_t36741"
     tRNA            307575..307647
                     /locus_tag="LILAB_RS01240"
                     /old_locus_tag="LILAB_t36741"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:307608..307610,aa:Asn,seq:gtt)
     gene            complement(<308370..308522)
                     /locus_tag="LILAB_RS01245"
     CDS             complement(<308370..308522)
                     /locus_tag="LILAB_RS01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013940738.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043712258.1"
                     /db_xref="GI:760029207"
                     /translation="MRPARSPAELGLTAYDRRKLERALRQSRDARHFRRLLAIKLIAE
                     GKAPGEA"
     gene            complement(308676..309071)
                     /locus_tag="LILAB_RS01250"
                     /old_locus_tag="LILAB_01300"
     CDS             complement(308676..309071)
                     /locus_tag="LILAB_RS01250"
                     /old_locus_tag="LILAB_01300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011985390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013935366.1"
                     /db_xref="GI:503701290"
                     /translation="MDDTEFESPAHEEVQADLRALFRGAIRMTLEALLEEAVRELVGA
                     GRWQRMVGRADVRNGSYLRTLVTTAGAVDVTVPRTRHSGSAGEVLGRYKRRSAELDEA
                     ITSAYVQGVSTRKMGKVTRALMGVDAHVC"
     gene            309552..309637
                     /locus_tag="LILAB_RS01255"
                     /old_locus_tag="LILAB_t36743"
     tRNA            309552..309637
                     /locus_tag="LILAB_RS01255"
                     /old_locus_tag="LILAB_t36743"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:309587..309589,aa:Tyr,seq:gta)
     gene            309882..309954
                     /locus_tag="LILAB_RS01260"
                     /old_locus_tag="LILAB_t36745"
     tRNA            309882..309954
                     /locus_tag="LILAB_RS01260"
                     /old_locus_tag="LILAB_t36745"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:309916..309918,aa:Phe,seq:gaa)
     gene            310065..310135
                     /locus_tag="LILAB_RS01265"
                     /old_locus_tag="LILAB_t36747"
     tRNA            310065..310135
                     /locus_tag="LILAB_RS01265"
                     /old_locus_tag="LILAB_t36747"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:310097..310099,aa:Ala,seq:tgc)
     gene            310160..310702
                     /locus_tag="LILAB_RS01270"
                     /old_locus_tag="LILAB_01305"
     CDS             310160..310702
                     /locus_tag="LILAB_RS01270"
                     /old_locus_tag="LILAB_01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_013935367.1"
                     /db_xref="GI:503701291"
                     /translation="METLVLSQSFEPVARVPWQRAVMLIFQGKVEVVEEYEDRVVRSV
                     TVEIRMPSVIRFIRGLRRRPKGVKFSRENVYLRDSCRCQYCGTRVTRPEATHDHVLPR
                     AQGGKTSWENIVIACVPCNQKKGNRTPEQARMALRTAPTKPKKVPEAMHLTFLFEKGM
                     PMSWAKFLRDVAYWHVELQE"
     gene            310952..313774
                     /locus_tag="LILAB_RS01275"
                     /old_locus_tag="LILAB_01310"
     CDS             310952..313774
                     /locus_tag="LILAB_RS01275"
                     /old_locus_tag="LILAB_01310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013935368.1"
                     /db_xref="GI:503701292"
                     /translation="MATRKSEDQERLIDRDLTALAREGKLPAAHGVDAAVTEVLGLLT
                     RGGKHPLLSGEAGVGKSALVQEVARRIAEGRVDAGLANARVVEVSVANILARSTQRQA
                     AESFEELLTYLSRHPRPIVYIRDLPAALGGPLAPVAVRGLRTVGLRFIFETEPKRVQE
                     LLRSDEALAERLHLLPLHEPPPEKARWVLGRVAEELERELRLPIDPAACDLALRLSSK
                     FLLAQRMPRKAIELLKETAAEAASAAKDHVGPEDVLSRFCAATRLPRFVVDDAMPLDL
                     EETERFFGERLLGQTDAVSAVLRSVALLKAGLNDPRRPLGVFLFAGPTGVGKTQLAKL
                     LAEYLFGSADRLVRLNMADYPNDGDESVPFGATWAPALETRRGELSALLDGKVFTVLL
                     LDEFEKAARSVHDRFLQLFDEGTFVNGAGETVSCNNTLIVATSNVGAEVYRESGMGFT
                     GARRAEEMVPEVDRRIGEAFRPEFLNRFDAICHFRPLSKVDIRKIAQREVGRVLEREG
                     IRARALDVEVTPAVVDLLVERGYSPQFGARYLQREIEKTLTAALAVEIARKPLPPGTP
                     VRVEARPGGRVTAVAEPAAPPPSPTAQILLPSARAAPVKRRLDRKSLLFEMDRLVGKA
                     RALADSTGRPQLEQRRAELLAETQAPNLWDDPTRAAEVLRAFRAVEAQINELERLEAA
                     VLFARRLVREAKNEVQLGSAAKQVEDVAREVQMSAALHASGATTQDTEALVDICASDS
                     AEAQETWVQELATMYLGWAQRRGYEAVAVAEAEEPSRVVVRIAGPGAYGFLAGEAGMH
                     RRLEDEKRQRAYVRVHRGGTLSEEELAYLEVQGRPMKSHEGAYLQRVRTEVTVKDESS
                     GRVLTLAGATELDELKDIAARVVYGQGSHTDEARRYYLGRGARVEDPRTGAGTPRVKD
                     VLRGELDVFIAAWISRPPTDSQPPGN"
     gene            complement(313790..314362)
                     /locus_tag="LILAB_RS01280"
                     /old_locus_tag="LILAB_01315"
     CDS             complement(313790..314362)
                     /locus_tag="LILAB_RS01280"
                     /old_locus_tag="LILAB_01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708973.1"
                     /db_xref="GI:760025838"
                     /translation="MKKVATLACLLALLGAIPAHAAGLEDVFGREVPVGKGRPTLVLY
                     ANKGSRDELRQHAYSFIYDLREERPIVLIHVDLRDVPGLFKGMARGEIKKSHRESIEH
                     MRNIFRQHGEAPPPELESSLYMVADAKGEPHQAMGLKKGFGQVVARVLGPSGQEVARG
                     PFPESARKLGQSMASAPERLSTLRVVDMSR"
     gene            314595..315791
                     /locus_tag="LILAB_RS01285"
                     /old_locus_tag="LILAB_01320"
     CDS             314595..315791
                     /locus_tag="LILAB_RS01285"
                     /old_locus_tag="LILAB_01320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_013935370.1"
                     /db_xref="GI:503701294"
                     /translation="MYRRLITLLFLSLAAPAFAAKPFTEGMVTITLDDGWATQYSLAR
                     PELNARNVPATYGLVTLAIHESWAGYINLTQAQTLVTEGNDIASHTLTHPDLTALSPA
                     QLLAELQDSRTWLENALGLPAVPNLIVPYGLQNGPVLDAIRQHYASSRTVNAGRNFRD
                     TVVYELRANDVARTVPVSTVQGWVDQAIAEKSWLILVFHEFTNGTPTRDTEYLTSQFA
                     DILDYVQTQGVRTVTLSEGLALTEGRTEPDLTAGLFVYNDALQNGFADWSWADHSLDE
                     TGVVHTGSASIRFEPDTWNGLLFHHHGLDLADHQSLRVWVHGGTVGGQAVRLVLHDGA
                     QLLGTIRLDTALGGPIAPGVWQQVSIPLASIGATTGTLRDIYFQDDSGTDQPVMYLDD
                     LVLLPH"
     gene            complement(315805..316707)
                     /locus_tag="LILAB_RS01290"
                     /old_locus_tag="LILAB_01325"
     CDS             complement(315805..316707)
                     /locus_tag="LILAB_RS01290"
                     /old_locus_tag="LILAB_01325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_043708976.1"
                     /db_xref="GI:760025841"
                     /translation="MSHTSPSLELARPPLLARELLRAAVARRPARPGEVPRLDVRVRG
                     FTPDAGQLARYREVCGFPEDGYLPLPFPQVLATSLHLTLLNHPDFPYRLLGMVHVRNH
                     IQQQRRLRAGARLSVHAWVEGQREARQGRELDLHTEVEEDGALVWSAVTTMLRRLPGM
                     GERPREAGRPPATDEAQVFAASRPASWSVPENAGRRYARASGDYNPIHLYGFTARPFG
                     FPRAIVHGMWTVGRCVAEMGEAAEAPALTLRSEFRRPLLLPSRVVFQTAPQPEGAVAY
                     RVMSEDGQPHLLGRLSPEGGPRAR"
     gene            316965..320309
                     /locus_tag="LILAB_RS01295"
                     /old_locus_tag="LILAB_01330"
     CDS             316965..320309
                     /locus_tag="LILAB_RS01295"
                     /old_locus_tag="LILAB_01330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_013935372.1"
                     /db_xref="GI:503701296"
                     /translation="MLARVTPPGAAAQRTAAARDIVTDTATSAGGPPEDDTLPTELIR
                     VGNGPALRQPPAPMNKAGERTPRHAVRRTGLAAHLDAPPPEGSGALAAPPAPAAPGFS
                     AAPSALPAPSGLAAPPAPPPPTSVAVPPPTPPQDLSGRILPAAHEGAPSPGVSGKNFA
                     GAHVLPHGGRLLSAAAEARGSRATLSIPMAPMPAKAPPASGGLGKAGRSPARKDAEDT
                     EPRDSGQVRVGRYHILDTLGAGGMGAVYSAYDPELHRRVAIKLLHPDANPAARSDGAS
                     RLLREAQAMARLSHPNVVSVYDAGTFAGRVFIAMERVDGLSLRHWLRAEHRTWREVLD
                     IFRQAGRGLAAAHAAGLVHRDFKPANVLVSKEGRAQVTDFGLARTTADLDAAEAGRGT
                     TPALPRVAPEDLLQTALTEAGLVMGTPAYMPPEQHEDGRIDARGDQFSFCASLYEALY
                     GQLPFNGKRPDEYLEEARSGRVRPPPRGSRVPAWVLRAVTRGLSPVPEARFPSMGVLL
                     EALGADPLAAWRRRGTVAAASLLLNSVVAVTWLLVGSQRGGPCPDPEARLAGVWDAAR
                     RAEIQQAFAATGKVHASAAFERVATTLDGFANEWTRMHREACEATRVLGHQSDHELAL
                     RMACLDRRHSALVALTGVLAQTDAAALAAAPDAAQRLPPVAACADVDALWLGLSEPAG
                     QRQQVEALRARVDRATALVDAGRYPQAQEEAKAVLAEARQLGYGPVLAEALELEGRLG
                     LVTGDDARAAAALRESLFTAQAHRHDQLAARAAARLVTTVSAEPTLESWTVDQARASI
                     QRAGGASELEALLQTSLGRNAFLRGQYTQAAEAFGRSAALREKELGPEHLLTLESLRN
                     QAAALSRTPETEHAMALLRRVLETTERVLGPDHPQTAMAANAMGYHLVIVRRFEEAIP
                     YLQRAIRLEEQSLGRDSATLSYPLNNLAEALEALGRHAESRPLRERALAVDLKAFGPE
                     HPETATDLALLGALALREGKARDAADYARRSIAAYEAFQKDHPDVAAPLTTLGQALHA
                     LGRSREARPLLERALALRTTHPGPAEDLASTRFALAQALVKQDGPRARGLATQALRFY
                     TAEEPVYATEASHVRDWLQDLRRRRR"
     gene            320380..322020
                     /locus_tag="LILAB_RS01300"
                     /old_locus_tag="LILAB_01335"
     CDS             320380..322020
                     /locus_tag="LILAB_RS01300"
                     /old_locus_tag="LILAB_01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase"
                     /protein_id="WP_013935373.1"
                     /db_xref="GI:503701297"
                     /translation="MLQVIPLGGLGEIGLNSMVIACRGELLLIDAGLMFPSSGMPGVD
                     IIIPDFSHLKQNAAQLKGVLLTHGHEDHLGALPYLLNEVPVPVYGTRFTLAMARHRLE
                     ELGIEADLREIEPREPFTVGTAFRVEASRVTHTVPDAVGFILRTPEGTLIHTGDFKLD
                     PDPIDGLRTDLERWGEAGEEGVLCLLSDSTNSEVTEETGSERVVEQTFERLFQGATGR
                     IIVALFSSNLHRVRHLLALAERLGRKVALQGRSMLRNVEMARALGYLDVPDSLFVHVD
                     TVPALPAQRVLVLTTGAQGEPRAGLSQLASGDGPVRLNPGDLVVLSSRPIPGNERSVG
                     ALIDALQWRGAKVAYAQVEPGIHVSGHASQPQQRRVLDLVRPAHFIPVHGEGRHLHKH
                     LLTAREAGLEPAQCLLAQDGDIITFEEGRGRFTGSVPSGRVLKDRFGPGRVTPDTLQE
                     RIRLSETGIVAAVVVLQRDSQKVVAGPQLSGQGLSLDEQVLLPRVAQDARVFFEELSP
                     VLRGDDALVREELTRAVRRAFKAHTAKRALVVPLVVRV"
     gene            322042..322539
                     /locus_tag="LILAB_RS01305"
                     /old_locus_tag="LILAB_01340"
     CDS             322042..322539
                     /locus_tag="LILAB_RS01305"
                     /old_locus_tag="LILAB_01340"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DC88.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935374.1"
                     /db_xref="GI:503701298"
                     /translation="MPSFDVVSKIDLAELDNAVNQTKKELSTRYDFQGTHADVVLAPD
                     HTAITVKANSEDRVQAAKEVLLAKLAKRNISLFALEYGDIEKTGLHNVKQTIKLQQGI
                     PVDKSKELVKLLKESKMKVQGSIQADQLRVTGKNRDDLQAAIALFRKEQDRLKLDMQF
                     TNFRD"
     gene            322536..323651
                     /locus_tag="LILAB_RS01310"
                     /old_locus_tag="LILAB_01345"
     CDS             322536..323651
                     /locus_tag="LILAB_RS01310"
                     /old_locus_tag="LILAB_01345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708979.1"
                     /db_xref="GI:760025844"
                     /translation="MKRPMRATALSFCLLFCAPGVASAQAERASKPVPSLSRPPRIQG
                     GLKAFASPLVLKPVVPEGATASFTAKVGARKDTLYVGVEATDDQLQAGDLLTLSLYFP
                     GTGPTSTGYTWRFAFDGKRASGADSGTPQFAQDLVTAAVQRQGNKLRMMASVPVRAFP
                     RFPAVDPLVMDLCLTYEDRDSADGKAASISNCQSGTMVGDALRLPDEPRKGLKLKPPE
                     SVSTLEPRQDGWLGWDYMSYPAWAQADGELTPSLLRGLVAPDAIIPSTADLNVPDTLS
                     LPDGGRVVTVVTGKNPYAVAGQCDADDELRLGIYLVDGKTARRVLEWPAATCALGRTS
                     SVELDEEGVLSIRYSNGTSMTFAWSGTHFSRTELGKR"
     gene            323657..325087
                     /locus_tag="LILAB_RS01315"
                     /old_locus_tag="LILAB_01350"
     CDS             323657..325087
                     /locus_tag="LILAB_RS01315"
                     /old_locus_tag="LILAB_01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S12 methylthiotransferase"
                     /protein_id="WP_013935376.1"
                     /db_xref="GI:503701300"
                     /translation="METTTPKSLYMMTLGCPKNRVDSEVMLGTLRHRGYTLVQEASDA
                     EVIVVNTCAFIGPAKQESVDSILEMAELKKSGACQTLVVTGCLSQRYGEELAKEMPEV
                     DHFLGTSAYAQIGDLLAAEASPRQVIPDPDYIHDANTPRINSMPKYTAYLKISEGCDN
                     ACAFCIIPTLRGGQRSRTIDDIVAEAKQLADSGVQELNLVAQDLTAYGHDLPGRPKLH
                     DLLKALVQVDVKWIRLHYAYPRIFPDELIDVMASEPKIARYLDMPVQHVSDKLLLSMK
                     RGRNSEFLKGLLTKLRERVPGLVMRTSLIVGLPGETEEDFEMLKEFVKTQRFERLGVF
                     QYSDEEGTAAYDLPDKVPQKTIERRWREVMAIQKRINREQNKKLVGKRLEVLVEGPAP
                     ETEHLLVGRHQGQAPDIDGMVYINDGLAYPGELVTVEVTEAHDYDLVARVVERPDPKQ
                     REHTARDAHPAPLPLSVMQRPAPRAE"
     gene            complement(325121..326110)
                     /locus_tag="LILAB_RS01320"
                     /old_locus_tag="LILAB_01355"
     CDS             complement(325121..326110)
                     /locus_tag="LILAB_RS01320"
                     /old_locus_tag="LILAB_01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935377.1"
                     /db_xref="GI:503701301"
                     /translation="MLRSPLAHMRPSPTEFDRQYTEQRRSIELARRYLEKEGVTRMYD
                     ALTKEVERGRLSVQDASGAIRFGLLALIERVAERVGHTRYVDMLKDEEMLAALRSLLD
                     DLCRRKGVDTFEFRQQWAHTNLQAVLRDWHLVVHEERGRQRYEVAADLARRLVAETPG
                     TVLAETLKLPTDAFVLLASPEAGLVGRGPDGAPAPITEIYVVESPAPEGKAWFLWLSM
                     RDAENRAARALINVYLQDGKTLDDAIAFTREQGGPQQDAGWEDCCRLLAGVARHLAEG
                     GPVREHWYDATARELHEKLAATPKSAKADREKLRERLRAVSPGRTRVLEEPSR"
     gene            complement(326133..327536)
                     /locus_tag="LILAB_RS01325"
                     /old_locus_tag="LILAB_01360"
     CDS             complement(326133..327536)
                     /locus_tag="LILAB_RS01325"
                     /old_locus_tag="LILAB_01360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712259.1"
                     /db_xref="GI:760029208"
                     /translation="MGLMGLAASGCHREPAAHAASPKGFLGQTLPLLASPALRLTVAG
                     RLGTRPVPVVLDVARPLSLVSKGCFDGELPAPEGTIRAPEPAGGFRSWPVVPLPAFSV
                     GPVRSPVRTAGLSGEKACAVTLGADVLEFYALTVDPLRREVTFTASRPRVDYAAEAAA
                     TEASREVHVVELDREPLGDWPLLAARMTQGGAELTGPFVLGSREPFSRVSARLAQARG
                     LQPLETVANLPPRTFALDAVEVAEGVGARPLVVEAAGRWDSPSSLGRLGPDVWGRFTA
                     TLDAKGGALVLRRPRVRHSEGATASHCAAPDGTFREEACYGLHVRREPDGSVSVSGAV
                     YRDLPEGGRLHLEPLGPDGQKLLSGCGVGLSFPATSRGLTTQHRLPWRSLAQALPACH
                     AALSTARDFTLGLFEEGRQPECPTACAFVTQAASRRTVCECQPTPLGEGVAMPARGAP
                     SREPPPEERELEPEDPR"
     gene            complement(327568..328302)
                     /locus_tag="LILAB_RS01330"
                     /old_locus_tag="LILAB_01365"
     CDS             complement(327568..328302)
                     /locus_tag="LILAB_RS01330"
                     /old_locus_tag="LILAB_01365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein LolA"
                     /protein_id="WP_013935379.1"
                     /db_xref="GI:503701303"
                     /translation="MFLEALLATLLSAPATPAAAQAKPPPAAQTAPAASAPAAPAAAK
                     PMTPEVKSLVDRMQDFYEKTGDFRAGFRQDYKYKTFRRTQTSEGTVTYKKPGLMRWEY
                     LKPSPRTFVLAGNKVYAYDPAAQSLTVANVDTSQLSASVTFLFGKGKLADEFNITKGT
                     CKDCKGTLLVLDPLKNEPRFRQVRLEVDPSTAQVLKSTVVDPDGSENAITFLDLKTNV
                     GIDTDSFKLDVPDDTRVDDFTKAKKQ"
     gene            complement(328377..329054)
                     /locus_tag="LILAB_RS01335"
                     /old_locus_tag="LILAB_01370"
     CDS             complement(328377..329054)
                     /locus_tag="LILAB_RS01335"
                     /old_locus_tag="LILAB_01370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N2)-dimethyltransferase"
                     /protein_id="WP_013935380.1"
                     /db_xref="GI:503701304"
                     /translation="MSGGGARYERYEREQFEPEQFLLDVRKEKIDRVVSHRTRNFTVV
                     LDRLEDSFNMAAVLRTCESMGVQEVHIVINPEAPFVPNSRVAQGCDKWLDVKLYKSFA
                     ECREHLKSRGFSLYASAIQDGATSLYTLRFDGKMALVFGNERHGVSDEVLAGVDGTFW
                     IPMKGFSQSLNISAAASACISRAIAWRDEHLGQSGDLSPEDAQALRERFYVLAIKQRK
                     RLFKKAP"
     gene            complement(<329086..>329580)
                     /locus_tag="LILAB_RS01340"
     CDS             complement(<329086..>329580)
                     /locus_tag="LILAB_RS01340"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DC95.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712261.1"
                     /db_xref="GI:760029210"
                     /translation="AVAAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAGGRAVAAAKKA
                     AAGKAGTKQGTSARNAGTAATKKGTSARKAGAAATKKGASARKAGAAAAKKGASARKA
                     AAKSSARKSGAVAAKKAAAVKSPARKSGASAAKKASARKSGSVGKAATKKPSASKSAT
                     KRAPA"
     gene            complement(<329473..>329931)
                     /locus_tag="LILAB_RS01345"
     CDS             complement(<329473..>329931)
                     /locus_tag="LILAB_RS01345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015914234.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712263.1"
                     /db_xref="GI:760029212"
                     /translation="LEEGASPGAPAPSRKQGTAAAKKAAAGRTGTAAAAKKASAGKAG
                     AAAAKKAVAGKAGTAAAKKAAGGRAVAAAKKAAAGKAGTAAAKKAAGGRAVAAAKKAA
                     GGRAVAAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAGGRAVAAAKKAAGGR"
     gene            complement(<330085..331098)
                     /locus_tag="LILAB_RS01350"
     CDS             complement(<330085..331098)
                     /locus_tag="LILAB_RS01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DC95.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase CgtA"
                     /protein_id="WP_043712266.1"
                     /db_xref="GI:760029215"
                     /translation="MKFVDEVRIFVKAGDGGNGAVSFRREKYIERGGPNGGDGGNGGS
                     VVFVADPQLTTLLDYRYQQHHRAKNGEHGMGSDCNGRAADDMVLKVPVGTLVKDANTE
                     ELLVDLSEAGQRWVAAKGGRGGLGNMNFATSTRQTPRFAQDGTKGEEITLRLELKLLA
                     DVGLLGFPNAGKSTFISRVSRARPKIADYPFTTLVPNLGMVQYKDGLSFVMADIPGII
                     EGASEGVGLGHQFLRHVERCKVLIHLIDMGAEGEGRAPLQDFDVLNAELEKYSPELAS
                     KPQVVAANKLDLPDAQARLEDFTEALRERGIRVYPVSCATGEGMQPLMDSVAEVLFTG
                     RTEK"
     gene            complement(331225..331500)
                     /locus_tag="LILAB_RS01355"
     CDS             complement(331225..331500)
                     /locus_tag="LILAB_RS01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014394223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_043708982.1"
                     /db_xref="GI:760025847"
                     /translation="MAHKKGQGSSRNGRDSNPQYRGVKVYGGETVSAGSILVRQLGTV
                     IHAGANVKLGRDFTLYSVVDGVVKYERLGRDRKKVSVYPAAAEQASA"
     gene            complement(331540..331848)
                     /locus_tag="LILAB_RS01360"
                     /old_locus_tag="LILAB_01385"
     CDS             complement(331540..331848)
                     /locus_tag="LILAB_RS01360"
                     /old_locus_tag="LILAB_01385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_013935383.1"
                     /db_xref="GI:503701307"
                     /translation="MYAVIRTGGKQYRVAEGDVVRIEKIAGDVGAEVTFTEILMLGGS
                     DSPKVGQPTVAGAKVVGKVLAQDKHRRVLHFRKEKEGWTRRRGHRQPYTEVKVTSIAG
                     "
     gene            332106..332486
                     /locus_tag="LILAB_RS01365"
                     /old_locus_tag="LILAB_01390"
     CDS             332106..332486
                     /locus_tag="LILAB_RS01365"
                     /old_locus_tag="LILAB_01390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="WP_013935384.1"
                     /db_xref="GI:503701308"
                     /translation="MKKLLIGLVASSALVFGTGCGDSTEPEDVCERFFSAMIDIDQKA
                     CGEVSEGPTDQERNEAIQQCSTQIERCTEDDREKMNRIADCINDIDDCREGREDEFAG
                     AFLACLIQEGSFSESCNISADIED"
     gene            complement(332514..334454)
                     /locus_tag="LILAB_RS01370"
                     /old_locus_tag="LILAB_01395"
     CDS             complement(332514..334454)
                     /locus_tag="LILAB_RS01370"
                     /old_locus_tag="LILAB_01395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_043708984.1"
                     /db_xref="GI:760025849"
                     /translation="MEAQDPLVGTRCGSFRLTRRLGRGGMGSVYLGEHVSIGSRVAVK
                     VLHAHLTMYPELVQRFHAEARAVNLIGHENIVSIFDMDAAPPRPYLIMELLDGSPLSA
                     WVGTPLAAGAVVSVLSQVCDALQAAHARGIVHRDLKPDNIFLVRRKRSAPFVKVLDFG
                     IAKLADAHMPQTHAGIIVGTPEYMAPEQSLGRGVDGRADLYALGVIAYQLLTGRLPFN
                     DEGLTAQLVAHQLRPPPPPSSVYPAVSAALEHVILRALAKKPEDRYPSIAAFRDALQV
                     ALVEHQRVSARKTRPGGHPVLEQAPVASMARVQARLPSGSRAGPLPSLLAGAPLRRPS
                     SAAPTASPRASNVEVPVQVVLRPGESPVRLRGSGLSRGGLFLHGGRFLPPLCARLPVV
                     LELASGPLSVMCEVVRLVPPAQARVWGMPTGFGVQFVEATAVLKAAVDALLQGDPVRE
                     APSAPSAEDPAVARLLEAWRQRSAGDAYAVLALDQDSDMVTVRLRTREAWRSLESLEQ
                     HPLTPPQRAQVDALRVRVREAAEALGATAHRALYDAWRGNHRGVAKCLEAGLTAEQLE
                     SLRREFLARRPQAMGSARIHFQSGGALEREGRLSQALEQYERGLRLAPLEVDMLQRYR
                     RLRRVLGGRSPVMTTHGRARTP"
     gene            334761..335723
                     /locus_tag="LILAB_RS01375"
                     /old_locus_tag="LILAB_01400"
     CDS             334761..335723
                     /locus_tag="LILAB_RS01375"
                     /old_locus_tag="LILAB_01400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020480675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="WP_013935386.1"
                     /db_xref="GI:503701310"
                     /translation="MSPSPRRIPIVNLSHYRTGAPQERARFVQVFGDGIKEFGFVTVE
                     GHGIDDGLIRRTYTDVERFFSLPEATKAQYAQAAHGGQRGYIGYGQEHAKNRQVGDLK
                     EFWHVGRELPPEHRYRERYGPNVWPTEVPTFREHTLSLFNALDGAAGVMLQALAEYFG
                     VARDTFSGMATDGNSVLRLIHYPPLKERFIPGGVRAAEHEDINLITLLCEGTAGGLEL
                     LTRDGEWLPVDTLRGQIVVDSGDMLSRVTNEIIPATTHRVVNPRGKEEDTVRYSMPFF
                     VHPYADCVLQALPCTQTADSPARHAPITADAFLKQRLRENGLLK"
     gene            335730..336785
                     /locus_tag="LILAB_RS01380"
                     /old_locus_tag="LILAB_01405"
     CDS             335730..336785
                     /locus_tag="LILAB_RS01380"
                     /old_locus_tag="LILAB_01405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935387.1"
                     /db_xref="GI:503701311"
                     /translation="MAPSADTVELFALQPRVSLEDYASPSAFAARHRALAAKVDALRS
                     RDAEGRPRHPALAVWPEWVGAPLLFTGHVALVRRATSVQGALKRVALAEPWDTWNAWS
                     AFHPPSLLECVYAARAPRVHRALWETFSGIARDFGLWVVAGSALLPASQRGQDTPDFR
                     PYGARTYNTSYTFSPEGRCVAAVRKANLVPTREDALHLSPGRPEDLALLQTPFGRLGT
                     LIGYDGFLKPHTSQEPWFVPCAQYLDALGADVLAQPSANPWPWEAPSPFNASQRRGEQ
                     WREEGLQAQLRMLKRVRYVVSAQLVGSVLGTPFEAPSSILERTDAGEVRVLAEAPSRS
                     EEDVVHATVPTAARGTP"
     gene            complement(336782..338221)
                     /locus_tag="LILAB_RS01385"
                     /old_locus_tag="LILAB_01410"
     CDS             complement(336782..338221)
                     /locus_tag="LILAB_RS01385"
                     /old_locus_tag="LILAB_01410"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DCA2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit B"
                     /protein_id="WP_013935388.1"
                     /db_xref="GI:503701312"
                     /translation="MPVSDFQPVIGLEVHAQLLTQSKIFCGCSTAFGAEPNRNTCPVC
                     LGMPGVLPVLNQRVAEFAVRTGLALECTIRPTSVWSRKNYFYPDLPKGYQITQYDQPI
                     CEHGRLVIDTPRGEKTIRVLRIHMEEDAGKSVHDAGGGQSLVDLNRAGVPLLEIVSQP
                     DLRDADEAVEYLKAMRDVLVYLGVNDGNLEEGSFRCDANVSVMPKGSTTFGQRCELKN
                     LNSFRFLKQAIEYEIARQVDVIESGGKVVQETRLWDVSKGVTRSMRSKEEAHDYRYFP
                     EPDLPPLHVSAEAIDAAAQALPELPRAKLQRFTSQYGLPAYDARILTADRPLADYFEA
                     CAGHYKDYKKLSNWFLGELMRLLKEEGTPLSALRFTPAQLGELLGAVDQGTVSANAGK
                     DVLGEMFRTGKAPADIIAEKGLAQVSDTGAIEAVVDDILAKNAGEIEKYRAGKKQVFG
                     FFVGQVMRAMKGKGNPALVNELLKKKLGD"
     gene            complement(338254..339714)
                     /locus_tag="LILAB_RS01390"
                     /old_locus_tag="LILAB_01415"
     CDS             complement(338254..339714)
                     /locus_tag="LILAB_RS01390"
                     /old_locus_tag="LILAB_01415"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase"
                     /protein_id="WP_013935389.1"
                     /db_xref="GI:503701313"
                     /translation="MQLTDLTMLELAAKLAAGEVSSEEATRASLARIQQVDAKVRAFL
                     RVDEAGALAAARASDARRKAGSPASALDGVPLGLKDLFLTEGVETTAGSRILEGFVPP
                     YDATVVRLLKEAGLPLVGKLNLDEFAMGSSNESSAFFPSHNPWDVSRTPGGSSGGSAA
                     AVAAREVFGALGTDTGGSIRQPAALTNTVGLKPTYGRVSRFGVIAFASSLDQPGPMTR
                     TVADAAALLQVIARPDARDATSADAPVPDYSADLEAGVRGLKLGVPREYFTEGMDPEV
                     EAAVREALREYERLGATLVDVSLPHTKYALATYYLIAPAEASSNLARYDGVRFGLRAK
                     DARSLRDVYALTREQGFGAEVKRRIMLGTYALSSGYYDAYYLRAQKVRTLIREDFTRA
                     FAQVDALLSPTSPVPAFKLGEKVEDPLSMYLMDIYTLPCNLAGLPGLSVPCGFTKAGL
                     PVGLQILGRPFDEAGLLRIARAYEREHDFFRRAAPL"
     gene            complement(339733..340020)
                     /locus_tag="LILAB_RS01395"
                     /old_locus_tag="LILAB_01420"
     CDS             complement(339733..340020)
                     /locus_tag="LILAB_RS01395"
                     /old_locus_tag="LILAB_01420"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DCA4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     C"
                     /protein_id="WP_013935390.1"
                     /db_xref="GI:503701314"
                     /translation="MALTLEQVRHVATLARLSLTPEEEQRFTTQLSAVLDAVEQLQAL
                     DVEAVEPTSHATLMSSRLREDVTRPSLPPEKSLANAPAKSDTSFAVPKIIE"
     gene            complement(340027..340362)
                     /locus_tag="LILAB_RS01400"
                     /old_locus_tag="LILAB_01425"
     CDS             complement(340027..340362)
                     /locus_tag="LILAB_RS01400"
                     /old_locus_tag="LILAB_01425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935391.1"
                     /db_xref="GI:503701315"
                     /translation="MADARTDKPSSTEEEYFAREEIEKKRKLALEQAAANAAQQREEL
                     KKLHWMKCPKCGMDLQTLKQGNVEIETCFNCHGVFLDAGELDQLVAQHGHEGSGKVMG
                     AILNLFKKK"
     gene            340442..343633
                     /locus_tag="LILAB_RS01405"
                     /old_locus_tag="LILAB_01430"
     CDS             340442..343633
                     /locus_tag="LILAB_RS01405"
                     /old_locus_tag="LILAB_01430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_043708986.1"
                     /db_xref="GI:760025851"
                     /translation="MGGAQPKCRSPVRGWKIDRSPSLPTLAAGIATARYAAETRRGKT
                     DMTAKKGRAEKAVLSRQEIATRRRALADKRMKAGKGGDVATRAITGVFLLAASLIALL
                     AVATFDAKDRVGPGFNNAVGPMGHLIAESLRGLLGVCAYLIPVGGIYTAMVLFVGSRD
                     RKRGPQIISLALLTVSVSVLAQLMFAGDKGWDHPPGGALGASLGGIMSGLFSTVGTVI
                     LVTAISAAALIVGTQYTFLKVCSLAWAGMCVLGRRFQESFNTFWEAQKVAYQERQERA
                     AQEKLEEAAFLAQLEADEEELAEAERLAEEAEAAEAEAMAEEAFRLAKQQEKEQAAAA
                     KLALKESREREKAEKKLLPPAREADSLPPAPAPVLALPEKAPAKVEKRPGISADPAWA
                     ASFLPPSPNLVPADGAESSEPPRSRRKPNIVTGPAPAPVAEEETPEPVAPVSTAPVAP
                     VAPAPAPAAPADIVPAKPAALARMPLIVEPKAPPKPTAKKSQDQFEFVGDRKSFSLPP
                     LDVLECDKKERSALDQDAYLATAEKLRAKLADFGIVGEVVEIRPGPVVTMYEFLPGPG
                     IKVSKIAALADDLAMAMEAMRVRIVAPIPGKGVVGIEVPNKDRETVYLKEIAEQDAFN
                     KGASKLTMCVGKDIEGMPYVLDLAKAPHLLIAGTTGSGKSVAVNSMIMSILLKATPEE
                     VRFIMVDPKMLELSVYEGIPHLLLPVVTDPKKAALALRWAVEEMERRYQMLSEAGVRN
                     IAGFNKLVESTAVEVKTTESAPKKKAKPKNVLVLDGESPRSSMPTGGESLGVAAPRDD
                     EDDLLEAQSPEAEVPELEAEPEDTEAMEASEPAEPAKKQLQKLPYIVVIIDELADLMM
                     VASREVETYVARLAQMARAAGIHLMVATQRPSTDVVTGVIKANFPTRVSFMLRSKPDS
                     MTILGTVGAEALLGMGDMLIMPPTSAHLQRVHGAFVSENEIKKAVDHLKAQGKPVYDE
                     SILKPRDEDVEGGGEEDELSDELYDQALATVSEMRAVSISMLQRKMRIGYNRAARMIE
                     RMERDGVVGAADGAKPREVLIRGLGDMPGAGAM"
     gene            343748..344032
                     /locus_tag="LILAB_RS01410"
                     /old_locus_tag="LILAB_01435"
     CDS             343748..344032
                     /locus_tag="LILAB_RS01410"
                     /old_locus_tag="LILAB_01435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013935393.1"
                     /db_xref="GI:503701317"
                     /translation="MIVAISRFRPAPEEADRLVARFQARTRAVDGYPGFLGLEVLRSF
                     EPAPELMLVTRWRDKAAMRAYFQSEDFQRAREASAQQEDATFALYEVVGT"
     gene            344166..345410
                     /locus_tag="LILAB_RS01415"
                     /old_locus_tag="LILAB_01440"
     CDS             344166..345410
                     /locus_tag="LILAB_RS01415"
                     /old_locus_tag="LILAB_01440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_043708988.1"
                     /db_xref="GI:760025853"
                     /translation="MALFATAARGTEDLLADELKELPPRRIRQDRGGVRFMATLDEAL
                     MVALWSRIAMRVLYPLGAFEARGAEGLYEAAASIPWEEHLTPEHTFAVDATLKDSEHS
                     HSGFVALKVKDAIVDRMRDTQGARPDVNTRDPDIRVVAHLARETLSLSLDLCGEPLHR
                     RGYRVRPTPAPLKETLAAAVLRAANYTGTEGLVDPMCGSGTLLIEAGLIARCRAPGLN
                     RDFAVERWPELGARARELLADMRADARRNERKVEVPLLGFDKDPEALEAAHRNVRAAR
                     LTEELQLAEGDATRMPPLPETGGLIVTNPPYGDRIGTGGQKGMKSFYFKLGESLRVPG
                     WRVWVICGNPAFESAFHARPSAKRDLWNGPIACALLGYRPPDGGSARGDTETGSEAPL
                     GAPRQPVDVAPVRPQHEGEEEG"
     gene            complement(345327..345905)
                     /locus_tag="LILAB_RS01420"
                     /old_locus_tag="LILAB_01445"
     CDS             complement(345327..345905)
                     /locus_tag="LILAB_RS01420"
                     /old_locus_tag="LILAB_01445"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DCA9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_013935395.1"
                     /db_xref="GI:503701319"
                     /translation="MTSALVLLGYLAGSIPFGVLLTRWLRGVDVRKGGSGNIGATNVT
                     RVAGKKLGAVVLLLDAVKGALPVLLAVRLLPDAPAVHVAVGLAAVLGHIYPVWLKLQG
                     GKGVATALGVLLVLAPQAALAAALVYVAVFAVSRVSSLGSLAAGATAVGTSALTARAL
                     EYAGLSALLFALMLWTHRGNIHRLARRTERRF"
     gene            complement(345916..346347)
                     /locus_tag="LILAB_RS01425"
                     /old_locus_tag="LILAB_01455"
     CDS             complement(345916..346347)
                     /locus_tag="LILAB_RS01425"
                     /old_locus_tag="LILAB_01455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935396.1"
                     /db_xref="GI:503701320"
                     /translation="MKVIIPPRNRRFSTVDALGLAGVVGLLVARYIPVARIVPFWGCV
                     LREQTGWPCLGCGLTRVADRVSHLNFAGAWEANPLGTVAALLFALAAVVMVLHLVFAM
                     PIPQVELSPREWSVLGVLAPIIILVNYAYVVVKTRFPHLLL"
     gene            346334..347005
                     /locus_tag="LILAB_RS01430"
                     /old_locus_tag="LILAB_01460"
     CDS             346334..347005
                     /locus_tag="LILAB_RS01430"
                     /old_locus_tag="LILAB_01460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708990.1"
                     /db_xref="GI:760025855"
                     /translation="MMTFKRTSSACADGWTLVRGSPCRSKDFWLSGRGMNTLRTSLML
                     LVAVPLVALAGDKTSAKAGKAAEADCHHPPAPQAAAKSEATPAAAADTGWKLTRGEPL
                     KGAKAVKLADVLARPQAHDGKTVLLEGQVRKACERKGCWMELAASGQDKGPGVRVTFK
                     DYGFFVPLDSAGSQARVEGVLKVAELSDSRAQHYESEGAIVPRGADGKPREVQLVATG
                     VELRR"
     gene            347012..347599
                     /locus_tag="LILAB_RS01435"
                     /old_locus_tag="LILAB_01465"
     CDS             347012..347599
                     /locus_tag="LILAB_RS01435"
                     /old_locus_tag="LILAB_01465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043708992.1"
                     /db_xref="GI:760025857"
                     /translation="MARSFSMRGVQGAADRAVQHARAWMLETEPGSRVHDVQLDPRFQ
                     HRGVDLLWELPSGEVRGIEVKGDRNATRRRYFFELVSNLEKDTPGCFLYSGADLLVYV
                     FLSQGELHVVPLKAAREWFLPRAKEYPLKHAFTQTGAIRYTTVGAVVSVRDVAEGVPG
                     VLRVPLKRRGGAKNEVEDVPPTSESPRGQEPNGLE"
     gene            complement(347701..348600)
                     /locus_tag="LILAB_RS01440"
                     /old_locus_tag="LILAB_01470"
     CDS             complement(347701..348600)
                     /locus_tag="LILAB_RS01440"
                     /old_locus_tag="LILAB_01470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712268.1"
                     /db_xref="GI:760029217"
                     /translation="MDKSWQQKGLKEYSTEALLGTLGHYGIAVGEDDFRKLAESAFPL
                     GIAQQWRPKWKGTGPFKDFMVAAAVELWSRWLPDRVAPMEMADTLANLMQQLSFLLGG
                     RQDAAVDAAFEKMNAVRAKMPLDEKGAPQERFMREALAPFTEKQAEIFDSLAEALASS
                     GQVAHAEAFADLEEFLLPDRRGISKAIVRAAKGELQPATEDMVKLTEDTERSPIARLL
                     AVDGLIHIKAHGQAAAAARTLLAAAEQGGDLHLALDLVPRLEHVYKAQNDREALMELM
                     GIAERLEAAHDKIHPGHRRHRHG"
     gene            complement(348712..350256)
                     /locus_tag="LILAB_RS01445"
                     /old_locus_tag="LILAB_01475"
     CDS             complement(348712..350256)
                     /locus_tag="LILAB_RS01445"
                     /old_locus_tag="LILAB_01475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_013935400.1"
                     /db_xref="GI:503701324"
                     /translation="MEGRYSLIERVRALLADEAGTLHKAAPYRVALCYPSPYHVGMSS
                     LGYQAIYREIHEHAGATAERVFLPDDVEAFKRTRTPLFTWESQSPVANFDMLAFSVAY
                     ELELTGLFSMLELTGVPLLAEERRDGRYPLVVGGGPLTFSNPDPLEPFVDVLVQGEAE
                     DLIHLLVDAAATMERDALLAHLARIPGFRVPGRGGARYHVAKATDARLPARSQIVTPH
                     TELRSMFLIEPERGCSRGCHYCVMRRTTNGGMRTVPPERVLSLIPEHARRVGLVGAAV
                     TDHPRIVELLRTIVESGREVGVSSLRADRLTQELVDQLRRGGATNLTVAADGPSQRLR
                     DMVDRKHSEEQIVRAATFARTAGMKQLKVYNVVGLPTEEDADIDELIRFTAELSRILP
                     VALGVAPFVAKRNTPLDGAPFTGIREVEGRLERLRKGLRGRAEVRPTSARWAWVEYML
                     AQCGPEAGLAAMDAWKAGGNFSAWKKAFEARGCEPYLARRVEDGRRNPVLWPTVPGTA
                     PPASAA"
     gene            complement(350387..351109)
                     /locus_tag="LILAB_RS01450"
                     /old_locus_tag="LILAB_01480"
     CDS             complement(350387..351109)
                     /locus_tag="LILAB_RS01450"
                     /old_locus_tag="LILAB_01480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935401.1"
                     /db_xref="GI:503701325"
                     /translation="MTKNIVNTALVLLGTGTLLTGCDFEQPATDCFVQGSTSWAMKYD
                     LVDEPRDANGDACEPGAPLAELVGVYKFVNPDTDTAQLALRPAGLVGSAAVADESSES
                     TDQTALGSLGEQDAEDFCTATNFNSAFVNVAASEGAPENTIRYEFSNVRVYSAPSAPG
                     TQIMGQFTYTNNGCTGTYVMRGLWPAVGCYTDSTDPLESCGEGSGMNPEAAVMCQPIH
                     PDDPEDPTYGYCVPAKEIPSFK"
     gene            complement(351146..354331)
                     /locus_tag="LILAB_RS01455"
                     /old_locus_tag="LILAB_01485"
     CDS             complement(351146..354331)
                     /locus_tag="LILAB_RS01455"
                     /old_locus_tag="LILAB_01485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_043708993.1"
                     /db_xref="GI:760025858"
                     /translation="MHLNRVLRETGVVVAAGLLYGSAAFAQSSVIIGTVIDAQSRQPA
                     ADVVVTATSPNLQGEQTVVTDAQGNYRIPQLPPGDYTLRFEKEQFKPYARSAIQLRLN
                     RTIRVNVELLPEALGEDIVIVGAPPTIDVGSTTMGVNVDQEFIKRIAVARPGGKAGGT
                     RSFESLAELAPGAQNDDYGVSINGSTSPENGYVVDGLSTNDPAFGVNASPLSIEFVQD
                     VNIITGGYMPEFGRSTGGVINAVTRSGSNEFHGSVFANWTPGSLEGTRTEIRREGTVI
                     SGQNQLSNLGDFGATLGGPILKDKLWFFAGFAPSFTRYQHTRTLNALRVDDQGNTVTD
                     ESGFTLADAIPGSATNYFADSRSIQYMGKLTYLINQDHNVSFALNGTPTSSGGLGKLS
                     IDPRSGGLPGVLASRPGDFGLTETNANTTSLALKYAGAFADKKVLVDANLGWFHQTAS
                     TLPGDGSNLGDRTGLAGYSRMLYNTPRPLTFFEALPAGQENACGATDEERMLRCPIQS
                     YTVGGPGFMSEQTLDRYQANAKATYLLNALGTHVFKAGVDVEMLSFDQVKAYGGGVYY
                     QEYEGGWTGGQGPAVQDYRRYGYQTGPDSAVSQLTQIAKTTSTTVGGFIQDSWSIANR
                     VTLNLGVRYDVQALYGGNGDLSLLLGNQWSPRIGAVVDPFANGRAKLFVNFARYYEQV
                     PLNLMDRAFPGENRITSVQRMAAPGEGSATACDPSSYESQQATCGNGNNLLEIPESSR
                     NVNRLYTGGTVGGTPVDPDIKPQSSNEIVVGGEYEVLANTRLGASYTHKNMNSVIEDM
                     SRDAGATYFLGNPGSGFAQEFPTPVRNYDNVTVYLNRTFSDGWLAQANYTWSRLHGNY
                     PGLFRPETGQLDPNILSDFDLIELLQNRTGLLPFDRTHQIKIFGAKEFNISNALSASL
                     GVSYRGNSGTPINYYGSHWGYGPDESFVLPRGAGGRTPWINTIDSNIGVNYRVSKDSV
                     VSFTLDVFNLFNFQGVTAVDQTYTLRNIKPIPNGTPADLENLPGRVEFQDESPREAPF
                     GSVDGDVNPNFKNPAGYQTPRQVRFGIRYTF"
     gene            354566..355321
                     /locus_tag="LILAB_RS01460"
                     /old_locus_tag="LILAB_01490"
     CDS             354566..355321
                     /locus_tag="LILAB_RS01460"
                     /old_locus_tag="LILAB_01490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_043708995.1"
                     /db_xref="GI:760025860"
                     /translation="MFDSVLDRGQGPKSRFGVGATVSVILHVALFGLSIWLSTRPPVE
                     EEKEIEVTLKATMAPPPPPPPPPPPPASSSKPKTQPKKPKKPDAIVQPKEIPKEAPKE
                     VEPSEEPPADEEEASEEAVEGGVEGGVVGGVVGGVVGGVIGGVVGGQLGGTGTDVLPF
                     GAGMTRPEKLSGPQPGYSREALEARVQGTMIVKCVVTVEGRVENCRIIKPLPHMDRSV
                     LDALTSSRYKPVTFQGRPVQVDYTFTLNFKLPR"
     gene            355393..356076
                     /locus_tag="LILAB_RS01465"
                     /old_locus_tag="LILAB_01495"
     CDS             355393..356076
                     /locus_tag="LILAB_RS01465"
                     /old_locus_tag="LILAB_01495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_013935404.1"
                     /db_xref="GI:503701328"
                     /translation="MQFTLAEIWAHTGLFARSVIFTLGIMSIASLVVMAERMIVFRKT
                     RSDSRNFAAKMGAILAKGDLNTAANTNLGKDVGHLGRVINSGLTAYRISPNNKDVAVE
                     SVARALERQAQREVQSMKRGLGLLATVGSTAPFVGLLGTTMGIVNAFQLMAAAGSGGL
                     GTISAGIAEALITTAFGLLVAIPAVMAYNFLQGWVDARSVDISESSNEFLDVVARHLG
                     GGAHSSNAA"
     gene            356202..356618
                     /locus_tag="LILAB_RS01470"
                     /old_locus_tag="LILAB_01500"
     CDS             356202..356618
                     /locus_tag="LILAB_RS01470"
                     /old_locus_tag="LILAB_01500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_013935405.1"
                     /db_xref="GI:503701329"
                     /translation="MGMSAGPKGGVKSDINVTPLVDVVLVLLIIFMVVTPMLQRGKSV
                     ELPKATEIEKEGKKTEADPVILSITPDKKVFVENDQVDEKGLQEKLTEEMLKDPGRKI
                     LLKGDNALSVGDVRKVLDVARKSKAKQISLGVEEKK"
     gene            356618..357118
                     /locus_tag="LILAB_RS01475"
                     /old_locus_tag="LILAB_01505"
     CDS             356618..357118
                     /locus_tag="LILAB_RS01475"
                     /old_locus_tag="LILAB_01505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_013935406.1"
                     /db_xref="GI:503701330"
                     /translation="MAGRKQRQWVKPQAQPNSEINVTPLVDVVLVLLIIFMVVTPLLE
                     KDIVVRVPDTEVEQEPTPPDPDDQQLVVQLDKDGGYSINTEKIPQADYVNRLKRMLAA
                     KKADDKVVFFMADDATNYGRLITALDGAKAAGAKVLGMATELPQNAIIQGTSVDTPTP
                     PPAPTP"
     gene            357197..357820
                     /locus_tag="LILAB_RS01480"
                     /old_locus_tag="LILAB_01510"
     CDS             357197..357820
                     /locus_tag="LILAB_RS01480"
                     /old_locus_tag="LILAB_01510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935407.1"
                     /db_xref="GI:503701331"
                     /translation="MADELLIFEQTIEALFLRALHGRLTPECKARLRQAGLDLDQKLR
                     PAYAFDAWMTFLRIAAEELFPQLPLEQGTWKLGEAYIEGFRETMLGRAVLSLLRVLGP
                     RRTLMRATQNFRAGNNYTESKLRELGPCQFELWMNEVGPYPAFTAGIIHAGLKVAGAQ
                     DILIEMSGYDGHACVYRINWNEASVSSGVAGSGDSKAASRSGSINSL"
     gene            complement(357721..358395)
                     /locus_tag="LILAB_RS01485"
                     /old_locus_tag="LILAB_01515"
     CDS             complement(357721..358395)
                     /locus_tag="LILAB_RS01485"
                     /old_locus_tag="LILAB_01515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709000.1"
                     /db_xref="GI:760025865"
                     /translation="MGDAMGAKAAVESGVVRQRRQVRIRKADIKRGQRMKAAFAVFRF
                     CLYGMVGLSAEIFFYNLVRIAQHVPLLEALFRFQWRVDDRLGLNAIWDTPIATAYGQC
                     SLWMFAIYGVACFFFIEPLYRWMLYQHTGLRAAVYGVVILLFEGFSGVMLERLTGYRI
                     WYYADAGAILWEMTSLYILPIWMVTGLLAEFIYRELMDPDLLAALESPLPATPEETEA
                     SFQLIR"
     gene            358624..360555
                     /locus_tag="LILAB_RS01490"
                     /old_locus_tag="LILAB_01520"
     CDS             358624..360555
                     /locus_tag="LILAB_RS01490"
                     /old_locus_tag="LILAB_01520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013935409.1"
                     /db_xref="GI:503701333"
                     /translation="MGIDVVVVECEVDMALGLPYFNVVGQAEGAVRESKVRVISALKN
                     TGFELPQKRITVNLAPADLKKEGAAFELPIALGVLAAAKLMDEAPLGRLLFGGELSLD
                     GGLRPIKGVLPLAVAALNGGFEGVMVPLANAAEAALVEGLRVFPVRTLREAVDHLTGA
                     CAITPYERQREPSLLPPTGQMPDMSDVRGQADLKLALEIAAAGGHNVLMSGPPGSGKT
                     MLARRLPGILPEMTFAEAMEVTKVYSVLGLLGEGHALMRERPFRAPHHTLSDAGLVGG
                     GPSARPGELSLAHNGVLFLDELPALRRNVLAGGHNVLMSGPPGSGKTMLARRLPGILP
                     EMTFAEAMEVTKVYSVLGLLGEGHALMRERPFRAPHHTLSDAGLVGGGPSARPGELSL
                     AHNGVLFLDELPEFRRNVLEVLRQPMEEGVIHLARANQNITYPCRVMLVAAMNPCPCG
                     YYNVPNRPCTCGEQRVFDYLTRVSGPLLDRIDISIQTRPVEYHHMARSTVQEPSSRYY
                     RERAQAARERQRARYRDEPGLHCNAQLPAHLLRRYCGMSERAEAMLQQAVRMYGLSAR
                     AHDRIVKLALTRADLEGHGRIEQSDMQLAINCRMLDRRGAAQGKLHGSRPAPPSGDAA
                     WRAVAGPSGRASPLEDLDG"
     gene            complement(360572..361957)
                     /locus_tag="LILAB_RS01495"
                     /old_locus_tag="LILAB_01525"
     CDS             complement(360572..361957)
                     /locus_tag="LILAB_RS01495"
                     /old_locus_tag="LILAB_01525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_043709002.1"
                     /db_xref="GI:760025867"
                     /translation="MSPKSKREDLPHVVILGGGFAGLYAARHLYKAPVRVTMVDRHNH
                     HLFQPLLYQVATATLSPSEIAAPLRALLGRHDVSVVLAEVTGVDTVGKRVLLSDGELK
                     YDFLVIATGATHSYFGNDAWAQHAPGLKSIEDAVEIRRRILVAFELAEREPDPEVRRA
                     LLNFIIIGAGPTGVELAGSLAEISRHSLPGDFRNIDPREARIILIEGIDRVLPVYPDD
                     LSQKACRTLEKLGVEVRTGARVTHINEQGIFIGTEFIPARTVLWAAGVAASPVARSLG
                     AQLDRAGRVLVTPELTVPGHDDVFVVGDLASLNDADGKPVPGLAPAAMQEGKHAAHNI
                     RRQLQGKPMEAFSYWDRGSYAVIGRGHAVGIAFRRFKQSGFSAWMAWLLIHITFLIGF
                     RSRLAVLLDWAYSYLTFGKSARIITGPSPRLDRLQPTHALTEGGETSAAPESRFQATA
                     SHAEPASPVTH"
     gene            362263..363288
                     /locus_tag="LILAB_RS01500"
                     /old_locus_tag="LILAB_01530"
     CDS             362263..363288
                     /locus_tag="LILAB_RS01500"
                     /old_locus_tag="LILAB_01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_013935411.1"
                     /db_xref="GI:503701335"
                     /translation="MSKLAEKLKAVAAAVASIEKQFGRGSVMTLGGEAREQKVAVIPT
                     GSVGVDRALGVGGYPRGRVVEVFGNESSGKTTLTLHAIAQVQAAGGVAAFIDAEHALD
                     VSYARKLGVRVEELLVSQPDTGEQALEITEHLVRSGAVDLIVVDSVAALVPRAEIEGE
                     MGDAHMGVQARLMSQALRKLTGAVSRSGTCIIFINQIRMKIGVMFGNPETTTGGNALK
                     FYASVRMEIRRTGNIKDGDAVVGSRARVKVVKNKVAPPFQEAEFDLMYGSGIHRVGEV
                     LDLGVATGLIEKSGSHFSLRGERIGQGRERAAEWLREHPEVLESLGKELTGASPPSPP
                     AAVEAAA"
     gene            complement(363285..363797)
                     /locus_tag="LILAB_RS01505"
                     /old_locus_tag="LILAB_01535"
     CDS             complement(363285..363797)
                     /locus_tag="LILAB_RS01505"
                     /old_locus_tag="LILAB_01535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709004.1"
                     /db_xref="GI:760025869"
                     /translation="MRDVMQPPTGQPPPGKRWHTREDSGIRLDATLRWWHDDEPILHP
                     KIIELFNASLVLDEAGRYQLRIGNDWCFVQVDGAAYEVRTVDVTPDERVSVRLSDRTA
                     EALDVDSLHLDADGVLSCRVKQGRAQARLSRDAQYQLGQLLEEAPDGGLVLCVGQRKL
                     AVPVALDASA"
     gene            complement(363843..365354)
                     /locus_tag="LILAB_RS01510"
                     /old_locus_tag="LILAB_01540"
     CDS             complement(363843..365354)
                     /locus_tag="LILAB_RS01510"
                     /old_locus_tag="LILAB_01540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709006.1"
                     /db_xref="GI:760025871"
                     /translation="MSRSKSKRPRPPSSEPVAPESPAVAPVAAQPEEGAASTAAPPAA
                     EPAPAPAPESAASAPGAPVSGGLPLNAARVWLSAYRVEVGLFLVAFVVLASFSSQRFL
                     RQSAAPHFVYQAQAWLEGRLDVDPRVLPNMEDWACVRVVEGDKVRCAGRPLPTDRWYV
                     SFPSFPAVAMLPFVALHGYQFNDTSFGVIVGALAVALFYSLLRFLAKEGETARNRNEN
                     VALALILAFGTLFFYCAIRGEVWFSAEVMGVALTCLYVRNAVRAQRPLLAGLFFSMAT
                     LTRTPLLFTGLFFVLEALCPGPEPRLAQLKALARDWKPAARKVGLFTLGAAPLAGLAA
                     AYNVYRYGRLSEFGHAYLFNNRVNVDIDRTGLFNWEYLPRNLEAAFFKLPTVSLSPLK
                     LAYDPHGLTLLLTLPVLVFLLVPKTRPRLHWPAWLTVAVCALPGLFYQNTGYMQFGFR
                     FSLDYTPYLLLLFALGGWSLRNRAVLAAVALGVLVNFWGAVAFRGYTELVRNW"
     gene            complement(365351..366616)
                     /locus_tag="LILAB_RS01515"
                     /old_locus_tag="LILAB_01545"
     CDS             complement(365351..366616)
                     /locus_tag="LILAB_RS01515"
                     /old_locus_tag="LILAB_01545"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DCC8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence damage-inducible protein A"
                     /protein_id="WP_013935414.1"
                     /db_xref="GI:503701338"
                     /translation="MRVELLCTGDELVTGLITDTNSNYLEARLFDLGVKVERVVLVGD
                     VRPDITRALTEAASRADVVVVSGGLGPTADDFTLECAASAAGVPLEEDPRVLGWLHER
                     YAARGIPPNPSALRMARVPRGSEPVKNPEGSAPLVLMKLGGAQLFFLPGVPREFKALL
                     EAEVLPRIRATLDARPGRTYRAFRLLRTVGIPESELDLAVAPMAPRHPRVVFGFRTHA
                     PENHLKLMAEASSQSEADAALAAAEAECRQVLGPRIFGADAETYAAALLETLRRAGAT
                     LAVAESCTGGLIAQQLTAVPGSSDVFIGGAVVYSEKMKSAWVGVPPELLARHTAVSRE
                     TAVAMAEGVRAACATTFGLSVTGYAGPGGGTPEDPVGTVYCALAAPGLPTRVERISVT
                     GDRDRVRLFAASFTQEMLRQHLLAAPATP"
     gene            complement(366728..367594)
                     /locus_tag="LILAB_RS01520"
                     /old_locus_tag="LILAB_01550"
     CDS             complement(366728..367594)
                     /locus_tag="LILAB_RS01520"
                     /old_locus_tag="LILAB_01550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="WP_013935415.1"
                     /db_xref="GI:503701339"
                     /translation="MMKLRKLMFVLPNLFTVTSIFCGFYAITLCTGDVAPVQLYQAAL
                     AIFFAMFFDGFDGRVARLTKTQSDFGVQLDSLADVISFGAAPSLLVYKWALEPLGFVG
                     LFIAFSFAACGALRLARFNVLAARNPHGGGGSFFVGLPIPVAAGMLVSVIISHHAATQ
                     GEPLAEGAIVPMAVAVAGLALLMVSTVRYRTFKDTRPNRKSALAFMLVVVGGTVIATQ
                     FHPAWVLVACCGAYLALGLVESAVLVRSRLAARKVAAPCAVAAVAVATVIDDEDEEEA
                     ESTPGSDGPAYL"
     gene            367688..368851
                     /locus_tag="LILAB_RS01525"
                     /old_locus_tag="LILAB_01555"
     CDS             367688..368851
                     /locus_tag="LILAB_RS01525"
                     /old_locus_tag="LILAB_01555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_043709007.1"
                     /db_xref="GI:760025872"
                     /translation="MDASRWTVWVLVAGVALVLWNVLWVASVRRWYRPRAELPQVLRA
                     RCEDGWELVVHVRRAAVRRFEEPVLLCHGLAANRFTFDFEPPYSVAHYLAEAGFDCFS
                     VEWRGTGHSRQPPRGRRYTDFTIDDHILQDGPALLELALKETGAKRAFWLGHSLGGLV
                     GYGVAQGPHGAKLAGLLTLGAPVHFKSEPFLRTLISMGVRAAWPARFRQEWMSASLAP
                     FLGYVTLPLSDLLVNPEHIPPRIQRQVYANMMSSMSRKVLLQFQDWIEHDAFRSFDRG
                     VDWRAGISKLQLPLLIMGGSSDRLATAANVEAQFALATAPDRTLHIFGTDHGDKMNYG
                     HGDLVFGTGAPTEVYPVIREWLERHAAALPAAITEPAPEQVEEAPREPERSVP"
     gene            complement(<368936..370645)
                     /locus_tag="LILAB_RS01530"
                     /old_locus_tag="LILAB_01560"
     CDS             complement(<368936..370645)
                     /locus_tag="LILAB_RS01530"
                     /old_locus_tag="LILAB_01560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935417.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712270.1"
                     /db_xref="GI:760029219"
                     /translation="MLACVRFRTFLLLSLLLAGACRSASHREALSVPGASTVIWVDAA
                     REGPGDGSRDRPLQSLGEALARPGPLTVRLAPGRYAGPFVLPPGARLEGLGTGVVLHA
                     GDDSHTVLKMDEGGTLSGVVVQSGQWGLEVTGGSHVRLERVGFSGQRTGAVRVESGRL
                     DVEASRFEAAPKATVGILLESKSPLPPGSGAMATGAERLATAPAAPGTAPRQVAEARA
                     DAGADPGQVAEALADAGTVPRQVAEAPADAGADPGRPAGEAPPTGAEGTRAGPEFPRA
                     AGEAHIRASTFTGPYRRAVRLRGADMRARLEDVRFSGPATAVGVDGAHAEVLRSSAEG
                     GQAAAFSVMSGTLILDEVTVTGHEYGLSAMQALRLEVHRFTSVRAQRAGMGVSLSRAR
                     LRDIVVRESGSYGGLQFLGGDLDVQGVRVEGAGEYGLMALRGKLRLRDADIRGVRTAD
                     NVTGDGLHLRQVEADVEGVVVREAQGACVLAAQAARVSLRGAKLEACGDVGLMTDTLA
                     RLDASSVKIDGAASALKAQGGSELRVESLDARGLAKGFAQAECEGGTQVLLKDLRSED
                     TRGL"
     gene            370959..371228
                     /locus_tag="LILAB_RS01535"
                     /old_locus_tag="LILAB_01565"
     CDS             370959..371228
                     /locus_tag="LILAB_RS01535"
                     /old_locus_tag="LILAB_01565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002610473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor"
                     /protein_id="WP_002635502.1"
                     /db_xref="GI:488711624"
                     /translation="MTKAELVEVVAAQTRLTKKSAAQILDIVFTNIGKAVKKDARFSY
                     PGFGTWSVRSRKARKIRNPQTNEMMKLKASKTIGFRPAKELKNSL"
     gene            complement(371251..372258)
                     /locus_tag="LILAB_RS01540"
                     /old_locus_tag="LILAB_01570"
     CDS             complement(371251..372258)
                     /locus_tag="LILAB_RS01540"
                     /old_locus_tag="LILAB_01570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_043709008.1"
                     /db_xref="GI:760025873"
                     /translation="MRRLSLLAFVTACACASRGAEPKMSFEELYATSAPRPRGPELAP
                     AVTRARRPAPETAPELHAVLSAFAARAQTLRQQVARGGVMPAAQVENWEQMTLALDGF
                     LSRPAAPRVGSGDLLRAQSVLEAELERDGFTYGDMPASLAEAVVLRVGRLAVRTAELR
                     RLEQPPEPDEDAPPRFSWPVDPVSVTSLFGYRWHPVTGVHRRHLGVDLAATQGQPIYT
                     AEKGVVLRAGRNGDHGLQVEVQHEGRWVTRYSHLSRLLVAAGEVLERGIAVGLAGETG
                     LATGVHLHFELWRDGEPMDPLEALADAEPPPEPTPPMARRPTGRSPAMQQGRPLAGER
                     P"
     gene            complement(372358..373383)
                     /locus_tag="LILAB_RS01545"
                     /old_locus_tag="LILAB_01575"
     CDS             complement(372358..373383)
                     /locus_tag="LILAB_RS01545"
                     /old_locus_tag="LILAB_01575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_013935419.1"
                     /db_xref="GI:503701343"
                     /translation="MKRIDFRSDTVTQPTAAMRRAIADAEVGDDVYGEDPTVLRLEAQ
                     VAERLGLEAAVFVPSGTQANQLAIGAHCRQGDEVLTEAGSHILHYEGGAVPALWGVQP
                     QPLPGERGLLSPEDVRAAVREDNIHNPRTRLLSLENTHNRGGGSVWPVARFRSVVEAA
                     RKAGLAVHLDGARLFNAGVALGVPVSAWASLTDSTAVCFSKGLGAPVGSALAGRADVI
                     REARRLRKRLGGGMRQAGILAAAALHALEHHVDRLADDHANARRLAAGLAEVPGVKVD
                     ASRVETNMVFAEFTRPALESLSLLERHGVLTNPAGAPRTLRFVTHLDVSAADIDEALE
                     RIRRAVS"
     gene            373414..374160
                     /locus_tag="LILAB_RS01550"
                     /old_locus_tag="LILAB_01580"
     CDS             373414..374160
                     /locus_tag="LILAB_RS01550"
                     /old_locus_tag="LILAB_01580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="WP_043709010.1"
                     /db_xref="GI:760025875"
                     /translation="MLGLAAGVTYNGAVPGRETVTEKRKRAVLVMDWLAADMPDARIE
                     LDYRTPLELLVAVILSAQCTDKRVNMVTPALFQRFSDAQAYAEAEPPDVEPFIRTCGL
                     YRAKAKNIVAAARALVQEHGGRIPLQRDALEKLPGVGRKTAGVVCIHLGGDAAFPVDT
                     HVKRLAFRLGFTTKADPDKVEADMQAVLPSERWTLGHQLLVWHGRRTCFARSPACERC
                     VVADLCPKKGVKAAAATETPGRPPRARAKT"
     gene            complement(374114..374647)
                     /locus_tag="LILAB_RS01555"
                     /old_locus_tag="LILAB_01585"
     CDS             complement(374114..374647)
                     /locus_tag="LILAB_RS01555"
                     /old_locus_tag="LILAB_01585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_013935421.1"
                     /db_xref="GI:503701345"
                     /translation="MVREILIWPDPVLKQKAKPVAKVDDSIRTLVKDMFETMYSAEGV
                     GLAGPQIGVLQRVIVLDTTHSQPELKPIAMINPEIIAREGDTTYNEGCLSIPGESAEI
                     DRAAAITVKFLDPDGQEQTLRCDGLLSIAVQHEVDHLDGTVFVDHISSLKREFIRKRM
                     KRLKSSREREVGAPASP"
     gene            complement(374737..380238)
                     /locus_tag="LILAB_RS01560"
                     /old_locus_tag="LILAB_01590"
     CDS             complement(374737..380238)
                     /locus_tag="LILAB_RS01560"
                     /old_locus_tag="LILAB_01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="WP_013935422.1"
                     /db_xref="GI:503701346"
                     /translation="MGAPVLLVHDDIANIAAVRRLLTREGYEVILATSAADALIAYGH
                     HLPVLLVLAPGVESGRGHLVLEELLQHPDGKSARVLLLGEPIPGFSAPVAPLPLEGAA
                     FVALVDSLVKAPADADAWHVVENREPPPSSGGVSAAVGTETESWHATPPPSVAGDPAL
                     ANALFGDLAPLHQTDWELAAMTDAERSAHEAARHREHQSTRDLDTAMARAHLEAEAQA
                     MTSIDSALAPDSADGWGESSQEQDWGSAVEGDADARAPGEEAPPVGRLAWTEEPVSQA
                     SLRTAAPAPQLGDEGFFDVDTPEAPAGDALSAAEAELAAMRAAPSHEPAAPDGSPWTE
                     LPPDPEMEHAARLGTQSDGAASEAPGEASASEPEQASDSESDDAWGTEAALGESTDAA
                     AVSASNWELLEAELQAASTKSHADEEARPAPGDDWFDGEATGETGDAPAAEPSVGADW
                     FDSEAEAASPAPEAPVEAPAAAAGGFAVPALMAQWQAQQEEAERQLEEAHARVSAVTE
                     ALEREAALRRELEQQVQGLQERLAEEEEEHSRESLLRAEAEAALEGLRQRAAPSSTAT
                     SARAVLGDAEAAGDVAALRAELEAQVQLREEAETLTAEVEAQVRQFEDACAEAELRAI
                     DAEARAEAEAKAREEAELRAAASTQALQALEARLESEAAGRVVSEVRAESELKARQAA
                     ESRVESAEDLSSMSEARIDAEARAREAAEARADVEAQARLEADTRAQSLSQAFEEAEA
                     RAELATRSQAELEARAELATRAQVEAEARAESATRAQAEAEARAELAARALAEAEAQS
                     ALIARALAEAEARVQAEAEARVEADARVESVATALAEAEARAEIEAAARMDAEARLSS
                     SATTLAEASARGEVEASARAEADARMESVAAALAEAEARAEVESTARADAEARAKQAE
                     ARAQQEAEARANAEARASSDAAARTEAEARAEQEATARLEAEARAEHAAAALNDAEAK
                     AEQSAAALRDAEARAEIAALAQQDAESRAESEAAARREAEARVQSESEARAAAEARAE
                     AEAAARAEIEARAEREAKLRAAIEVRVESEANSRTQADTRASREAEARAEAEATAEAE
                     ATLRAEAEVRAKAEATARAEAEAQATAESERRAEAEARAEREAKLRAAIEVRVESEAN
                     SRTQADTRASREAESRAEAEARAEAEATLRAEAEVRAKAEATARAEAEAQATAESERR
                     AEAEARAEREATSRAEAEARAERETQTRAEAEARADREAQARAEAEARADREAQARAE
                     AEARAEQAARQLAEAEAQARAEADARAAEKTRAQTEEEQRATQSEAEAKARLEADARA
                     EAALKSAAEAEARAEAEAKHRAEAEARAQQAAQAEAEATARAKTESRHRTALEVRLDA
                     EAKQRATLESRLEEESRARNESESRLLAENARVSEELAELRLEHQQSREELAKEREAR
                     ESLEQSLEALRRESAEQRARAERERHELEERALRDAEEAAAQARASMLPLEAPPGRPE
                     LAVARSGSVTQDGLTKLVLRLCEARMEMRLELKVMNALRVLWLRDGALVGAVSSAQGE
                     SLVDRARADGLIDARQEGELRLVRSATTAALLDALRGRGYLRESEAVPLVQRYTEQVF
                     LDALAEPSTLYRLVPEPAPHEVALAAATRPPLHLLAEALRNTLTSESLLEAAGSLRAR
                     VTRGDLHLAPDDFGLPPRDLQLLSQVDGEHTLEALLLGAGLPQDSALKALAVARTLGL
                     VSLEPAADDDAGDLPPELDVRRLEAKFEEIQDADYFTVLGLARSAGGEEVKRAYELLA
                     AEFHPLRFAGHPDPALQHRAQQIRSVLAEAAQALGDDRLRAEYARSLLD"
     gene            complement(380254..382506)
                     /locus_tag="LILAB_RS01565"
                     /old_locus_tag="LILAB_01595"
     CDS             complement(380254..382506)
                     /locus_tag="LILAB_RS01565"
                     /old_locus_tag="LILAB_01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_013935423.1"
                     /db_xref="GI:503701347"
                     /translation="MRAEVSAPVLASIAVGRPVRGEFTYALPEELAGRLEPGQRVLVP
                     FGRGTALGFYLGPASPPPGDKVKLKAVQRVLEDSPSLPRDLIALLRFAAVHYRYPLGE
                     VIRGALPPGLSKAVEEKEAKPDVQHFAVALVNEVPPELSRAPAQSAALAYLLAVGGRA
                     PLEEVAHAIPGARETLKKLATRGFARLEEKTVEASVKEGLIQGRPDHLTPEQDAAGVV
                     LRGALDAATFQPFLLHGVTGSGKTEVYLRAAEHALSLGKGSLILVPEIALTPQLVGRF
                     RSRFGAEVAVLHSALKDRERLFHWQALRRGDVKIAVGVRSAVFAPVDNLGLIVVDEEH
                     DPSFKQEEKLRYQARDLAVVRGKQAGAVVVLGSATPALETLENVKRGRYQLLELKHRV
                     DDRPMPSIELVDLRVERPREGVVTEEAPILSPPLLEAMAETIGRGQQVILFLNRRGHS
                     TVLLCEVCGLSLKCSECDVCLTHHRSQNRVVCHYCGLAMPVPEQCLECTGPMLKLGIG
                     TERVEAEVLERIPTARVTRLDRDSASSAERLTELLASFARRELDVLVGTQMVAKGHDF
                     PGVTLVCVVMADTSLSIPDFRAAERTFHLLTQVAGRAGRGKDPGRVLVQTYNPDAEPV
                     RRVLAHDFDGFANQELEWRKALAYPPYSRMAAVRLEGEHPEQTASVARSLGNIVSRHM
                     PPASAGVRMLGPALAPISRIRGKTRWQLLLKGPTHTALAPLLARVEAALADVPSAVKV
                     VIDVDPGAML"
     gene            complement(382775..383401)
                     /locus_tag="LILAB_RS01570"
                     /old_locus_tag="LILAB_01600"
     CDS             complement(382775..383401)
                     /locus_tag="LILAB_RS01570"
                     /old_locus_tag="LILAB_01600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013935424.1"
                     /db_xref="GI:503701348"
                     /translation="MKVYGLPMSTATRMVLAALAEKGQAAELVSVDLTKGEHKASAHV
                     ERHPFGVIPVFEDDDGFRLYESRAIIRYLDRKLPGASLTPSDVHAYARMEQFISVEQS
                     YFSPAAMKVIWERLFKKFLGGGAPDEARIQEGLEGVERVFGIIEPVLGRQQYLAGDSF
                     SLAELTWMPYMEFFVAAGGAELVARHPNVAAWWERVRSRPSWKQVTGS"
     gene            complement(383520..384275)
                     /locus_tag="LILAB_RS01575"
                     /old_locus_tag="LILAB_01605"
     CDS             complement(383520..384275)
                     /locus_tag="LILAB_RS01575"
                     /old_locus_tag="LILAB_01605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935425.1"
                     /db_xref="GI:503701349"
                     /translation="MKRTVALLAVLVSFAAAAYVLPGSSIIRRMAAERAELRLSTLRV
                     EGSLSFGGPAVKEAGAALGTPTDRPEVQGDGVLSIRVPGRCRFEASAPGGSATSTVIQ
                     SGGRRRAQGTEIPAMSVLVAQVCPLLATGSGNVQDQKEAVLRHLQGLGIETGRTGLAR
                     LGGEVTYVLGELAEGRPQFWVYKDSFRPARLRYTDASGTAWDVRFLDYNSPATGEWMP
                     RTIEVWRGGQRSLRFTALKGDNRASVPDSLFTL"
     gene            complement(384272..385174)
                     /locus_tag="LILAB_RS01580"
                     /old_locus_tag="LILAB_01610"
     CDS             complement(384272..385174)
                     /locus_tag="LILAB_RS01580"
                     /old_locus_tag="LILAB_01610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_013935426.1"
                     /db_xref="GI:503701350"
                     /translation="MASKTPKVEPLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTP
                     TLQYIVEEAVSAGIEDVVLINGRGKGAIEDHFDIGFEIETTLRARGKEAEADRLRAIA
                     DLVRVVSIRQKEPKGLGHAVLCAKSVIGDEPFGVLLGDDMIDAEEPGIRQLARVYRQY
                     NQAVIALMEVPDNETHMYGIAAGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLP
                     PDIFPILENQTPGVGGEIQLTDGLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAY
                     ALKRPDLRDGLLAYLREVVKTEKP"
     gene            385235..386083
                     /locus_tag="LILAB_RS01585"
                     /old_locus_tag="LILAB_01615"
     CDS             385235..386083
                     /locus_tag="LILAB_RS01585"
                     /old_locus_tag="LILAB_01615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935427.1"
                     /db_xref="GI:503701351"
                     /translation="MLLRALVLIALCVSTTALAQPAEDLRDVMSARAYGMGGAYRALG
                     LGVDAMMGNPAAMVLYPSYRMEGTGAWDSHRKEGLLGVSVIDAATSRLGMGMDYHWVS
                     VGRGGARASAHLSSLGVGLPISQSLMLGATVRYLRMSGQSRFANSVTGDAGIMLRLSQ
                     ALMAGFSAHNLVDTGNDELTRYYSAHVGVMTGLLTLAGDVRADFTTNDTTTFTYHGGL
                     EYILGQMFPVRAGYSYDGFTRTSQVSAGLGYMSEGGGGLDFGYRHDLGGPKGRMLALT
                     IKMNMN"
     gene            complement(386085..390602)
                     /locus_tag="LILAB_RS01590"
                     /old_locus_tag="LILAB_01620"
     CDS             complement(386085..390602)
                     /locus_tag="LILAB_RS01590"
                     /old_locus_tag="LILAB_01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935428.1"
                     /db_xref="GI:503701352"
                     /translation="MGGVRNGKSAGTPEPAAVRQEALQSGASDVKPAEAVNDVVNRHL
                     RSAARLLREGAAARAFGELARASRTLPMTPRLAAGIVRMALLAGTEAAAITLLEVSPS
                     VVSSRRAVRRQLARVLRRVDQLPRAAAALEALLVEWPEDRGARRVLQVLRARIAGTAS
                     PGARPSAAPEGGGEAGVLAKRPARKDGVQDAVSWDDDGIYLIETVVGPPLAARPPPGA
                     TSTAGTAQARPRSSSSELPLVGGAGPAIASPGSEAGARVEAPAGLERLGAVSDGAAVP
                     SSERSHVESPAAEIRPSEGSAEPVPGATAVSARTGVAELPAVAPNVAAPPAESLKTVL
                     ELPAVEPSAVGLSPRASAPEAPRTLVELPAVVAQPPSLAFEARKTEVEMPALGADASP
                     PASGSVKTFVPGRAPLSVPWADASDDDAGAPAPPVRDVPPAPRREAVTFDDFREDEVT
                     SEAQPFHSTDAVSGQAPRPQAPAASQGPRRKTPVSSEALPPPATPRGAPEPDARAGTM
                     EVSLAELEAALAAASGDAPNARQAAAASPGAEDAEELTRSQKVEAQLIARRAWAELAQ
                     LYLKRADQAKDAALRADALARLAEVMENELHDPAGAARMYREIVALTGDRAALRDQVR
                     LLAARGDASIVRRALDEAIRRAPTARARAGALLTRGERWLHLGELEKARADFEAAESL
                     APGLLPVLAGLLRCVSDRERPAIAERLRVALAAAPRRAPDRVEALRVLAQVAEESLSD
                     LRLAQWAWSEVLAESPDSEQARVQLTTLTRQLGDTTVLSRLLRAQLARESRGPAARQA
                     RLELVTTLDAQGDAEAALEELRQAVRYEPGHKEAWLLLVDRLLARERLGEAAWALEHA
                     ATATEDEEERERTWDRLARLWREVMGNPERAQVYARRAEGLRQARAEREVPPPEPPRS
                     ATPRREPSGPRAPLIPAPPVLTQASANVASLANEETSTTDMGVAPAATEGVDAGGGAL
                     PNAASAPGHPASPGHAASRRRRKRGARSDSASPSHAGAEAQAEGRNPPSSPGNTTAPA
                     PRAPVESFPAPSSKAAGRNPPSSPGNAPAPRAPAEPREAALSKVQAAPKPSGSSRGDK
                     AAQRPAEAAPAPAARDADVRGRRTRATDLMTGELIELGDAPVPETRVISWEAPPGRMD
                     PVRRVVRARPEGTVSAPAPGRTFIAKPPASPEPARPVAGVMETREVPAPAYPASPDTE
                     PDAFRHIRERPLDAQPYRLLAEYFDQRGDPARASLMREIADALDGLETPAPKGQRPPL
                     TSDERAGLRHPGLRTPSGELLACTGIALCRLFPAEGRAAGSSELLRATAGPCAPAVLD
                     ALHTAARMLDVHLPELVLAEDDGPPFTAVHAGHPRLLVGRALLREPMPLPELRFHAGR
                     ALLSLSPDLLALRALKGGQLFRALALLTTVLKDPRAAGAEARVVRESLSPRALERALT
                     LLEPGTQNFKASALADAARDSANRAGLVACGGIGPALTVLRARRGNEAELVELLRFAA
                     SERYLPLRAPR"
     gene            390627..391646
                     /locus_tag="LILAB_RS01595"
                     /old_locus_tag="LILAB_01625"
     CDS             390627..391646
                     /locus_tag="LILAB_RS01595"
                     /old_locus_tag="LILAB_01625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_043709012.1"
                     /db_xref="GI:760025877"
                     /translation="MPVPAVTVLLPARNAEATVARAVRSLLTGTVRDLRVLTVDDGST
                     DGTRRVLTDLAASDARVEVLDGRGRGLVAALNLALGQATSPYVARMDADDEALPRRLE
                     ASLDALEAEPALAGVGTAVELFRDDQPVSPSLQAYATWLNGLTSAEQLDRERFIESPL
                     CHPSVCLRRDAVIAAGGWRDGDFPEDYALWLELLDQGFALRNLPEVLLRWRDSDGRMT
                     RTDPRYALKRFMWMKARYLTRGRGPLADGRPCTVWGAGPSGKLLTAFLHQEGARVRRY
                     VEVHPRKVGTHIHGIPVISPQELGAPGDGHLLVCVGVRWARAEIREDLIGWGWVEGRD
                     FTCAA"
     gene            complement(391651..392595)
                     /locus_tag="LILAB_RS01600"
                     /old_locus_tag="LILAB_01630"
     CDS             complement(391651..392595)
                     /locus_tag="LILAB_RS01600"
                     /old_locus_tag="LILAB_01630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_013935430.1"
                     /db_xref="GI:503701354"
                     /translation="MKRRTFRVEGGLVGKAVAHAVATELGLPEARARGLVDVGAVYVA
                     GKRSRDASARLAAGQVVTVVLEEGGQSPLAAPPPAPELPVLYEDADVIAVDKPAGVSA
                     QPTEGRVGDSLVDLVGAKLGRAAGLVHRLDRETSGVTVFGKTAEATSALAAAFREGRA
                     RKRYVAATGPGLPPSGTVDLPLSKDPSRPGRWRATRAANGVPALTDFHTLFAGPAFCV
                     VELLPHTGRTHQLRAHLTALGAPILGDARYGGAARAQGVEAARCLLHAQALELGHPRT
                     GKALRIEAPVPEDLMRFFLAAGVEPPQGAIRGAGSGPG"
     gene            392766..394286
                     /locus_tag="LILAB_RS01605"
                     /old_locus_tag="LILAB_01635"
     CDS             392766..394286
                     /locus_tag="LILAB_RS01605"
                     /old_locus_tag="LILAB_01635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="WP_013935431.1"
                     /db_xref="GI:503701355"
                     /translation="MDRPLHSVRTRLDDFLAELATVHYRQGAGLALEVQPSQLLASFP
                     ELSSPDTFAAANEALAKARAKDDPLLVRRIQRVRELVASHVEDALAARHVDAIATLEA
                     QAKLTVDDQAYAFGEALGRIPHEPARGRRALLERATGEFLWQHRTRYGDRREAALHAA
                     EQLGAKDYPTLRQDVTGIDFAKLAESASTMLARTEDAYRDVLAYVLKKVDPLLRPLPG
                     GEARRHDLQAALQAPWMDGFFRREDAFPAVVRWLGEWGLTPNAGGRIRIDDEARPGKS
                     PRPFVAVVRVPDDIRLVLQPRGGLDGLASLLHELGHAQHRAHVSDTLPVELRRLGDAA
                     VTEAHAAVFERLLLSPDWLKRYLGLPTMAAKDAARLAAFQALTLLRRHAAKLSYELSL
                     TRRGASAERADEYADGQRHALFVEPHPGFFLHDVDPQLYVAHYLRSWALETQLTARLT
                     ERFNEDYWRNPAAAAWLKGLYARGGSDDAEGLATETSGTPLALPEAGERLVAILNR"
     gene            complement(394305..394652)
                     /locus_tag="LILAB_RS01610"
                     /old_locus_tag="LILAB_01640"
     CDS             complement(394305..394652)
                     /locus_tag="LILAB_RS01610"
                     /old_locus_tag="LILAB_01640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935432.1"
                     /db_xref="GI:503701356"
                     /translation="MERKVGSSTVTAKEVKAALEKTRTLSAEEEKVLRMRHGAGASST
                     RAPLPRAAGDNQELGDELLLIEMQLMKAMRARAGGKPVATASSKPVAATRARDAAANP
                     TKDKIVRALRKKK"
     gene            complement(394882..395916)
                     /locus_tag="LILAB_RS01615"
                     /old_locus_tag="LILAB_01645"
     CDS             complement(394882..395916)
                     /locus_tag="LILAB_RS01615"
                     /old_locus_tag="LILAB_01645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935433.1"
                     /db_xref="GI:503701357"
                     /translation="MSRLKKSAFTLAVALAAAGCSDPVDKAAKARIFSPEDPPKAVAS
                     AKETLPPEDVADNPRVARRILGMDAAEVTERLGPHRYQATLGYEWTSEASIPVKLTET
                     RTFRAGPGGVGGDFHGVLENSRDQGLEVMRVGGQVFARNRYGPFRQRLRDRGMAERTR
                     AELTGAIRDFDSLFQGRIKLTPEGTVTHEGRTAWRYVVTLAPAGQADTSRPLPPMPQP
                     KKGGADETTVRRANFFAHRLPRSLDGEVLVDAATSVVLKARLDGRMGVPGDKTPEAAE
                     LRLTLEAALSEVGTDPRLQPPEDFLPDADKPQGIADALDTFGIQRKKAGESDSESSGA
                     APEPEDEEGT"
     gene            396022..396876
                     /locus_tag="LILAB_RS01620"
                     /old_locus_tag="LILAB_01650"
     CDS             396022..396876
                     /locus_tag="LILAB_RS01620"
                     /old_locus_tag="LILAB_01650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935434.1"
                     /db_xref="GI:503701358"
                     /translation="MQNLRDKLLKAGLVTEDQAKKVETKASQAEARRSGPQEGGRSGG
                     NRPPPRRDDNRTQGGPPRAEGGGRPGGPRDAGRREGGGRPGGFGGAPRHGGGPQQGRP
                     AAAPERAIPKLPPMPGSKAYQRAESKRQVELDRALRELVLGSQVPVEAGETAFYFMTR
                     KGKLRRLELSPAQAKQLEEGELGVVERPEPAQIEHSLVPAAAAEQMFALSKKSVRFLN
                     RKDNPVGFMNDEELKAQQAAEAAGTAPELPDEPEGEGEAPASEPPAEGEASTTEPTPA
                     HGDAPQNG"
     gene            397028..397855
                     /locus_tag="LILAB_RS01625"
                     /old_locus_tag="LILAB_01655"
     CDS             397028..397855
                     /locus_tag="LILAB_RS01625"
                     /old_locus_tag="LILAB_01655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase"
                     /protein_id="WP_013935435.1"
                     /db_xref="GI:503701359"
                     /translation="MVQGFLKLLPVVFVVSGGLKAVILWAGWKLTHLKSAARLRVYRR
                     AFGKGQLRSEVRAALIVIGCDALLISAFRAFHDERFAPFRWTATLLTFAWMFVMFEAW
                     FYVTHRLMHTRALYWIHAQHHVAQVTNPITSLSFSVAERVVLLGGAFMLVTVAGHFMP
                     ITQAGLVLYILTNYSLNVLAHGNTEWVPGRFVSSWAGRLFFTTTFHAMHHARYQGHYG
                     LFTPVLDRWLGTAFADYPQVHARARAGQGLERLGERIRLDAPSPTVSAPAPGGLGTS"
     gene            397890..398651
                     /locus_tag="LILAB_RS01630"
                     /old_locus_tag="LILAB_01660"
     CDS             397890..398651
                     /locus_tag="LILAB_RS01630"
                     /old_locus_tag="LILAB_01660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013935436.1"
                     /db_xref="GI:503701360"
                     /translation="MTTTSKTVVVTGASRGIGRAVALAFAKEGHDVWALARSKESLES
                     LRQEGGERIRPHAVDVADEAALVAASQRILAEGAPRVLVNNAGITVSAPLTKTRTEDL
                     ARVMAVNVTAPFLLCRELMPAMAQADGGRVINIGSMAAVRGVKYTSAYCASKHALLGL
                     TRALAVEYAKKQVTVNIVNPGWVETDMFAGATSAISASTGRSVEQARDALASMNAMGR
                     IITPEEVAALCLFLASDAAGGITGTAYAIDGGEPG"
     gene            398704..400344
                     /locus_tag="LILAB_RS01635"
                     /old_locus_tag="LILAB_01665"
     CDS             398704..400344
                     /locus_tag="LILAB_RS01635"
                     /old_locus_tag="LILAB_01665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709013.1"
                     /db_xref="GI:760025878"
                     /translation="MCCAAGIPSPLCATTPATSGAVASNREAGVSGLRSMVLGACLWV
                     GCASSVEDSAGPTAGTPADVTQTPAPGGETPAPQVPATDSRVPPPETSAACSGPDGTA
                     RLAWSHDAAWNRTVDFRGLMDADGNTYWTECESSYWVDKDPSLLACQLVSVTPEGTER
                     YRRDLPPPGAWAAHTVEGDQLFVTGRLALLSARDVATGQERWSVSLGAVKDEDPAAHH
                     ALRIESLVRSPPYLVALVHDTFGDVGAEDLLVAVRADTGAVAWKVPVPPVHAPLVVDA
                     EGNVYGGASDVLAQRTALFSYTVDGQLRWRTERTGVVEPTAVDGGTLLLGRAELVDAA
                     TGASLATLATASAESFYYSLGRSSSPFGRAALQAGELLVLPDMRCATDGCPTTAHPGG
                     TFLYGLDPESGAVRWHRAVGTWPTAPLLTQRGALLLVDRPVNAPCGEYGCTGDDAAIG
                     SFLRELGPDGRELSACALTGKAPYITPPALHRGRVVLGAWTNWDASNDWTQRMSIRAF
                     DLTTPDEPASGGWVSAGGGNTRSGQTKPTGGAARAAGR"
     gene            complement(400363..402186)
                     /locus_tag="LILAB_RS01640"
                     /old_locus_tag="LILAB_01670"
     CDS             complement(400363..402186)
                     /locus_tag="LILAB_RS01640"
                     /old_locus_tag="LILAB_01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_013935438.1"
                     /db_xref="GI:503701362"
                     /translation="MTHSLAARLTVALSLVILCLSTLSVALTGVSLRTWSHETLTSRL
                     AQDEAAWSRVLSQESRALTALARVAAAESPLPAALASGAVAEQLEPALRAKQSLLGVE
                     LLVAVDLAAGVRAGTPGGALAGVERLLKQQGAQVVLVGNVPHLAVAQPLTHEGRAVGH
                     LVLGRILGEQELQALRDERGVEGLLTVGETPVAHALGAVPPDALLAALAGKGRPDMVK
                     VNGVSLRLRRVELGPGVELLLTRDGGKEAEQFRESMLLVVLLGVIVTVAAGAAIFLLV
                     RRMMEPLRELTRATARMVSEADFRGGLEVRSKDEIGQLASSFSELMSQLRELLMALRH
                     SAEQLETASTQLTESASVQNEAVSQQAVALHETQMAAQQLQEASRAAARRVEVILREA
                     DKASGFGEAGEAAVSGSVGGLTHIRSHVEQIGRTVAELNQRTRQVGDITRTVKDLADQ
                     SNVLALNASIEAARSGDSGRSFSVVARQMRSLADQSAGATTRVQSILGDIGRAISQAV
                     STSEGGAREVEGGLEQVRAAGESLRSLAGIIQNNGKTVRSIAEAVSQQDAGIAELFAA
                     LSSMADLADQIVDRMAASEQSAIQLSAASAELSAIVGRYRL"
     gene            402439..403038
                     /locus_tag="LILAB_RS01645"
                     /old_locus_tag="LILAB_01675"
     CDS             402439..403038
                     /locus_tag="LILAB_RS01645"
                     /old_locus_tag="LILAB_01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935439.1"
                     /db_xref="GI:503701363"
                     /translation="MRSPCVPAALALLALTPSLLRAEDVATEARAKAEPAPTTRNFGN
                     LRVGGSTANGNGRPELCLELSPVAFLSVESCGTGSGFLHGDPEPEVAHFRAKLRLASF
                     EVERWGTFQPFLAGGFAEAQVGRDDPGFQFSGTDKRRVATTGPEGGLGLRFLRPLAGG
                     FELVGDFNFSLAWLPHAPELIQPGSTWLPSASLSFGVGF"
     gene            complement(403045..403788)
                     /locus_tag="LILAB_RS01650"
                     /old_locus_tag="LILAB_01680"
     CDS             complement(403045..403788)
                     /locus_tag="LILAB_RS01650"
                     /old_locus_tag="LILAB_01680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase"
                     /protein_id="WP_043709014.1"
                     /db_xref="GI:760025879"
                     /translation="MRMDSAGQSHIGRRPHNEDAFCVAPELGLFVVADGLGGQEGGEV
                     ASRCVVDTFVGFGLRLGQDQDSTWPTVPDPRRSREENLLAACSALAQRNLQAQRVGRL
                     REMASTVVALAVSEHGAAVAHVGDSRLYRLRAGKLESLTRDHSLIEELRDAGMEPPGG
                     SGNLRHLITRALGTDNAEPTVQRLQAEPGDVFLLCSDGLYEPLGTEGLMKRLTLSSAQ
                     EACDALVADAYEAGGKDNITAVVLRVAEA"
     gene            404171..405310
                     /locus_tag="LILAB_RS01655"
                     /old_locus_tag="LILAB_01685"
     CDS             404171..405310
                     /locus_tag="LILAB_RS01655"
                     /old_locus_tag="LILAB_01685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935441.1"
                     /db_xref="GI:503701365"
                     /translation="MSTIRRITASISSARLDTNLESVSPLVPREPLQPVPAVRRGFAD
                     ESEFQAEVDDLDTSLTAHAPKLAGLDGAQVDAEAPEHLRVFAGESSFESAPPRYSQLL
                     GSQLPASLGAPRESVSGAAHRPSSRGPGAQDMGSDLLSPDAAAWELQHRDTSMAPTPV
                     EAEDVLFMLDGPGAAADLEPAVELGLEDLFEEAPRLRAAEDALFSAGAEDVPAARADT
                     EAARLAGLAPTRFDAPVNFATEAAGIDAVPADLATAAAGDARVDDAPAGFALGSAYAA
                     TYGQQFAARQALDAAVSPAGPDAFLADPLDLGTLAPDEPTLDDAAVAGVLGPISANPA
                     AASAPVAAAFASQGVEVVAEALEPEPRPDANPGAAEALAPEEPQG"
     gene            complement(405316..406596)
                     /locus_tag="LILAB_RS01660"
                     /old_locus_tag="LILAB_01690"
     CDS             complement(405316..406596)
                     /locus_tag="LILAB_RS01660"
                     /old_locus_tag="LILAB_01690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709015.1"
                     /db_xref="GI:760025880"
                     /translation="MTPTGTVSAPASRMRHAIWAVPLIPLVLGGMGWWWMDSEAGAEP
                     PGEDAVMEASSPSAMAAPRKPGGALDAPPAGPPPGVAAPAPAHGPEEAERDARRELWE
                     RRLARAKETLAAYMKATRYPPESRPASEHPDQMELAEPERTHPLNMDGSDIQLRLKQD
                     RVFVVGDEVVHFFVGCEDARRVPRPCQVVSALAHEAEHMPGAGGVPAVPLVFTDDGAS
                     GDALAGDGTFTGRFQPSKQGFPIYSGTLRVDVQVRSGSAEGAASFDIMYTPSPPALFT
                     GGVREVLSPEGSLQLYLGIQVQKAGRYVVAGRVDDESGMPFAHVSFNEELKRGEQEVK
                     LTIAGNLVLDEVPTFPLKLRDVEGFLLKERGDPDRELMTSLRGYVHTTKDYPFESFSP
                     AEWQGEERQRYLDEMNREIIEIQRYIEQDEPPPP"
     gene            complement(406621..407508)
                     /locus_tag="LILAB_RS01665"
                     /old_locus_tag="LILAB_01695"
     CDS             complement(406621..407508)
                     /locus_tag="LILAB_RS01665"
                     /old_locus_tag="LILAB_01695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935443.1"
                     /db_xref="GI:503701367"
                     /translation="MKKLFGMVLAAATMLAGTEAAAARYTLWIHGRNSGTTQPGNYND
                     FSYWGPASAQAGVNKKAVNWDGRQRIGTQNERIRDALDCFCTGSNQCYIAAHSAGNLQ
                     IGYALSLYGGSTRQVKNASPNASGVCGNVSGGATQKGWNILWVGVASGAAGGSELADI
                     GEWATSDALVTDLKTTNARAMYNHNETRGKAFYMFAASKGTAYSFVLPGQDDEAVAYH
                     STGGVSGSAGSSQCNPGDWFCGATLNMLTQPSSDGRAKWANHSLVLRDDREAYNHYAG
                     GNWGGIIAPLRQYMADYAY"
     gene            complement(407694..>408299)
                     /locus_tag="LILAB_RS01670"
     CDS             complement(407694..>408299)
                     /locus_tag="LILAB_RS01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551524.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_043712272.1"
                     /db_xref="GI:760029221"
                     /translation="DALCDLSRERGIHLLSDEVYRLLEHDSRDTLPPAPSHTPHGISL
                     GVMSKAFGLAGLRVGWLACRDPALLRRCAAYKDYTTICNSAPSEVLSLIALRAKERVL
                     ARSRALLAENLALLDAFFARHPDTFHWVRPRAGSVAFPRLLRQTPVARFTEDLREREG
                     VLLLPGDVYDFPGNHFRLGLGRANLPDALARLERYVADTSR"
     gene            complement(<408465..409085)
                     /locus_tag="LILAB_RS01675"
     CDS             complement(<408465..409085)
                     /locus_tag="LILAB_RS01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551524.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_043712275.1"
                     /db_xref="GI:760029224"
                     /translation="MRIPDFKLERYFARWEFAAPYLLCSSDIEGWRMADLLALAGPDE
                     QARWEGLTLGYTESTGLPALREEIAALYPGLSPDQVLTFAGAEEALFVLVNVLLGPGD
                     HAIVTWPGYQSLHEVARATGADVTLLRLREEDGWALDLDALRRELKPQTRLLVVNFPH
                     NPTGALLERATFDALCDLSRERGIHLLSDEVYRLLEHDSRDTLPPAA"
     gene            409201..409674
                     /locus_tag="LILAB_RS01680"
                     /old_locus_tag="LILAB_01710"
     CDS             409201..409674
                     /locus_tag="LILAB_RS01680"
                     /old_locus_tag="LILAB_01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935444.1"
                     /db_xref="GI:503701368"
                     /translation="MPTLDIPITLLDPDGGWINTPVHVSELDELPVLLHFFSVKQRGG
                     DEDIDAVKRLIAEFAPRGLKVISVDVTHSAKELRDTNAVEAFARRHGLYHPIAVDDGS
                     MARAYDVADTPAWLVFDADAGRLRHHFSGRNASRHVRQVLERFVQAGAAAPSPAL"
     gene            409689..410735
                     /locus_tag="LILAB_RS01685"
                     /old_locus_tag="LILAB_01715"
     CDS             409689..410735
                     /locus_tag="LILAB_RS01685"
                     /old_locus_tag="LILAB_01715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketoacyl reductase"
                     /protein_id="WP_013935445.1"
                     /db_xref="GI:503701369"
                     /translation="MATRRKDSDSSRFSLGTVAAAGIGAALGLRRILRSRFQFKDRTV
                     LITGGSRGLGLVLARQFVKEEARVAICGRDELTLERAREELERAGGEVFAIPCDVRDP
                     VQVEAMVSAIHERWGAVDVLVNNAGVIQVGPLESMTLEDFQEAVDTHLWAPLYTTLAV
                     LPEMKRRGQGRIVNIASVGGKVSIPHLLPYSASKFALVGLSDGLRAELRQDGILVTTV
                     CPGLMRTGSPRNAYFKGNHEAEYAWFSTGDSLPVTSLSAEQSARRILAACRRGDAEAL
                     LGAPAKLAAVGRALAPGLTATLTAWVNHFMPQDSSQDRYTGSQSETPLTQSWLTELTR
                     RAAERNNETEVPLH"
     gene            complement(410752..411861)
                     /locus_tag="LILAB_RS01690"
                     /old_locus_tag="LILAB_01720"
     CDS             complement(410752..411861)
                     /locus_tag="LILAB_RS01690"
                     /old_locus_tag="LILAB_01720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="teichoic acid biosynthesis protein"
                     /protein_id="WP_013935446.1"
                     /db_xref="GI:503701370"
                     /translation="MLAGMRILYGVVGEGMGHATRSRVLLEALTQEHEVHIVVSGRAQ
                     DYLARRFQNVHGIWGLTLAYEGNSVKKWQTVLRNLTGAVKGWPQNIRQYFELVDAFRP
                     DVVVSDFESFSYMFARNHRLPVISVDNMQVINRCKHEPALLAGHEDSFETSRAIVKAK
                     LPGAFHYLVTTFFYPELRKRRTTLAPSILRPEIIEAKSEPGEHLLVYQTATTNTALPD
                     ILKAAGIPCRVYGLRRDITEDLVDGNLTYRPFSEQGFIDDLRTARGVVASGGYTLMSE
                     AVYLRKPVLSVPLVGQFEQVINALYLEQLGYGMYVKALTVDALKEFLTRVPRCQQALQ
                     GYEQDGNTRMLAALREQLALAYEHRGHWAMEMARD"
     gene            411920..412228
                     /locus_tag="LILAB_RS01695"
                     /old_locus_tag="LILAB_01725"
     CDS             411920..412228
                     /locus_tag="LILAB_RS01695"
                     /old_locus_tag="LILAB_01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935447.1"
                     /db_xref="GI:503701371"
                     /translation="MPAPPEPSPPQRSSLGRSAATGLLGGLLLGGLGLLAVGLKNSFI
                     APGCDGLSSPECQLLTDATREVGRVQTLGGGALTALAASLFVLFRPRPPAPPEGPEGS
                     "
     gene            412365..413270
                     /locus_tag="LILAB_RS01700"
                     /old_locus_tag="LILAB_01730"
     CDS             412365..413270
                     /locus_tag="LILAB_RS01700"
                     /old_locus_tag="LILAB_01730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013935448.1"
                     /db_xref="GI:503701372"
                     /translation="MQLESLKMFCDVVETGSFSRAAQLNHVTQSAVSQQIRALENRYE
                     QKLLSRSARQVTPTPAGERLFRGCKEILARFSEVEQEIREQATEVAGTTTVSTIYSVG
                     LHELNAVQKQLLKSHPKVNMRLNYRRNDQVYDDVILGAAEIGIVAYPQPRAGVDILSF
                     RDDKLAVVCAPGHSFATKQKVSLTALSGVPFIAFDREAPTRKALDRLFREKNIDINPV
                     MEMDNVETIKRAVEMGLGVAILPMATAMGEVKGGSLVAKPFAEGPVSRPIGLLIRKGK
                     YLDRASAAVLEAFKAAANLPTSDEA"
     gene            complement(413278..414594)
                     /locus_tag="LILAB_RS01705"
                     /old_locus_tag="LILAB_01735"
     CDS             complement(413278..414594)
                     /locus_tag="LILAB_RS01705"
                     /old_locus_tag="LILAB_01735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015347031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013935449.1"
                     /db_xref="GI:503701373"
                     /translation="MNARALAITVLARVRATDAYLNVVLDTQLSESPPKDPRDAALVT
                     ELAYGATRRQLALDYAIARFADRKLDALEDKVLAALRIGAYQIFHTRVPARAAVAETV
                     QALKEVGLTRAAGFTNAILRKLADLPAPPLPPASDVALHLSVRESHPQWLVERWLRQF
                     GRERAEAMLVADNQAPAVVVRANTAKVTRDALLTQLQEMGVDAKATTVSPVGITLPPV
                     GRVEDVYGYAEGLWQVQDEAAQLVGVYGAIPESARVLDACAAPGGKSCHQAQSHDVVA
                     VDLHAHKLRKIDAEAKRLGLQPRLKAYAHDAAEPFPEEWGEFHAFLVDAPCSGLGTLR
                     RHPELRYRRKEEDISRLATLQRRILENCQEAVPAGGLLVYAVCTMEPQEGQDQVEMFL
                     RSHPEWTAEPPVLPGLKLPLSQAYLRTLPGPEGFDGFFAARLRKLY"
     gene            complement(414591..415511)
                     /locus_tag="LILAB_RS01710"
                     /old_locus_tag="LILAB_01740"
     CDS             complement(414591..415511)
                     /locus_tag="LILAB_RS01710"
                     /old_locus_tag="LILAB_01740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_043712277.1"
                     /db_xref="GI:760029226"
                     /translation="MRLLVLHGPNLNLLGVRDDTSGGRLEDLDAAMQARAEALGLELT
                     VVQSNHEGDLLDTLGAELEELDGIIINPAGLFGSYCLKEGLEAAGLPAIEVLLKPPAR
                     ESVVGEACVLQIHGGPGFEPYLQALETFGSGVFTTAQPEPKKPLGKKKGSATRGAKVT
                     PITVLKRAPRREGSSETAKSLARAVKAAGPTKTLGRKLAPVEDLRAARQAKTLGRGGK
                     GLTPAADLLTRALVRQKISDRLAGRLSAAELATWARSQYQAVQRGAPAEHGHRELLEE
                     SLQSLTLSNLPATRLSDEQLVDLLTRLDEG"
     gene            complement(415533..416471)
                     /locus_tag="LILAB_RS01715"
                     /old_locus_tag="LILAB_01745"
     CDS             complement(415533..416471)
                     /locus_tag="LILAB_RS01715"
                     /old_locus_tag="LILAB_01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_043709016.1"
                     /db_xref="GI:760025881"
                     /translation="MSRPRIVFMGTPDFAVASLAACFDLGEVVAVVTQPDKPKGRGNT
                     VTAPPVKELALSRGVPVLQPTKLRTPPFSEELRQYAPDICVVTAYGRILPKDLLELPT
                     HGCVNVHGSLLPRFRGAAPIQWAIAHGDAETGVSLMVMDEGLDTGPVLAMKRMPIAPD
                     DTSATLYPKLAALGGEVLREFLPAYLRGELKPVPQPSEGMVLAPIIEKDQGRLDFTRP
                     AVELERRLRAFTPWPGAFTTLGGKLLKVHRATARGGSGAPGTVLAAGPDGIEVACGEG
                     SLVLLDLQPEGKRVMRAADFLQGHKLAPGSQPFVAG"
     gene            complement(416501..417082)
                     /locus_tag="LILAB_RS01720"
                     /old_locus_tag="LILAB_01750"
     CDS             complement(416501..417082)
                     /locus_tag="LILAB_RS01720"
                     /old_locus_tag="LILAB_01750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal protein"
                     /protein_id="WP_043709017.1"
                     /db_xref="GI:760025882"
                     /translation="MSDGNQKTVRPSHIRRTYILDRPFQLKYILLLAGIGAGGIGVFG
                     LLAHRVHVSSVASGVDGGQTLLWLTGLGTLGAAVALGLFGLVFTHRVAGPVHVMSLYV
                     AALAAGRYPRLRPLRRGDELKLFFDRFSEAVTRIREREADEAYALETVLEALRPVATT
                     PEALEALGTLSALHTRKRQAVDTPTGSTFKSVA"
     gene            417186..418781
                     /locus_tag="LILAB_RS01725"
                     /old_locus_tag="LILAB_01755"
     CDS             417186..418781
                     /locus_tag="LILAB_RS01725"
                     /old_locus_tag="LILAB_01755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PBS lyase"
                     /protein_id="WP_013935453.1"
                     /db_xref="GI:503701377"
                     /translation="MTRSLTALCVALSFLTLAGCKGDPATPEYWESNIQQSRRAEDRI
                     RMVEAMRASGKLNEGFLPMLHEQLDTERKPEVRAALARALGDLKHASSVEPLTKALDP
                     AAGDMPAQLANKAIVATLGTIGDRRAIPALVPLLRAKDNYTRIEATQVLGDMKAKEAV
                     EPLIALATDDTVEPFLNKKAIEALGDIGDARAAPALVRMLTKERKGKSFYVESSFALY
                     QLGAPAADALLPALEGQDAELLKWARSNGVNPASYAMKAATVLGDLREKRAVAALLKQ
                     LAFTNADPQIQALVRMQAADALARMRAPEAVKPLAGLVTETDPTVRDAYVRALTRLGG
                     RDALPALEKAAGTGDWYARESAVKGLAMLGDARELPVLQKLAAAEPARTAADCKQADD
                     DGCDDPAALGKQRADQISGQAKLLEAAQACAGNAGCWVQRMEKADPVLLERAALEVGR
                     AGTAEHAVALAARLGERDTEARLALVLAVGWLVEGSRDTAKKLRQAALPTLRKQLADE
                     QGNTRFVSVNEDLRRLVATLDRT"
     gene            complement(418735..420900)
                     /locus_tag="LILAB_RS01730"
                     /old_locus_tag="LILAB_01760"
     CDS             complement(418735..420900)
                     /locus_tag="LILAB_RS01730"
                     /old_locus_tag="LILAB_01760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935454.1"
                     /db_xref="GI:503701378"
                     /translation="MGSLRHHLQAFLRVEPGRPAYGAGLRAALAVGAPLAAAALLHLP
                     AATWVGLSALFVALVDRGGPYGYRARTMGAMTLMGAVVGLAAALHLPAWAAVIVTLLW
                     VTACGFARSYGDTPGLMGVVLANYFVVSLALPARDVSDALLRSGLFLVGGAWAMFLAL
                     LLWPLFPYRPARMAIARCYDALAEHAEEVGRWPLEGLPVAAGVLPVAPWQARMRQLIE
                     QARTVLASTRMGRAGESGRGEHLLVLLEGADAMMVTLIALTEMLEVAPAEPRYHALRS
                     EVQRALAELAADLRRVRLALEKEGGGSGPPAWSAERVKRALAAAGDLPEQARAGYQYV
                     YSLLDRLRDYAHATVDVAARLEDSAPVPDTPSLPSRPASKAPPSSPLEPLRENLNVRS
                     VIFRHALRLGVAASLAMALVSALDLNHGYWVIITVTVVLQPYAGLTFQRSLQRIAGTL
                     LGAGLAAGLVALVRDPAIILLAIVVLFAVAMSLQPLSLAAFQVLLTPALVLLAELQTG
                     DWELAGVRIVNTLLGGLIALAGMRLLWPSPEHLRLPEQVASALRADRDYVMAVASASS
                     DAEAPVREARRRMGLALLSAEASFQRLLGEWRGPARELEPVMALLVYARRFTSAVTTL
                     AASRSERAAPRELADVVRFVVCVLEDLAAAVEQQRRPAPMPTPAPKGGAEPLVRTHVE
                     RLLRQLTVLHHAAERVPPLLFKEGLRSGPASPPAAAGPR"
     gene            complement(421197..421952)
                     /locus_tag="LILAB_RS01735"
                     /old_locus_tag="LILAB_01765"
     CDS             complement(421197..421952)
                     /locus_tag="LILAB_RS01735"
                     /old_locus_tag="LILAB_01765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935455.1"
                     /db_xref="GI:503701379"
                     /translation="MTSQNRIVLTVYAPALIGDDERPLAVVHGMEKALPGLRLEWRVT
                     GSRRLAALPQRDAWLVEKIKDGGFPLVCNGDESYPVTVMGRGSSGLFSPGGQALFEVH
                     AKLPLDAAVVAAAAAMLERVAEGTRAFWGRATPHDAAVDIAYQTAPTLEGPPSPRRGL
                     PALKLFEHIRAPEIPYYLGWLNYWSAAAAQAIGFPDPTRDAELLSRARRTASGGWVVQ
                     LTDAPLDLDDPTHLDTLKRTYERFPEIGGRAAP"
     gene            complement(421949..422857)
                     /locus_tag="LILAB_RS01740"
     CDS             complement(421949..422857)
                     /locus_tag="LILAB_RS01740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002616254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709018.1"
                     /db_xref="GI:760025884"
                     /translation="MRLRACAALLLFLSACATSTPSPRARAPWNPRVANLQRAATLPW
                     MDGGRCVVREASNEWSVLVERCFHTLDHDRITFRDVTGNCSVASAGAAAIGLGVCILI
                     APELIVGAVIVAGAVVVAVAIKEELDAYRRASRERAKPETQARPSNAQARLTHRKLKP
                     EPSGQDGFPPVLTDPLDREHRPECRPVPVPHAGRDAPHNECADRFPPNRYPGMDVFVG
                     GERFDALQVGVRVLWEIKTHRFDTYPDFIQEREIEKELEQIERERKAAAACGYGFIMG
                     VSTQAHKDALLAVVPSLRIVVTGCKR"
     gene            complement(423073..424446)
                     /locus_tag="LILAB_RS01745"
                     /old_locus_tag="LILAB_01775"
     CDS             complement(423073..424446)
                     /locus_tag="LILAB_RS01745"
                     /old_locus_tag="LILAB_01775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712279.1"
                     /db_xref="GI:760029228"
                     /translation="MDFTKAGWLLPLLTETVAFEAGAPAPSVPPLGSGRARARAHLRR
                     TLRATGLLYGTPADAPSAAELAPPTESQARLLEDQLFHAVVRTLALMALELGRLVGTP
                     TAVRTEQLLVLFAVLAGELELARTLEVTIASGRPVSRRLAAKVEASLVKRSPVLAGDP
                     VYGLVLHNGAQYADAQLFCRQAIDYFSRGTLHRERAQRRLDFAARQKALLVDVLTGLA
                     CVDRVPGLSARRAILRQVESLRLPAAMTSELKAAVKQSFARRRPVRDVVRQVRSVDVR
                     HFLLEQTLLAALVDGRKTRRERVFIRELAQALQVSDTELHRLELEMAEFYARHRAIVD
                     VFTVSDAAGAMGDDLVAGIQETLEKNFYRLIQEVRETGDLAVLLTKAARRQPLTGDER
                     QRMRAQLIDVAKAIPALAIFAAPGGVLLLAALAKVLPFSLLPSAFQEAAPVEEDLEDV
                     GPEREAG"
     gene            complement(424620..425462)
                     /locus_tag="LILAB_RS01750"
                     /old_locus_tag="LILAB_01780"
     CDS             complement(424620..425462)
                     /locus_tag="LILAB_RS01750"
                     /old_locus_tag="LILAB_01780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_043709020.1"
                     /db_xref="GI:760025886"
                     /translation="MDMRTKLMAVVAGAAMAFGGTAAAQGTPAPVKPAATTKAPTAAA
                     RGKAEVTWWGHAAFVIRSPGGAVIAIDPWLTNPKAPKGAAQPEALDAILLTHGHFDHV
                     GEAKALAEKTGAKVYGSFELINLLGLPEAQAVGANAGGTFRVKDVTLHLVEAVHSSSY
                     AADPKSPAQYAGAPLGYVLKIDKGPTLYHAGDTGAFEGMSLIATQFKPTVALLPVGGH
                     FTMGPAEAAQAVRLLKVKSVIPMHYGTFPLLQGTPDALTGELKKLRSTARVVTPEPGV
                     TTAL"
     gene            425649..427517
                     /locus_tag="LILAB_RS01755"
                     /old_locus_tag="LILAB_01785"
     CDS             425649..427517
                     /locus_tag="LILAB_RS01755"
                     /old_locus_tag="LILAB_01785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone Hsp90"
                     /protein_id="WP_013935459.1"
                     /db_xref="GI:503701383"
                     /translation="MDHRFQVSLRGVIDLLSHHLYSSPGVYVRELLQNATDAIRARQL
                     LEPGHAGTVRLELMEKQDGSPPTLLFTDDGVGLTEDEIHRFLATIGESSKREALEARR
                     NDFIGQFGIGLLSCFMVCDELLVVTRSARGDGRTLEWRGRHDGTYAVRPSEHPLAQPG
                     TQVFLVARPDMTHWFTAQRLRNLASHYGGLLPFPVHLTTPEGTERLDTSGVPWRREYD
                     SAGERRKALLAYGRELFDTDFVDCIPLRSTAGDVDGVAYVLPASPHFNSRQKHRVYLK
                     HMLLSESAENLLPDWAFFVKCVVNANALRPTASRESFYEDEALAAARESLGQSLRGYL
                     MELAREDPRALQRLIALHGLSVKALALDDDDFYRLIIHWLPFETSMGMMTLADYRRAH
                     PVVRYTSTLDGFRQIAQVASAQGLCIINAAYTHDTSLLEKLPHAVPDVQVEPFSSADL
                     PQSFEELTLDEREATFPLLRMAERVLAPFRCGAVVKKFYPAEVPTLYSADAEGAFRRD
                     VERAREESDDLFAGVLDSVVAAAGGEPAQLCFNLHNPVVRRLAAVADRDMLKLSVEML
                     YVQALLLGHHPLNAQELVLLNQGLLGLISAHLGGEGGRRPPAAPDAATPPGPPARG"
     gene            427763..428890
                     /locus_tag="LILAB_RS01760"
                     /old_locus_tag="LILAB_01795"
     CDS             427763..428890
                     /locus_tag="LILAB_RS01760"
                     /old_locus_tag="LILAB_01795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935461.1"
                     /db_xref="GI:503701385"
                     /translation="MSGDWREQVKALFNQAGALGEGEGKVRLLEEAVRLADTHKDVGL
                     GYRMRDALIDAATFGGFPDKALVAFAWCRGQQKKDPKRFEPEDMFWKQKWVVARIKEF
                     PHITRKQIADALDDVEQCFKATDSGTRAVLKLRYQAAREMGDAAEEVERLWNAWLEAR
                     RDHLTDCRVCELDDELDHHADKGEWQQVLRKAKPILDGRKACAEIPHLTLGTVLYPLF
                     KLGELEQARELHRRGYALVAKNREFLSTVGEHLEFLALTDNLSRGLTLLEKHLGWALD
                     HPSYRDRFTFYAAAAFLLERVLTAGERDVVSLRLPKTFPHHQADGGYDVRALHAWTLE
                     QARDIANRFDTRNGTDRFARLLARNQVLAGEVRPFPVDAKP"
     gene            complement(428903..431242)
                     /locus_tag="LILAB_RS01765"
                     /old_locus_tag="LILAB_01800"
     CDS             complement(428903..431242)
                     /locus_tag="LILAB_RS01765"
                     /old_locus_tag="LILAB_01800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_013935462.1"
                     /db_xref="GI:503701386"
                     /translation="MHAYAAELSQELGLRPEQVDRTLALQEDGATVPFIARYRKEVTG
                     GLDEVQIQTILDRATERAELDARRDTILRTIEEQGKLTPELTRALKAAKTRTELEDLY
                     LPYKPKRRTRAAIARERGLEPLADLLWKQDGRRGEDAAARVRPFINPEKDVQDQAAAL
                     AGARDICAERVAEDAGLRREAREVSARRGTLCSNVVAAKKGEPTKFENYYGHEEPLSQ
                     APSHRVLALLRGEEEGVLKVKLSLPDDEVKGLLAGRVVTKPQSLFAQELRAAVEDGWD
                     RLMGPSLEAELRAELKERADRQAIGVFGENLRHLLLTPPAGARAVLALDPGLRTGTKL
                     AMMDVTGKVVETLTLYSERGADERARAAKLLAAVVQKHKPELIAVGNGTGSREAELFV
                     RDTLKALGSQVPVVSVSEQGASIYSASEVARDEFPDLDVSLRGAVSIGRRLQDPLAEL
                     VKIDPKSIGVGQYQHDVDQGLLKKKLGEVVDSCVNAVGVDVNTASPQLLEHVSGVGPS
                     LAKKLVAHRAAKGRFTTRRELLKVSGLGPKTFEQAAGFLRVRGTEPLDASAVHPERYG
                     VVERMARDLGVAVSALVGNAELVRKIDPRRYLGPDLGELTLKDILAELEKPSRDPRGD
                     FTAPQHREDLRSLEDVKEGMVLQGVVTNVTAFGAFVDVGVHQDGLVHVSQISTRFVKD
                     PSEVVKVGDRLTVRVLTVDLARKRLALSVRAVQEGGAPQPSGRPHVGGATGPGRMTER
                     GGGPPRQGARPPSSSGPQSKPAEKKGPEPFNNPFSKLKR"
     gene            complement(431337..431888)
                     /locus_tag="LILAB_RS01770"
                     /old_locus_tag="LILAB_01805"
     CDS             complement(431337..431888)
                     /locus_tag="LILAB_RS01770"
                     /old_locus_tag="LILAB_01805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_043709022.1"
                     /db_xref="GI:760025888"
                     /translation="MVPGACLTDVRLVPARPEHVDFWLEMRAAPGARRFVETGEDSRE
                     LLLRRILEAGALGRPGARSFRWFVEADGQLAGTVSARELSRAHGRAELGYMMADAYHG
                     RGLGTRAVGLMLEELFTLPFLQRVWLTTLAENAASRGVARKLGFTLEGTLRGHCLFQG
                     QRRDQQLWGLLRDEWASSRASRG"
     gene            432009..432419
                     /locus_tag="LILAB_RS01775"
                     /old_locus_tag="LILAB_01810"
     CDS             432009..432419
                     /locus_tag="LILAB_RS01775"
                     /old_locus_tag="LILAB_01810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935464.1"
                     /db_xref="GI:503701388"
                     /translation="MGLPERRAQKAYETNVFPQQKQRIDEAAHFEVPVEVQWETLMED
                     DYSHLFESAWTTVYIDPLVEAFKGICIDDMGQEALKEKLKKVVIQNKAENASASRIAR
                     FEDGVLTLDHKPFTNIDDEKDRTQAIQKTLEAAL"
     gene            432570..432863
                     /locus_tag="LILAB_RS01780"
                     /old_locus_tag="LILAB_01815"
     CDS             432570..432863
                     /locus_tag="LILAB_RS01780"
                     /old_locus_tag="LILAB_01815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712281.1"
                     /db_xref="GI:760029230"
                     /translation="MLKNTWPRDRHVGPGGGLYTGPGGGLYTGPGGGMSTGPGGGLYR
                     GLGGGLYTGPGGGLYTGHCEQPYRSNLPPREALLEYLARNRLEHLLCLLLQCG"
     gene            complement(433078..435306)
                     /locus_tag="LILAB_RS01785"
                     /old_locus_tag="LILAB_01820"
     CDS             complement(433078..435306)
                     /locus_tag="LILAB_RS01785"
                     /old_locus_tag="LILAB_01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_043709023.1"
                     /db_xref="GI:760025889"
                     /translation="MFPAGWKGALDSRACFLTRATRSAALFDRFKRRSFLQAVVAVAA
                     TTAFGCNDDETSSDAGEKYFPQSVCSGDPRPDSVVLWVRAVDPDNAGGNTQVRLEVST
                     SEDFSSLVLDQTFTALAASDHALKVKVTNLSARTTYYYRFSIDAGGQKHSTVTGRTRT
                     APAPTDTVPVKFVFASCQDYIGRYYNAWQHLLQLDEDLDFVVFLGDYIYETTGDASFQ
                     SVDGRGVIFSEPEKALRQGTGLTAFYAANSLSNYRDLYKNLRKDKVIQRVHERYPFIV
                     TWDDHEFSDDCWGDVATYTDEKTNEKQTERRRNAEQAFFEYIPMEHGESAAGAIDINA
                     VVSQPTRIYRDFEFGQNLKLLVTDTRTYRPDHLIPEDAYPGKVAVPAEQLALVLPTLP
                     EPVQAQLQSDMFAYVDIDAEELAPYKQVLTGVYVQQAVAAGLTAEEAATKAATWITGG
                     QALLYVNQVLNAVNQARVAAGEDAIPAIPVDGTPRGLAFAHMGKTGLFGIQGSRYVVV
                     KPIFDLYAAIKYMGSAGASEGIFGNEQQAWLQESVAQATNAWKIIVSSISLTTMVFKL
                     SDKADVPDPTLRQDFYFNVDQWDGFPTKKQEFLKYLRDSNVQNALFISGDIHASFASV
                     ESGIPALTAPAISSGSIKELAGLAVIGAGFSTGSTVYRYIVAELDKSLKEAHPGMEFV
                     DGDAHGFVVLEVGASEAKAAFHLIPSTEIAKDYSLRQPSELTAKFTRRDFVIKDGTIT
                     AA"
     gene            complement(435473..435766)
                     /locus_tag="LILAB_RS01790"
     CDS             complement(435473..435766)
                     /locus_tag="LILAB_RS01790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709025.1"
                     /db_xref="GI:760025891"
                     /translation="MYGTGISREGDLIDLASNENIVEKSGSWFSFNGERIGQGRENVK
                     DYLREHPEIAKDIEGRVLEKYGIGKTPGAAAAAPEEAAPAEGSEKRGRVKAVK"
     gene            complement(<436038..>436547)
                     /locus_tag="LILAB_RS01795"
     CDS             complement(<436038..>436547)
                     /locus_tag="LILAB_RS01795"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P48292.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_043712282.1"
                     /db_xref="GI:760029231"
                     /translation="IPTGSISLDIALGVGGVPKGRIIEIFGPESSGKTTLCLHIVAEA
                     QKRGGICGYVDAEHALDVGYARKLGVRTDDLLLSQPDTGEQALEIAEMLVRSGAIDVL
                     VVDSVAALVPKAELEGEMGDAHMGVQARLMSQALRKLTGTIAKSQTCVIFINQIRMKI
                     GVMFGNPETT"
     gene            complement(436786..437748)
                     /locus_tag="LILAB_RS01800"
                     /old_locus_tag="LILAB_01835"
     CDS             complement(436786..437748)
                     /locus_tag="LILAB_RS01800"
                     /old_locus_tag="LILAB_01835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709027.1"
                     /db_xref="GI:760025893"
                     /translation="MATVSSVSDAPRIHPPTQRPMDGEAEAPREDVAPWAPLTDTLAR
                     EDAAPWVPSLEDVAPQAPPTAAAAGEAVAPRAPLVAMPGEAVSPRGPPGATSREAPSP
                     SPRSGKPTPPLDLPLPVLVLTEQAQRAPEAERPLIAARLNLQLARMARTGGDRLVADT
                     FLRLLESGRLTGLVDARGRTCRAAAVEALLSLGFPYALEVHPEDLAHLRANAQQRKKR
                     RGKPGTSVAVLVGGLSAQGAHEALFPFRDASLLTSQVGLSLLAMTALWLARPGTPVYR
                     VGLLMLALVSLGGVALALVGAAHTGVWVGLGGLVAALLAALREG"
     gene            437816..438421
                     /locus_tag="LILAB_RS01805"
                     /old_locus_tag="LILAB_01840"
     CDS             437816..438421
                     /locus_tag="LILAB_RS01805"
                     /old_locus_tag="LILAB_01840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma 70"
                     /protein_id="WP_013935468.1"
                     /db_xref="GI:503701392"
                     /translation="MDDADSDAQAMLRVAAGDRRAFARLFDRHHASVARFAFRFVGNR
                     ERAEELTQDIFVKLYRNARAYQPTARFKTFLFRVATNHCLNEVRRGEYRTPRASAAAP
                     DGDDRDGWDREGPQGDRPDAALEGRELERAVGEALADMSARERAAFTMCRFEGMAYRD
                     IADALEASESAVKSLIHRATLAVARRIEALQTGTVPARSRA"
     gene            438418..438894
                     /locus_tag="LILAB_RS01810"
                     /old_locus_tag="LILAB_01845"
     CDS             438418..438894
                     /locus_tag="LILAB_RS01810"
                     /old_locus_tag="LILAB_01845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013935469.1"
                     /db_xref="GI:503701393"
                     /translation="MSCDYEEDLTAYVDGELPPARGARLRVHLDTCADCRATEALLRT
                     TVARVAALPAFEPSPASRRAVMAELDALPAPWWARLKTWPRPAVLVPAAGLVAVLAVS
                     LLLTRAGPGAPLALEDASVMELAANLELAEDYELLGLDDMDDLEVVANLHELEVTR"
     gene            438891..439388
                     /locus_tag="LILAB_RS01815"
                     /old_locus_tag="LILAB_01850"
     CDS             438891..439388
                     /locus_tag="LILAB_RS01815"
                     /old_locus_tag="LILAB_01850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935470.1"
                     /db_xref="GI:503701394"
                     /translation="MRTGNLAAALVLGVALLTGAPARAQAPTPRTAAERFEQMTPEQK
                     EALRAKLREFKAMPPAEQARIRANLRRWRQLPPEERERIRANLRELERLTPAERQALR
                     ERARDLRQLDPAQRAELRQRMRRYLKENPERREQMLENLRRWRRLSPEQRQEVRERLR
                     ERRRR"
     gene            439385..439630
                     /locus_tag="LILAB_RS01820"
                     /old_locus_tag="LILAB_01855"
     CDS             439385..439630
                     /locus_tag="LILAB_RS01820"
                     /old_locus_tag="LILAB_01855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935471.1"
                     /db_xref="GI:503701395"
                     /translation="MRGALPAALCLLLGATSAAAQEPPAPPPPGVPAKPPPPGEPPRP
                     RAPPSDEDQEVVEHLELLESLDAAEDLDLLLELSQED"
     gene            complement(439717..441552)
                     /locus_tag="LILAB_RS01825"
                     /old_locus_tag="LILAB_01860"
     CDS             complement(439717..441552)
                     /locus_tag="LILAB_RS01825"
                     /old_locus_tag="LILAB_01860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002630044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_013935472.1"
                     /db_xref="GI:503701396"
                     /translation="MCGIVGYVGDKESAPILVSGLKRLEYRGYDSAGVAVLNQRKLNV
                     VRATGKLRNLENRVVADQPPGNIGIGHTRWATHGRPSDENAHPHTYKDVAVVHNGIIE
                     NHLALKEQLRSRGHVFSSETDSEVFAHLIAEELERGLELPDAVRAAITQVKGTYALAV
                     LTASDPSRIVCTKDASPMVLGLGQGQNFLASDVPALLEHTRDFVYMEEGDLAVITAAA
                     VDIFNRQGQKVNRPTRRIDWTPMMAEKGGHKHFMHKEIWEQPRAIADTLRGRMLLSEG
                     DVHFEGWNLSAEKVRSLTKVTILACGTSWHSGVAGKHMIESLARLPVEVELASEFRYR
                     DPIVDGTHLAIAISQSGETADTLAAFKEAKARGATAMAICNVIGSAMTREADFSVLTN
                     AGPEIGVASTKAFTTQLVALYLLAVKLGRMRGTLSVPAAQEHLTHLTQVPKMIEDVLK
                     CEPAVTRVSREFMNAQDFLFLGRGPMHPVALEGALKLKEISYIHAEGYAGGEMKHGPI
                     ALIDDKMPVVVIAPKQPHVAYEKIIGNIEEVRARGGKVIAIIDEDDEHVTTLADHVIR
                     IPAACALLAPVVATIPLQLLAYHVADLRGNDVDQPRNLAKSVTVE"
     gene            complement(441660..443060)
                     /gene="glmU"
                     /locus_tag="LILAB_RS01830"
                     /old_locus_tag="LILAB_01865"
     CDS             complement(441660..443060)
                     /gene="glmU"
                     /locus_tag="LILAB_RS01830"
                     /old_locus_tag="LILAB_01865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935473.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-1-phosphate
                     uridyltransferase"
                     /protein_id="WP_013935473.1"
                     /db_xref="GI:503701397"
                     /translation="MSVLAAVVLCAGKGTRMKSEKAKVLHPILGRPLCAYPLKRALEL
                     GATSVVPVVGHQAEAVEKAVRALFPEAPLRFALQREQRGTADAVRSAEEALKGYSGRV
                     LILYGDVPLLRRETLEALLAAHDQAGGKLAMVSTTLEDPTGYGRVLREGGQVTRIVEH
                     KDCTPAQRQVRECNAGIYSVDADFLWKALADIKPQNAQGEYYLTDLVEMAAKLGPVGS
                     VEADATETAGVNDRVELAARARVMQQRINEAHMRAGVSLVDPATAYIEEGVTVGPDTE
                     IGPSVTLAAGTVVGRGCVIGQGSVLQASTVADDTVIKPYSVLEEARVGARNVIGPFSR
                     LRPGTELAEDVHLGNFVETKKARIGKGSKANHLTYLGDAVIGSGCNVGAGTITCNYDG
                     VNKHLTELGDGVFIGSDTQLVAPVKVGDGSYVGAGTTVTKNVPPGSLAVSRTPQVTKE
                     GWVATKKARQAKARAG"
     gene            complement(443072..443278)
                     /locus_tag="LILAB_RS01835"
                     /old_locus_tag="LILAB_01870"
     CDS             complement(443072..443278)
                     /locus_tag="LILAB_RS01835"
                     /old_locus_tag="LILAB_01870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935474.1"
                     /db_xref="GI:503701398"
                     /translation="MSTPAIPENKALPGAAPTAAEVTVFLKPSFGITVQRNTLCVSVS
                     AKARPVDTPPPSDPRAVDDSIPCP"
     gene            443493..445301
                     /locus_tag="LILAB_RS01840"
                     /old_locus_tag="LILAB_01875"
     CDS             443493..445301
                     /locus_tag="LILAB_RS01840"
                     /old_locus_tag="LILAB_01875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_043709029.1"
                     /db_xref="GI:760025895"
                     /translation="MDCSDSARRAEPVKEMSFRGAVLKRGLLTAVMLVACVAQAARPY
                     RGGAVATAYPQASAAALEMLEKGGNATDAAVAAAFVAAVVGPYHSGIGGGGFALVHDA
                     KRGDTKVLDFREVAPKAATRDMYVKDGKVVPGLSTDGALSVAVPGAVAGYLELLKAHG
                     KLKPAVVLAPAIAAAKRGMWVTPRYRTMAEGRLACLRRDAEASRVFLVKDAQGQWEAP
                     PVGHLIRQPDLARTLTAISKQGAKAFYAGPVAKAIATSVQAGGGILTQEDLAAYKTRG
                     ATPLAGSYRGHRVLTMPPPSAGGVAVIQVLTALEQLRPQGLAFRDAEALHLYVEAVRR
                     AYVDRAKHLGDPAFVDVPLARLVSAGHVADLAGSIDPKKATPSASLLAPKEGVRGSTL
                     TDEPTTLTPEPEKKNTTHISVIDKDGNAVAMTTTVNYGFGSCMVAKGTGVLLNDEMDD
                     FAAQPGVPNAYGLVTGEPNAIAPGKVPLSSMSPTLVFSKEDPKRVMLAVGSPGGSTIP
                     TTVIQVISNVVDHGMDVARAVNEGRVHHQYLPDEVWVDRWGLEPATLSALEAKGHKIR
                     RVEQWGDAEAVYSDPKTGLRFSASDPRNEGAALGQD"
     gene            445305..446087
                     /locus_tag="LILAB_RS01845"
                     /old_locus_tag="LILAB_01880"
     CDS             445305..446087
                     /locus_tag="LILAB_RS01845"
                     /old_locus_tag="LILAB_01880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_013935476.1"
                     /db_xref="GI:503701400"
                     /translation="MPTPPPIFDAHLHPEGLSDQDLESMRFFGVERALVVAHHFPEPT
                     SKALLRHFDDLVERQLPRLERLGIRAYAALGVHPRCIPRRGLSEVLSALPGYFQGGRV
                     VALGETGLHAGGEEEEEAFLEQLALARGLKLRVVVHTPTADKERHTRRILTLLRQSGL
                     LPSRALVDHANARTVRTILEVGHWAGLTLHPEALKAERAVALVRRLGSERLMLDSDAG
                     DGAGDILGLARAANLLAKASLSERIVRRITHENAARFFQVSG"
     gene            446357..448315
                     /locus_tag="LILAB_RS01850"
                     /old_locus_tag="LILAB_01885"
     CDS             446357..448315
                     /locus_tag="LILAB_RS01850"
                     /old_locus_tag="LILAB_01885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="WP_043712283.1"
                     /db_xref="GI:760029233"
                     /translation="MAAPRPPEPDAGRQLTFTPERFLAACLRDVRQAEARIQAMLALP
                     TPRDVDAALTAYDDAMALLDDAHGRGNLGANTHPDAAFRAAAERCAQATDGKRTDVSL
                     NPRVYAALAALELSGQDAATRRWVDLVLRGFRRAGVNRDAATRARLRELNDTLTRLGQ
                     AFSQHIREDVRYVDVAPDALEGLPDDYIRDHPPGPDGRVRITTDPSDTLPFLTYARDG
                     RAREALWRAGQQRGHPRNLETLSRLLQARHDLATLLGYPSWAAYASEDKMVRHQHVAE
                     AFIEQLATATATRVKDDYAALLARKRREVPGAARVEPWEQTYLKEQVRAERHQLDSRE
                     LRPFFEYTRVKQGVLDITSRLFGLTYRRVTDAPAWHPDIETWDIYEGPTRLGRFYLDM
                     HPRPDKYAHPAQWDLATGRAGRTLPEGVLTANFPRPGAHPALLQHAQVQTFFHEFGHL
                     LHHVLGGRARWASLSGSRTERDFVEAPAQVLEEWAWRPESLRTFARHVDTGEPLPTDT
                     ILRMRRAEAFGKGLWLRQQLFYAAVSLQLHASDPAGVDTTARVYALQERYMPFPALDD
                     TYAHLSFVQLDGYYSSAYYAYLWSLVIARDLLTPFLEHGLMDPATAQRFRDTVLGPGG
                     SRDAADLVRSFLGRDYGFEAYTRWLDDA"
     gene            complement(448427..448705)
                     /locus_tag="LILAB_RS01855"
                     /old_locus_tag="LILAB_01890"
     CDS             complement(448427..448705)
                     /locus_tag="LILAB_RS01855"
                     /old_locus_tag="LILAB_01890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935478.1"
                     /db_xref="GI:503701402"
                     /translation="MAYDGELVKMENGRWARFQRCQVYRPGVEDAGETMLLIAVELEE
                     RFQRQLDAAADSLAQYRYQGVPVQVRFDADAQGITLQPEQSVSAPAVH"
     gene            448956..449183
                     /locus_tag="LILAB_RS01860"
                     /old_locus_tag="LILAB_01895"
     CDS             448956..449183
                     /locus_tag="LILAB_RS01860"
                     /old_locus_tag="LILAB_01895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935479.1"
                     /db_xref="GI:503701403"
                     /translation="MKLPGLFRKERTTIQAADAQDHAERLLAESLRMLGQVCGKVADA
                     IEAQRLSRQGYPHNTYLRRTDGDEDDSAKKA"
     gene            449199..450146
                     /locus_tag="LILAB_RS01865"
                     /old_locus_tag="LILAB_01900"
     CDS             449199..450146
                     /locus_tag="LILAB_RS01865"
                     /old_locus_tag="LILAB_01900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013935480.1"
                     /db_xref="GI:503701404"
                     /translation="MATDSDADVPVPCLATAPTWRDAGITLPMPGLHDSEGPRLPDSL
                     PPVVDAHVHLFPDRVFEAVWRWFDRYGWPIRYKLHTRQVVSFLLSRGVQRVVALHYAH
                     RPGMARALNAYVAEVAREEPRVLGLATVLPGEPEATAVLEEAFAAGLRGVKIHCHVQC
                     FAPDAPHLHEVYAACAKAGRPLVMHAGREPSSPHYNCDTYALCAAERVERVLKDHPTL
                     KLCVPHLGADEFDAYARLLERHDNLWLDTTMALAGYFPVPLPRRALEVRPERILYGTD
                     FPNLPYAWDRELRTLLGMKLDDAVLAGILGQNALQLYGA"
     gene            450305..450682
                     /locus_tag="LILAB_RS01870"
                     /old_locus_tag="LILAB_01905"
     CDS             450305..450682
                     /locus_tag="LILAB_RS01870"
                     /old_locus_tag="LILAB_01905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011551495.1"
                     /db_xref="GI:499870761"
                     /translation="MSHILVVDDDASHRTLICDALEEMGYPTVQAANGREALDLLEGD
                     MPSAVLLDLRMPVMSGWGLLDALKKMPRARGLPIIIISGYGFEWEAELVGAAGYISKP
                     VDLDKVRMTVQQIAGPPEMSLVH"
     gene            450773..451594
                     /locus_tag="LILAB_RS01875"
                     /old_locus_tag="LILAB_01910"
     CDS             450773..451594
                     /locus_tag="LILAB_RS01875"
                     /old_locus_tag="LILAB_01910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013935481.1"
                     /db_xref="GI:503701405"
                     /translation="MTPSPTDDLAVDARGLQKRFGGFSALNGLDLQIPRGAFYAYLGP
                     NGAGKSTSIALLTGVYGPDAGTIRMLGVDAVARPMEVKRRVGVVPEELSLFERLTGRQ
                     YLTFCARMYGLDGDEAAARAAELLELTELTYKAGALVAEYSKGMRRRLAIAAALIHAP
                     ELVLLDEPFEGIDVLAAGVIRELLRELSRRGVTLLLTTHVLEIAERLATHAGIIRGGR
                     MLDQGPVGSLLSRYECPSLEAVFEKLISVPASRNARLSFYGEAPASVTPLRRETA"
     gene            451591..453246
                     /locus_tag="LILAB_RS01880"
                     /old_locus_tag="LILAB_01915"
     CDS             451591..453246
                     /locus_tag="LILAB_RS01880"
                     /old_locus_tag="LILAB_01915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935482.1"
                     /db_xref="GI:503701406"
                     /translation="MSRPAVPGFFRHLWLLWGLRFDIGLNQGPGRSRLLAVAAFAASS
                     APGALLGLTFFALMRLKPIAQSEVWPFFILNLLCFVTFSVWVTWPLLSAGVDDHSELS
                     RYAAFPISPFRLLIASTVASLFEPRALVFYAPLTGAALGFASVYVLYMPWLAVVLYVL
                     FALLCAAWSRVALYAVINVLREKHSAEIMGGGLALFLLGASFIPPIDTSWLTAVGEAG
                     VDALDMSLIINAAVALGRVPPGLFGDALAQLAWHRPRVAMAEAAALLFFTAVGMAVAY
                     ALLMRFHRQAGRAGGSRKDSGDSNPFATTKTRYTTLVTREALDLWRNPRARLLASVPF
                     ILAILLKLLSGRDLFVFVLGASADAWLMGGLCIYGAVVIASTFSQNTFAYDGQGFAAF
                     LAAPLDLADVLRAKNQVQGAAALAMAALVALFYRVYFGFGTALDMLCAMAAVATVVPM
                     LLAAGNFLSLYFPVKFHASLKRRDKVPLTASMLGILAASAGCMPFGWALKLAGKDGPT
                     WHTAAMILLAAALNVALYRGVLPLALRLLERRREVVLQAVTRE"
     gene            complement(453386..454645)
                     /locus_tag="LILAB_RS01885"
                     /old_locus_tag="LILAB_01920"
     CDS             complement(453386..454645)
                     /locus_tag="LILAB_RS01885"
                     /old_locus_tag="LILAB_01920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935483.1"
                     /db_xref="GI:503701407"
                     /translation="MDRKFLSRAALSAAVVTALSAALALATESPIFKPVEKPASAKAA
                     TPAAQAQPAASQKPAPAPPSQQQKPVTARPEIEVVFVLDTTGSMSGLLEGAKQKIYSI
                     ASRIAQGRPTPRLKVGLVAYRDVGDEYVTKRFDLSDDLDTVFANLRKFEAGGGGDTPE
                     HVGRGLGEAVSKLSWSQNREVMKAIFLVGDAPPARRNDDWDFNFWAKKAREKHIVVNT
                     VRCGGDAKTAVAWRAVAKLTDGTFDSIDQSGGMVAVATPYDEALAKVNAELSTKTLYT
                     GRREVQAENKARAASMARLAPEAAAERISYMKKTRGAGAGGAPASSAPKAVGGAVDLV
                     EAPSALAGVSQDELPAELKGLSAEAQAAKVKTLSEEKKALEKKAETLAAEREAWLTKN
                     APAKEDAFDANVMKGVKAQAAKHGIAY"
     gene            454808..455707
                     /locus_tag="LILAB_RS01890"
                     /old_locus_tag="LILAB_01925"
     CDS             454808..455707
                     /locus_tag="LILAB_RS01890"
                     /old_locus_tag="LILAB_01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deacetylase"
                     /protein_id="WP_013935484.1"
                     /db_xref="GI:503701408"
                     /translation="MRVFHSDSYEVPLPPGHRFPMEKYRLLREALLARGVLPPESLTE
                     STPSPREDLARVHTPRYLDALFQGTLTEAEQRRLGFPWSPELVRRFAAAVAGTVDAAR
                     AALQDGIGGNLSGGTHHGFPDHGEGFCVFNDIAVAIRALQASRDIRRAVVVDLDVHQG
                     NGTAAVFAGDDSVFTFSMHGENNFPFRKQPSQLDVGLPDGTGDAAYLDALALYLPEVL
                     DRAGACILFYQAGVDPLTEDALGRLSLTHAGLRARDRLVLEAARQRGLPAVLTLGGGY
                     AKPLSATIDAHAGTYEVARALFR"
     gene            455729..456499
                     /locus_tag="LILAB_RS01895"
                     /old_locus_tag="LILAB_01930"
     CDS             455729..456499
                     /locus_tag="LILAB_RS01895"
                     /old_locus_tag="LILAB_01930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709031.1"
                     /db_xref="GI:760025897"
                     /translation="MPGCHDGRMLARTRRTQNMTPSLRRPLLGGLFLACCALALSCGN
                     DGPFFRLAFSLPDTLTAAPGESFPVEFTVLREGDDQSAFRVDLQSAPEGVTLTPEFVL
                     PENEASVTATATFAVAQDTQFRGMTRALLTATNAAETFATSANLFLVILQPPVAQPDF
                     SIAVEPRQVDLFAGQNEKVRITVTRAEGFTGPVTLSLETPTRRIGMQEVTIPAGETFV
                     EPYINTDRGMTRVPVAASLIATSEDGRQASTGISVNVR"
     gene            456671..457048
                     /locus_tag="LILAB_RS01900"
                     /old_locus_tag="LILAB_01935"
     CDS             456671..457048
                     /locus_tag="LILAB_RS01900"
                     /old_locus_tag="LILAB_01935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor I"
                     /protein_id="WP_013935486.1"
                     /db_xref="GI:503701410"
                     /translation="MSISPTRRQAALDALALDDEALLKACEVDYFIASGPGGQHRNTT
                     ASGVRLTHAPTELSVSATERRSQVQNKGVALERLREGLKALTFVPKVRRATKPTAGAK
                     RRRLEGKKRTSEKKALRSSKSGW"
     gene            457289..457699
                     /locus_tag="LILAB_RS01905"
                     /old_locus_tag="LILAB_01940"
     CDS             457289..457699
                     /locus_tag="LILAB_RS01905"
                     /old_locus_tag="LILAB_01940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935487.1"
                     /db_xref="GI:503701411"
                     /translation="MPLLTAFPSPSPSSRSRARRWRLWAPLALTLATPAAWAQDTDAA
                     PAPGAAPELDYATEAKSAEPSGLVVRVAPLEQTQFIVENAERVRVQAPAVVEVSLGEP
                     NQLAVQGLSPGVSEVLVWRQGIKRPLSVRLEVAK"
     gene            457696..458400
                     /locus_tag="LILAB_RS01910"
                     /old_locus_tag="LILAB_01945"
     CDS             457696..458400
                     /locus_tag="LILAB_RS01910"
                     /old_locus_tag="LILAB_01945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin cleavage protein"
                     /protein_id="WP_013935488.1"
                     /db_xref="GI:503701412"
                     /translation="MSRRDARGATLLEVSIVLAIIAVLAALAYAGYAQLSARTSPQNA
                     AADLSGALAEARARAVDRQADVWLIVYPDLDPAGQAGGHGAWFLVEDRLRNFGDAAAP
                     AGQLTFSTFSPPLDIHPTADQGRLMDSMYMDRYTQRTVRFGATGNLAWTGIFEGLPVS
                     DCSFCSGAPRRGAIVFRGDGSARFVDGAGQPVIPAGNGALNRAASLALTSTDGQREYL
                     FAISAPVGFVDTRTNR"
     gene            458397..458951
                     /locus_tag="LILAB_RS01915"
                     /old_locus_tag="LILAB_01950"
     CDS             458397..458951
                     /locus_tag="LILAB_RS01915"
                     /old_locus_tag="LILAB_01950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin cleavage protein"
                     /protein_id="WP_043709034.1"
                     /db_xref="GI:760025900"
                     /translation="MRRLNPASRRAAMRGATLIEGMAAAAILAMGISGVFGGLIFASQ
                     QNAAANRLSQASAIAAQVRSGLQLQGRARLFAGTGPLSAARCAGAAETLELAGGLSTL
                     PDACVVDLDAFDSATGDPLLKVVPGYSTEESEDYRRVLVWTPAQAIDSVAVVVSFRSA
                     GQRRYVKQFVALYNPAENGAGVEL"
     gene            458948..460135
                     /locus_tag="LILAB_RS01920"
                     /old_locus_tag="LILAB_01955"
     CDS             458948..460135
                     /locus_tag="LILAB_RS01920"
                     /old_locus_tag="LILAB_01955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin cleavage protein"
                     /protein_id="WP_013935490.1"
                     /db_xref="GI:503701414"
                     /translation="MSTPRTPARRGFTLIELLVGITVSSVVLLAVAATIIAVNDIFQK
                     NTVSKTAVEGSRVGMDYLNRTLRYAGYGLDPAIAFDFGTDGLPEDRKDNYTEEVEDWG
                     SFVTDDLAFRYRDPMYLRRGQLDGTGAPPFQLTLEPAANFGQPLRQGQAVLVACPGGQ
                     DYFLGRLAADVTADGTTASLETALAAGIPGDVPKGCMTDSTRMPFVMLVQEKRLRVEA
                     HGGRPYLVVKHGWAEDADFDPIAADVESFQVSYQMNRPPANSACCAGQAAPDGAVGSG
                     MAWVLGDEDAVMLPKYDADVPPPTYSTPYDDALRYNMNTANIRSVGVGLTVRSVRPMP
                     SGKKNQARRLFNAEPVNGEDTFFRTTVETSVRIPNMTSRAFFIPELRAAGVAGDLKNV
                     WGG"
     gene            460141..460638
                     /locus_tag="LILAB_RS01925"
                     /old_locus_tag="LILAB_01960"
     CDS             460141..460638
                     /locus_tag="LILAB_RS01925"
                     /old_locus_tag="LILAB_01960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935491.1"
                     /db_xref="GI:503701415"
                     /translation="MTHFASRRGSALAITLIALTVLLLLVVGAITFTGRNQSAAVSKT
                     RSDRVEACAETARRYLLSRLKVFGTGAVPVTSISLEQVLQDDQVVADSSTMRTAHMGD
                     TESAPTAAVLATSSFSSGKDQVSDAANTLREGTAGGSYYRVVVMCDEPGGRQAETEFV
                     FRFGI"
     gene            460671..465155
                     /locus_tag="LILAB_RS01930"
                     /old_locus_tag="LILAB_01965"
     CDS             460671..465155
                     /locus_tag="LILAB_RS01930"
                     /old_locus_tag="LILAB_01965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein tip-associated
                     adhesin PilY1-like protein"
                     /protein_id="WP_013935492.1"
                     /db_xref="GI:503701416"
                     /translation="MKALLSSLTALAALLMAPAALAQDPASCSLQSTSRLDALLNPAR
                     GSDERFFTSPSGPPNILLILDTSGSMAYWPIAWSNNDYYSYIDNRNGASPGCRQENID
                     ALNYDASVEYPRMWLSLTNQDSPWFVPTSYYRFDGNGSGTQESFGMGNNPVRFDQPPP
                     NTTISDSAATACANIVDTGNNSTRAAARAACAQCLTTKGYFQYRKNERIASGNFLNFY
                     SPRGHSAVNVISQVLKDSERTRFGVVTFSASRDATGTVKWSGQDVVRFEQFGPRCDQS
                     LNQTERNNHRNNLLVKMNRGLQFNTGTPLTQVMWGASTYFRSSEDDPFPGWFGSGYMR
                     DSDFDDEAEPGRAATCFTCGFNAMILLTDGEPNEPGNHDDQIPSQVRDLDVPCSNCTA
                     ANQGGYSGGTASHIHRIAKWMWTHDMRPELDGSQQVATYTVGFALTNTRALNLLRTTA
                     DAGGGRFYAATNSSQLKTALQSIVDDVQNRNIAFAAAAISSFQTGSSTLSALMPRMSP
                     ASGDSAWRGDLWRFNQFNEFVEGVDKNADGDMDDIFVVDRDGDIVVEDTSGNFVKDGG
                     STPANQFWEARRALLARSLDSRKIYTVTDSNQDGRLTAADNAATPIEFTVANRETLKS
                     YFGILGTPVCPTVESVSPLEIDPGKLLTGLGLTPQQAAAAMSVTVPTFSGMTQAQNWV
                     NDICVRTLIQYVRGQDLADEDGNGNRTEVRRSVLGDIFHSAPVLVDPPMDKFLCNLGM
                     SNQCTRTLYSQQLGVSPTPLATEDINRCGDTVEVDAYDAYLHRYRRRDKLVLVGANDG
                     MLHAFRDSTAGSDNCEGGMPMIEYTPSTGEEEWAFIPPDLLSRLHEMANGHQYYVDGD
                     IMVRDVWADGSDGSQPDGIKQSTEYHTMAVISEGRGGVHYLALELRADAGTGRFGAPR
                     MQWMYPQPDSAEAALFGKTLFSLSPKPPPIGPVLVEAGTAPGGVSRYEVNTQERWVVA
                     LSGGWSPGQEKGRGIYVVDAWSPEVNGRTDNLWWKFEFDPNATSEQHGPARHLTHSVA
                     APVALVDYGVAGSVQQDGFFDTAVFGDMRGQLWVARMSVPGALDPSTGLIRNWSAARA
                     FQMDRDSVGPNGVQGNSLTRTWPFYYVPSIGIQPGTGAMRALVGTGDRYALLDDQAGI
                     CRFDNPQACARYGCGNVEVDYQVDRIGENITEARHQWTQRGLAQTTLTRGTVSQPACG
                     EPGQTVVSARFSRYEARTCPGAPQDYTSMSPARVECGKDAAGNFRCHDVSNVAPNFAD
                     LELTRTTNAIGKNRFYGVRVYGVSGQTFAEDATAVSADGPMTASQFDAARLSDRTSDN
                     DTSGDLVNVTDITCDASGACSDTGAAPESPGWMLEYSDDITHKTAGGAATVASCTLWN
                     VIYPSQDGEVCSSTAARARFYQADFLSGLPNCAASFDNARFQERSVLSPPPEPATAVM
                     ISPTGSVKYSAVMQEPGQRQATSVDVSENSEVLQNVYELPLTQEQHACRHEDAARCLP
                     "
     gene            465224..465646
                     /locus_tag="LILAB_RS01935"
                     /old_locus_tag="LILAB_01970"
     CDS             465224..465646
                     /locus_tag="LILAB_RS01935"
                     /old_locus_tag="LILAB_01970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935493.1"
                     /db_xref="GI:503701417"
                     /translation="MPALEDAIALAVAAHHGQRDKAGQTYILHPLRVMMRLDTDEERT
                     VAILHDVVEDTPYTLERLRELGYPEGVLAALDALTRRQGESYEAFIERLRPLPLARRV
                     KLADLEDNMDVRRLAAVTPKDAERLARYRAAWARLREP"
     gene            complement(465743..468457)
                     /gene="acnA"
                     /locus_tag="LILAB_RS01940"
                     /old_locus_tag="LILAB_01975"
     CDS             complement(465743..468457)
                     /gene="acnA"
                     /locus_tag="LILAB_RS01940"
                     /old_locus_tag="LILAB_01975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935494.1"
                     /note="catalyzes the conversion of citrate to isocitrate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_013935494.1"
                     /db_xref="GI:503701418"
                     /translation="MTDSFGTKSQLKVGSATYDLFSLGKLAKSHPAVNRLPFSLKVLL
                     ENLLRHEDGRVVKREHVEKMLAWDPKATPDVEISFHPARVLLQDFTGVPAVVDLAAMR
                     EALASMGGNPDKINPRNPADLVIDHSVQIDSFATSAAFKENAELEFERNRERYAFLRW
                     GQSAFKGFGVVPPDIGICHQVNLEFLAHVTFRQGSTVYPDTLVGTDSHTTMINGLGVV
                     GWGVGGIEAEAALLGQPITMLIPQVVGFKLNGKLPAGATATDLVLTVTQMLRKKGVVG
                     KFVEFYGSGLKNLSLPDRATIANMAPEYGATIGFFPVDEESLNYLRFTGRPDDLVALT
                     EAYAKEQGLWRRDDAEDPVFSDTLELDLSTVVPSLAGPKRPQDRVPLKDMKAGYEKSL
                     VEMLSAGKGKGGEEGGKAAAVPPERLAQTVTVKNGRQSYQMGHGAVVIASITSCTNTS
                     NPAVLVGAGILAKKAVERGLNPKPWVKTSLAPGSRVVSEYLRDAGLLPYLEAVGFHIV
                     GYGCTTCIGNSGPLTEPVANAVTEGDLVVAAVLSGNRNFEGRINPHVRMNYLASPPLV
                     VAYALAGEVGTDLDNEPLGTDPNGRPVFLRDIWPTNEEIQEVIRTSVKPEQFRSQYAN
                     AMEGDALWQQLPVGKGATFKWDETSTYVRKPPFFENLPAEPKATQDIKGAHVMALLGD
                     SVTTDHISPAGNIAKTSPAAKYLMANGVEPKDFNSYGARRGNHEVMVRGTFANIRLKN
                     LLVPGVEGGVTVHIPTRERMSIYDASMKYQAEGTPLVVLAGAEYGTGSSRDWAAKGTM
                     LLGVKAVIAKSFERIHRSNLVGMGVLPLQFEAGQDAQSLGLTGHETFDITGVAQDLAP
                     QKKLTVKATGEGGTKEFTVVCRIDTPNELDYYRHGGILQYVLRQLAKG"
     gene            complement(468625..469974)
                     /locus_tag="LILAB_RS01945"
                     /old_locus_tag="LILAB_01980"
     CDS             complement(468625..469974)
                     /locus_tag="LILAB_RS01945"
                     /old_locus_tag="LILAB_01980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_043709036.1"
                     /db_xref="GI:760025902"
                     /translation="MSRRFPDTGWHRQTGCEAARVAGSRGRPHRWEAMGEPEALTEQS
                     GEADTGAPTPPGPVPEHGPVWSPNVSGLLLSRYYLPRRHPVMQGNACQLLRDGVEAYP
                     AMLEAIRGARRYVRLETYMFVSDAVGELFGEALAQAAERGVHVKVLYDAVGSWTSRRS
                     FFAGLRARGVDIRAFKPFSLSRGLRHLLRRDHRKILVVDGEVAFTGGVNISAHWAPAG
                     VGAAWRDDVLRIEGPAVHELERCFSATWRMMFQGRFHRLTRRLERLRRQPSRQGGVGL
                     AVLSSRRSIHRAYLHAIRRARRSVLVAAAYFIPDRRMVMALREAARRGVEVHLLLNAR
                     SDHPLLEFMARGFYERLLGAGVRIFEWQRGVLHAKTAVVDGVWGTIGSFNLERLSLAF
                     NHEVNAVFADPRLGQQLEDSFRGDCGDCREVTLAEFRRRPLWQKLLERALLLLRKII"
     gene            complement(470014..471582)
                     /locus_tag="LILAB_RS01950"
                     /old_locus_tag="LILAB_01985"
     CDS             complement(470014..471582)
                     /locus_tag="LILAB_RS01950"
                     /old_locus_tag="LILAB_01985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_013935496.1"
                     /db_xref="GI:503701420"
                     /translation="MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRR
                     HCRIFLDGDAYSVEDQGSANGSLVNGSPVKTQVLEDGDKLTLGPVTFIFAMLTDEPAT
                     GEEELPAGAQEGDGSTRIVSLDSLKRQRNKGVALAPEGADQDELDEIREGATRNNLQA
                     LRPVSQGQSGSRPAAIERSAPAAVPARRPASAPPPARARPAPSAGGGGLSAAERARIR
                     RESPGIVSSAKLFWADASQGVRTGIIGGGVALVLGLFGVLYWLVLSGEDGQPVGEEPA
                     WLSGQPIRDGFGLGPGATWERADMKVFEWEYTAATRAVVILHYQAQGISKDEVVVSVN
                     GVDVGKVPPDTLASQDRSIELMIPAQHLKKGEPNRIIFDNVKNPPGEDPWVIWNIWVE
                     RALLPDLLPEELVREATEYHKRGLKHFQTPDIGARNRYEAWKSFRVSWLMLEAHPEPK
                     PDLYYDAQERMKAAQQELDRTCSKLLLEVEGYYNQGNYKSASATLDHVKEYFPEYDQP
                     CATRAEAKRAEYGL"
     gene            complement(<471588..472631)
                     /locus_tag="LILAB_RS01955"
                     /old_locus_tag="LILAB_01990"
     CDS             complement(<471588..472631)
                     /locus_tag="LILAB_RS01955"
                     /old_locus_tag="LILAB_01990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551478.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_043712287.1"
                     /db_xref="GI:760029237"
                     /translation="MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRR
                     HCRIFLDGDAYSVEDQGSANGSLVNGSPVKTQVLEDGDKLTLGPVTFIFAMLTDEPAT
                     GEEELPAGAQEGDGSTRIVSLDSLKRQRNKGVALAPEGADQDELDEIREGATRNNLQA
                     LRPVSQGQSGSRPAAIERSAPAAVPARRPASAPPPARARPAPSAGGGGLSAAERARIR
                     RESPGIVSSAKLFWADASQGVRTGIIGGGVALVLGLFGVLYWLVLSGEDGQPVGEEPA
                     WLSGQPIRDGFGLGPGATWERADMKVFEWEYTAATRAVVILHYQAQGISKDEVVVSVN
                     GVDVGKVPPDTLAN"
     gene            complement(472638..473567)
                     /locus_tag="LILAB_RS01960"
                     /old_locus_tag="LILAB_01995"
     CDS             complement(472638..473567)
                     /locus_tag="LILAB_RS01960"
                     /old_locus_tag="LILAB_01995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013935498.1"
                     /db_xref="GI:503701422"
                     /translation="MSNVHERLRRLLFLVPYVSKHPGVTVDALARALNVSREDLLEEL
                     DLLTCVGRPPFNPDDYIDIYVDNDRVYVDLDQRLFAPPRLTPGEAAALAASAELLRPA
                     TGDALQSALQKLERVLPPATRERYREMYRKIDASTEAPQALGPLTRAIIERLEVTFGY
                     ASPGRSPEPRTVRPYELLSHRGQWYLQGYCHTRQDARLFRLDRMEDITVTDVPFQPPA
                     DARADVPNPARGLTDASVRVRFSPVAAPYVKERFGRDARPLADGGVEVLVAGDSERWL
                     TQWVLSFGGEAQVMEPASARAAVARAARASVGL"
     gene            complement(473564..474586)
                     /locus_tag="LILAB_RS01965"
                     /old_locus_tag="LILAB_02000"
     CDS             complement(473564..474586)
                     /locus_tag="LILAB_RS01965"
                     /old_locus_tag="LILAB_02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_013935499.1"
                     /db_xref="GI:503701423"
                     /translation="MDRTERILDLVALLLDAREPISWAELREHFPADYGGSDDAAERK
                     FERDKAELVELGFPLTYVQGDDERRDGYIVDRDAYYLPEADLSKEELAVLYAAGSAAL
                     ASGAFPGRDDLAHALRKIGFFAGQSLPTPRVRMELGSVHEGQEKEVSARLEQLWDACA
                     ARKWVDVTYASPKQAGTTQRRVDPYGLALRRGAWTLVGYCHLRASLRSFHVHRIRELK
                     VNTARPRTPDFQVPADFSLDSHVAYFPWQHRFHEQVEVVLHLSGTLASRAASLLPGAA
                     LEPAEAGAVRARLPVTFVDGLLRFCLALGPDCRVEGPERAQARLREMASRIVASHEDS
                     QDKVSA"
     gene            474853..475371
                     /locus_tag="LILAB_RS01970"
                     /old_locus_tag="LILAB_02005"
     CDS             474853..475371
                     /locus_tag="LILAB_RS01970"
                     /old_locus_tag="LILAB_02005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712290.1"
                     /db_xref="GI:760029240"
                     /translation="MPHGRRGGRRLRRDLTMSRITLVRNVVAGLAMFVGVTSTAAPAP
                     VRAEPLYFAVEVRRDGRLVAQPKLLGETGRTLRAERRRPGAPLPDYRLVLTPRAEGKS
                     FLLQLDLQLPEAKGHSELALLHGQERKLQLGSVPGELEVSLLLMKVDSPEFRALMQLG
                     ESSGASSSTSSI"
     gene            complement(475376..476509)
                     /locus_tag="LILAB_RS01975"
                     /old_locus_tag="LILAB_02010"
     CDS             complement(475376..476509)
                     /locus_tag="LILAB_RS01975"
                     /old_locus_tag="LILAB_02010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935501.1"
                     /note="catalyzes the formation of glutamate 5-phosphate
                     from glutamate in proline biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl kinase"
                     /protein_id="WP_013935501.1"
                     /db_xref="GI:503701425"
                     /translation="MSWISTGRTALRAARRVVVKIGTNALTNATGRFNRHHFDALGQD
                     LLWAAQGRELVVVSSGAIALGVERLGLPSRPRDIPGKQACAAVGQSRLMQAYEEAFAA
                     RGKAVAQVLLTHEDVQERRRYLNVKHTLERLLTAGVVPVINENDTVSVDELKFGDNDT
                     LAGLVAGVVEADALVLLSDVEGLYTGDPRRDADAELLATVLQVTPEVLALATGTTSGV
                     GTGGMSTKVRAAARASESGIHCVITSGAVPGRLRAVLEGEDVGTLFEPTGSRRSARAA
                     WIAHALRARGTLTVDAGAREAIVTGKRSLLPSGVRGVEGDFGRGDPVDLVGVDGAVFA
                     RGLAAYDANELRRIAGRHTADIEAVLGYRYLDEAVHRDDLAVL"
     gene            476631..478283
                     /locus_tag="LILAB_RS01980"
                     /old_locus_tag="LILAB_02015"
     CDS             476631..478283
                     /locus_tag="LILAB_RS01980"
                     /old_locus_tag="LILAB_02015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein HflX"
                     /protein_id="WP_013935502.1"
                     /db_xref="GI:503701426"
                     /translation="MKEIYGNTLGLKSSEQHRLRNTFRRRVPPHEIVSPELARHLTEL
                     SRETNRQVGVLVNRKGEIEHVIVGNAHKLELPDIGRARAGQVRLRGLRLVHTHLKSEP
                     LTKDDLTDLALLRLDCVAAIGVEHDGLPGVLHYAYLVPENGSGEFWNVESLPSVHVAQ
                     PDLMDTLGALEEEFNRKAASRKVGGREKAILVAVCLDGNRALAESSLAELKELARTAG
                     VEVIDSVLQVKREADPRYLIGRGKLEELNLRSMQSMVDLLIFDKDLTPSQGRHIGEAT
                     SLKVLDRSQLILDIFAQRAQSAEGKLQVELAQLKYRLPRLVQSDDSLSRLMGGIGGRG
                     PGETKLEIDRRRVRERITHLEKRIDAIGRERSVRRAQRNRRELPVISIVGYTNAGKST
                     LLNAITNAEVLAENKLFATLDPTSRRLRFPQEREVIITDTVGFIRDLPKDLVAAFRAT
                     LEELYDASLLLHVVDAADPARDEQVEAVENILDSLDLMEKPRLMVWNKADLLPQDEVE
                     ALLRTRGGVAISAATREGLATLLAKADTTLFAEGATEAIGAV"
     gene            478331..478756
                     /locus_tag="LILAB_RS01985"
                     /old_locus_tag="LILAB_02020"
     CDS             478331..478756
                     /locus_tag="LILAB_RS01985"
                     /old_locus_tag="LILAB_02020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935503.1"
                     /db_xref="GI:503701427"
                     /translation="MSIPTLTPLLLAQADYAKPVSSLSPKYIELLEQNSHIIYPIVAI
                     LTLVIIAAGVLQAWRTQDLDGLQKNEFKRAIVNELRRNISGMPGDLLAKSVGLDRLKT
                     NRLLEQMQQEGLVVSHTNSQRLTVWRVRGATPDAAPRRY"
     gene            478888..480204
                     /locus_tag="LILAB_RS01990"
                     /old_locus_tag="LILAB_02025"
     CDS             478888..480204
                     /locus_tag="LILAB_RS01990"
                     /old_locus_tag="LILAB_02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006412131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712293.1"
                     /db_xref="GI:760029243"
                     /translation="MVAPEQFDRFRQHIDPVWVEEAVVATGFASMRRRRLPADQVVWL
                     VVGMAMMRNESIERVASFLNVALPAGTAPKPVAPSALTQARQRLGDEPMEYLFNTTAS
                     AWAHRSARAHPWRKLAVYALDGTTVRVPDSADNWEQFGGNPGNGIRAGSAYPTVRAVA
                     LMAARSHLVAAVRFGPYATGEVTLAAELWSQLPENSVAIVDRNFTAVRDLLEIATGAK
                     NRHWLVRAKAHMKPVLLEKLGPNDELVELPVTRHMRASSSKPMPEAVRMRAIRYQRPG
                     FRPGVLLTSLLDPKKYPAEEVVQLYHERWEIELGYDEIKTHLLDRQETIRSRTPQGVR
                     QEVWGILLAYNLVRVEMERAADEAGVEPTRISFINALSLIRNAWLVWSTPPLAPGRIP
                     EHLLDLRRHLGLLLLPERRSERRFPRVVKIKMSNYNKKWVKRPRPN"
     gene            complement(480217..481224)
                     /locus_tag="LILAB_RS01995"
                     /old_locus_tag="LILAB_02030"
     CDS             complement(480217..481224)
                     /locus_tag="LILAB_RS01995"
                     /old_locus_tag="LILAB_02030"
                     /EC_number="1.1.1.94"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DCL2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_013935505.1"
                     /db_xref="GI:503701429"
                     /translation="MRGSVIGSGSFGTALANVLAVNCEEVRLWGREASVVEAINAQHE
                     NPTYLKGIPISERVRATTNLEEALAGSELVVLATPSHATREVVAKAQAYLPRHVPIVT
                     VSKGIENETLLTMTELLEDCLPEEFHPYLAVLSGPSFAKELARRMPTVVTIASHWDKV
                     ALRCQKALQTETFRSYTSTDVVGVQYGGALKNVIAIAAGMADGLGMGHNARAAIITRG
                     LAEITRLAVRKGANPLTLSGLSGMGDLVLTCTGELSRNRHVGMELGKGRKLPDILADM
                     KEVAEGVKTARSARDLELKTGVELPICHQVYLIAHEGKSARSAVVDLMTRQPKSELAG
                     V"
     gene            complement(481236..482147)
                     /locus_tag="LILAB_RS02000"
     CDS             complement(481236..482147)
                     /locus_tag="LILAB_RS02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020477758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709038.1"
                     /db_xref="GI:760025904"
                     /translation="MPAPAPSEATAPAPSGPAGPPPRNPAPDTSWAQPAEVSAPSRND
                     APDDAAWESFPGATAVPRAEEAATLPQLPEVPPLVPVDEAAIPKPPAAPVATRPPPVP
                     NRVSLLGARTVGEGGLAAGLSLGFPTVSARVAVGVLRRLDVLAGVDSAYGLMNELRLG
                     ARWMVFDGGPRWSLGVAVEGSHAFFLRPASVEERGARYLSGRRNWNVQPGIVGNLQLR
                     GARAPRLFLDVRYLLTLDTEPIQGVPLGGLPPDVEFSSAFPIRVGAEVPVSEKTSYAV
                     TLGGDIRTRPDEADFMPVISFGVVTGF"
     gene            482590..483189
                     /locus_tag="LILAB_RS02005"
                     /old_locus_tag="LILAB_02040"
     CDS             482590..483189
                     /locus_tag="LILAB_RS02005"
                     /old_locus_tag="LILAB_02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043709040.1"
                     /db_xref="GI:760025906"
                     /translation="MRVGGRAALFMALALAACRSRPADPPAADAGGAATPIERAAVPD
                     CEVLLSENDRELMLPGFTMKQERACPTCGPLCSFRSDADPDIAVSIAWDCNARHAQAD
                     VHALMAPTLQAGGVEVPALGRAAVRRAPAQGMSQVLAWDDDTPCALVITWLGGETERA
                     VEVARAALIATTPAVLDAGTANGQAPDAGDADAGPTGAP"
     gene            complement(483213..485222)
                     /locus_tag="LILAB_RS02010"
                     /old_locus_tag="LILAB_02045"
     CDS             complement(483213..485222)
                     /locus_tag="LILAB_RS02010"
                     /old_locus_tag="LILAB_02045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935508.1"
                     /db_xref="GI:503701432"
                     /translation="MRRTLLATVVVSMLAAPACEDREAQATWTQASGSVALSRDDAFL
                     YVVDSDNGVLAVVDTARREKVGEVKVGLLPERVAVGPDDTVYVSNRGSRSVSVIRRGD
                     WSEAARVAVGVEPVGLSVSPTGDTLYVVNSTSRESSRHGSLMAVDTRSLAVRWELPVG
                     DEPRGIALAQGGKRALITRFRQGDLVSVDLTDADRPRVAREKTDLYARANTRDGAAAS
                     PDGLTPLPPSPDIRFQPRGMSSVAVTPDGERALATVMWAREDPLSPDGTPTPPTGGSL
                     YGGGGPCNTGGVVAPGLVTFDTDTGTPRVDDLDRCRPPPELAPDFPPSTIISPESTHP
                     IQGPVAAVVDPTGLWAFVVNRETDNVAIIPTGRRSGSDLMSGMGSTVRQLVRVGSGPT
                     GIAMTRDGRRAYVYNAFDHTVTTLVSDGAGGTANVRTEGAPLPIAGDVLAPNEVAGRK
                     LFFSALDSRMASTSVGASCASCHPDGREDGHVWGFPDGPRQTPSLAGRGMTKTGPFHW
                     SGEFSTMRDFLDATVRHRMGGTVLDGVMVAQLSDFIDVLPAPDNPHKGEVLTEAQARG
                     EAVFRKAACDACHGGEHFTLNTQADVGTFVTTGPLQDNAAVREVGLNTPSLLGLARTA
                     PYLHDGSAASLKDRLLQGRESNQHGVTAQLTDAEVDDLVEYLLTL"
     gene            485422..486951
                     /locus_tag="LILAB_RS02015"
                     /old_locus_tag="LILAB_02050"
     CDS             485422..486951
                     /locus_tag="LILAB_RS02015"
                     /old_locus_tag="LILAB_02050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935509.1"
                     /db_xref="GI:503701433"
                     /translation="MSRTPPRFLNFRRTFALLIVLVVVPSAGLSGFGVVAIINERAAV
                     EKRLEAAWRGTLESLSEELPRILASASLEAVEGRLQFILPDGQSVSEPEGGFELEEGQ
                     VRTRDPQLTEALTAVLPEAGGLPTEPTVFSLTAGGRAVLVAAERRGPVVHGVRLSVQA
                     LEARLAERVDSRAVSSEPVRFALLPVPRDTSEGGLMGRLVSEVAQARASALGPTGLAE
                     RVLPSPLQDFRLVVLPTGEDPVARASTRNRVLYGVLLGLFYLTLTFGVVYTGRALYRE
                     AQLSRMKTDFVSLVSHELRTPLTSIRMFIETLALGRLKDPAQMQEVLTLLMRETERLS
                     IFVERVLDWARIEGGRKVYQRELVAVPELVGAAVEAFRTQRMEDGVDLSVDVAEGLPR
                     VDVDRAAVAGALLNLLQNAYKYSGPDNRRITLLARGGGKWVDLSVEDNGVGIAAKERK
                     RVFERFYRVDNLLTRRTEGSGLGLAIARRIIEAHGGRISVQSEPGKGSRFTIQLPAGK
                     A"
     gene            486948..487649
                     /locus_tag="LILAB_RS02020"
                     /old_locus_tag="LILAB_02055"
     CDS             486948..487649
                     /locus_tag="LILAB_RS02020"
                     /old_locus_tag="LILAB_02055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013935510.1"
                     /db_xref="GI:503701434"
                     /translation="MSSDKTRRILVVEDDLSILTGLSMNLRFEGYEVLQAQDGRTGLA
                     RALDESPDLVVLDVMLPELNGFEVLKELRQRGRDTPVVVLSAKGLEPDKILGLNLGAD
                     DYVVKPFGLQELLARIKAVLRRRYPSAGAGSPPPVTFGDVSVDMAARTVARAGTQVEL
                     TAQEFKLLAHFLAHPGRTFTREELLSGAWGYHYEGSARTVDNFMRQLRLKFEPDPEAP
                     RHFLTVRGLGYRFER"
     gene            complement(487657..488355)
                     /locus_tag="LILAB_RS02025"
                     /old_locus_tag="LILAB_02060"
     CDS             complement(487657..488355)
                     /locus_tag="LILAB_RS02025"
                     /old_locus_tag="LILAB_02060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015346966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_043709042.1"
                     /db_xref="GI:760025908"
                     /translation="MGGHDARGRMPLSLVGQEPDLLFYTRQAAEHGGPVLVLGAANGR
                     VVWALAGHGFDAVGVDPSEVMIRSAEEQRSTEPEDIARRARFQVADLRSLRLPERFPL
                     ILAPQHALGLMPGKDDLEALLATVRHHLTPEGTFVYDVLNTPREPVLPRDDEAPSAGL
                     EPRRPLFALHLRERRQPGGPSPIRRLKLRHFTPEELDAALTAAGLVPRERYGRFDGKP
                     FDLEDSRHIGIAGP"
     gene            488566..490230
                     /locus_tag="LILAB_RS02030"
                     /old_locus_tag="LILAB_02065"
     CDS             488566..490230
                     /locus_tag="LILAB_RS02030"
                     /old_locus_tag="LILAB_02065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935512.1"
                     /db_xref="GI:503701436"
                     /translation="MKRGWGWAGALFMAGVVGATGCGSGSDSTGAEDLDVPPVQSPQN
                     PEGDAGTPDSGIPGEPDSGTPDDGGTPDDGGTPDDGGTPDDGGTPDDGGTPDDGGTPD
                     GGPVEVPLPTPSAANWEFFGREAGGPRFIHGVTADASGNIWVAGGEEGLFLMKKGERT
                     FRKFTMADGLRPYGYMPDGSVPPGPKYLKVISVAGGWNDTVFVGYEGMPGDGALHCEN
                     NWDGNAPDPARYKSGDADRVSLRADGTLDVVHYDISSGPNVVDAELRGREKLCNIWRI
                     AYDANTNSVWFGANHGFARGDADYQGNPTCNGQLLCSGVEEHSHPGINAYIYADPAGD
                     RQRYGEDRSQWSVRDALLTDAYYGLGVRPDGDVWVGGANRTTRYFYGSVGNDFWEGQT
                     RTESAAYAWNRIDIWKDAVGEERYSRPEERTDDLVSGIALMGSSVWVGSFGHGIAELN
                     DSGQVVRTLKNELAAPHVASVAADPANGSIWAGHSWGGGLSRVHGGSVTLYGLSVFGR
                     ELSTLRVPDIQVDRSGPRRRILVAFQGATLSDGTVMPGTIGIYSGD"
     gene            complement(490309..490892)
                     /locus_tag="LILAB_RS02035"
                     /old_locus_tag="LILAB_02070"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(491024..491326)
                     /locus_tag="LILAB_RS02040"
     CDS             complement(491024..491326)
                     /locus_tag="LILAB_RS02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712297.1"
                     /db_xref="GI:760029247"
                     /translation="MGGLTENVAVVHVEERRLVRTIPGFYGYACNLDFHPAGHLLAAS
                     HDGRGFALHHFDTGEVLFRASDGDDLQTSDAVFSPDGRFVAWGQGDGTVGLWAVAD"
     gene            complement(492078..492659)
                     /locus_tag="LILAB_RS02045"
                     /old_locus_tag="LILAB_02080"
     CDS             complement(492078..492659)
                     /locus_tag="LILAB_RS02045"
                     /old_locus_tag="LILAB_02080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712299.1"
                     /db_xref="GI:760029249"
                     /translation="MPDARPEVKPVLGNRDELIDALRQRLAGSFRWAGVSVALGALAV
                     LYGASSFQQALDSGRYRWPFSAQLPVWGSLLIVIGLVAFWLAPRYTRRLVRSVESDVR
                     TELRMTVERKRVPGDDEHFLFVATLYTPDQRHVVLRNVHFHQGDKPLQYPYKKGVTQI
                     PVQVYGRPGEGPIVIDAGWGFLLPANLTYPWYK"
     gene            492950..494314
                     /locus_tag="LILAB_RS02050"
                     /old_locus_tag="LILAB_02085"
     CDS             492950..494314
                     /locus_tag="LILAB_RS02050"
                     /old_locus_tag="LILAB_02085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_013935516.1"
                     /db_xref="GI:503701440"
                     /translation="MPVLPPAPIPSHTVIGARTQGERLSAQLFHLVLLDTERAGTVFP
                     LANDALRVGKAADNDVVIDHPTVSRNHLVVRRQGDRFLVQDLGSTNGTFLDGAQVREA
                     FLRPGALLEVGDVRLRFSPQVSPVQVEPILEDRLGDLVGRSLPMRQIFALLQRIAPTD
                     STVLLVGETGSGKGAAAKATHKLSPRATGPLVVFDCASVSDSLIESELFGHEKGAFTG
                     AVSQRIGCLERANGGTLFLDEIDDLALDLQPKLLRAIEDREFRRLGASSPISFDARII
                     VASKKDLWAETQAGRFREDLYFRLSVFTVSLPSLRDRKEDIPLLVDAFAGEGLWPRLP
                     EKIREQFTGHTWPGNVRELRNALERARHMVDIPELAGDSLLREFTREAPAAAGDSLPV
                     EFTGPFKVCKDELIRAFEREYLTRLLGRAKGNIARAAREAELDRKHLYSLLHKYGLVQ
                     SETD"
     gene            494453..495097
                     /locus_tag="LILAB_RS02055"
                     /old_locus_tag="LILAB_02090"
     CDS             494453..495097
                     /locus_tag="LILAB_RS02055"
                     /old_locus_tag="LILAB_02090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935517.1"
                     /db_xref="GI:503701441"
                     /translation="MKRPSPWLAMLFAGFMSMHATGCFGQFQLTQKIWNFNKNISGNK
                     FVQWLMFLVLTIIPVYGLGAFIDAIVINSIEFWTGSNPVASVDGAPETTRIVKLSPTD
                     TLRLSRDVETGVMRMELEREGQETMVRYFEPLEDGMVVRDDAGAMLIQAQEATDGAVA
                     VTDAAGTTLTVHARDALAVARRVYEEGGAQALAQHTVAQASMSQGLAANTCVAR"
     gene            complement(495200..495775)
                     /locus_tag="LILAB_RS02060"
                     /old_locus_tag="LILAB_02095"
     CDS             complement(495200..495775)
                     /locus_tag="LILAB_RS02060"
                     /old_locus_tag="LILAB_02095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935518.1"
                     /db_xref="GI:503701442"
                     /translation="MTRAVRALAAVGLSALMAGAGLAACGLADNSLGGSVSELFPLEV
                     SRVEVRRNAEAFQVSYYRNNDLDVDLVVRLTVSTEGLDLRPGSKVDLAGTTPSGQARA
                     TVVHLNAGEPARVFGPVNKGDLQLESGGNPGESTRGNFSMSFSRGDGYGAGRNLEGTF
                     AVVAQDATFGPEPGQLLDGGVPPPDAGTPPD"
     gene            complement(495772..497118)
                     /locus_tag="LILAB_RS02065"
                     /old_locus_tag="LILAB_02100"
     CDS             complement(495772..497118)
                     /locus_tag="LILAB_RS02065"
                     /old_locus_tag="LILAB_02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935519.1"
                     /db_xref="GI:503701443"
                     /translation="MKRHAWALGLVLALGCGKDGNPTPPDAGGNPDGGPIDTSPFAKF
                     VVDADEGQFDPISSIAMAVGPQDRIGMAYFVRNGTRTEDVENSDVMYREFNGGQLGAA
                     ERIATVQRVYGISVAFGPDGQPVVTYLGGDREEPSSFWFQSDLAVAYRSASGAWTERI
                     TVRRSDEAQPVNPVTDVGFLVGLNPAIVFNGNEAIVAYRDGHSGNFGRQDWESSDLEI
                     ASGGPTTWQRRVAMSSGENKHGYGAHISLVMAGSQPAVVHDTAPEGAQATGTDVHFQR
                     RNADGLTWTAPVRVQAVSNTQLGASLAHDAEAGFGIAVLEKNGDRLTYTDCADTSASA
                     CTATGNWSAPDPVFNSGTGGWYPSLAFDPVHHEPSIAFYICALESGRNDTNCNPNDDA
                     LVISTRIQGIWRETLVDSGGGWSPKLAYLSNGKRVVLYRAPVVAQDKGVLKLAVER"
     gene            497252..497908
                     /locus_tag="LILAB_RS02070"
                     /old_locus_tag="LILAB_02105"
     CDS             497252..497908
                     /locus_tag="LILAB_RS02070"
                     /old_locus_tag="LILAB_02105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 2-dehydrogenase"
                     /protein_id="WP_013935520.1"
                     /db_xref="GI:503701444"
                     /translation="MTRARSNRGRLSRRSLIQRLTFLGGGVVLLGPACKRSSEPKEKA
                     PPADTGPLAAKQDGQGPRTFSSFEYAVVAAATERILPRDEDPGAVDANVPVYIDRILQ
                     TPELEPVKDDFLSGVAALERRAQRMHQKGFAALTAEQQDELLTLFKDSPPRSGEAHFF
                     ELLTVMTLEGFLGDPSYGGNQGKVGWRLMGFDTVGTLASAPPEDYDGPKCLRECGVHR
                     "
     gene            497905..499563
                     /locus_tag="LILAB_RS02075"
                     /old_locus_tag="LILAB_02110"
     CDS             497905..499563
                     /locus_tag="LILAB_RS02075"
                     /old_locus_tag="LILAB_02110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935521.1"
                     /db_xref="GI:503701445"
                     /translation="MSLPEVDVCIIGSGAGGAPMALELGRAGFKVVLLEKGPHYQPKD
                     FIHDEILNSRRNFFMPVPWEEPHLVRQGAAGRYEKTSAAWTANCVGGGTVHMSGFFYR
                     LKPVDFRLRSTLGAIPGSTVADWPISYEELAPFYDKAEAELGVSGESVPHPFAEPRKG
                     PYPLPPLDVHPVAKEIDKACGAMGWHSLPTARGILSKPYRGRAPCSYCALCGSYGCET
                     GAKSGTNASLIPAAVATGNVDLRPGCMARTVEVDKQGRARSVVYLDADGVTREQPAKV
                     VVVSCTAVESARLLLNSTSSRFPRGLANGNGLVGRNLTFSSFGESHATFRLSRQAAAR
                     PWLKDPSPFVNRSLQDFYLMPDARFGFRKGGTLGFMWAHPNPIHAAVGLAGKGQTALF
                     GKALKDKMREYRDSRILQFEVYAEFLPTAGTYVSVEGGVKDRYGIPVAAITVDRHPMD
                     LAATRFLVERGEEVLLRLDPDDVRRGTTTGETSILQHGTCRFGNDAATSVLDRHCRAH
                     EVPNLYVVDGSFMPTGGSVPSTLTISANSFRVADHLVRKLKGGR"
     gene            complement(499560..500129)
                     /locus_tag="LILAB_RS02080"
                     /old_locus_tag="LILAB_02115"
     CDS             complement(499560..500129)
                     /locus_tag="LILAB_RS02080"
                     /old_locus_tag="LILAB_02115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712303.1"
                     /db_xref="GI:760029253"
                     /translation="MKGSQRVRSRMDIHASHEGLKMTPVVTVFGRKSQAAAVLLFASL
                     WGACDGTREDFIGARVQDTCGAAWPVCDRVAGCILGSESYSEGRFPGRQQLIVQLKEA
                     STVKVSFFLEDVSAAGSETVVQFHEEGCRARIRRATEGRAVLDLMERQGAFTEEAELT
                     GVGDHLIEFESDMQARYIVKVDVAPLRNR"
     gene            500092..500529
                     /locus_tag="LILAB_RS02085"
                     /old_locus_tag="LILAB_02120"
     CDS             500092..500529
                     /locus_tag="LILAB_RS02085"
                     /old_locus_tag="LILAB_02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935523.1"
                     /db_xref="GI:503701447"
                     /translation="MSMRLRTRWLPFIFFALAGCGNEVELPQAPTLFIDRAALTFNRE
                     FEHGTYVGQTTFNSLAIQNRGLDPLDITAITLSAPGVFTLQLPEGFTPGTPLRLETYE
                     RAFLTVAFRPTDDTEYDGTVTIESNAANTPQQVITLNGLGVAP"
     gene            complement(500583..502994)
                     /locus_tag="LILAB_RS02090"
                     /old_locus_tag="LILAB_02125"
     CDS             complement(500583..502994)
                     /locus_tag="LILAB_RS02090"
                     /old_locus_tag="LILAB_02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043709044.1"
                     /db_xref="GI:760025910"
                     /translation="MRNDAMPTSVRLLPLTLLVLAACSSGGGETPDAGTPAVEDLCNS
                     REDALTRPECELKPGEPLERFLALDSEPRAGDQDWYRIVLPAGTNARTLLNVNGAYLA
                     ASTAVNLSVTILGPLPNGEEGALAKKEDKHAQGAPRPVDIVLPLRDGLENQTLLVLVQ
                     DAPDVPSRPNYDARNKYRLTVRIDQNPDEQEPNDTHETATPLVLTQSGELLMGASTGY
                     LATDNDVDHYTFDLEAGKIVYVRVVAPNLDFVPNWRLSYELWRPGFTEKEDEGVVLPQ
                     VRGGELATARKIKVGHAGRWTLVVKGYRGTNDRDTAQGDLTQPYEVEVRVLEEEDPQD
                     QTTPDVPDDHDDNDKVQWATTRNLSAATPGGTGSAVSFTGRLGYISDRDWYAVQLPAF
                     GTSSLLRYRLVPLDSGGRFPTLPVTASRVLHVFTLSAVGDNLNEWRENCATRPEVCPR
                     DFSENPDARALVDGFCRRTDLPAPMCVHSSREEAVDNARFTGLSNFRGVIPVPAHAGV
                     VTYYFLVQDNGSWVDDRDYRLEVSWDAEDADELARYVDGAEAPVQRPMASTTAFPAPP
                     DTAEFSVSGQLSHGHGRLRSGTDRLNGLGVRGPLDYDAVPSDVDSYVFDLPTVPPPED
                     RTWLLQWEVQKLADGGTPHGLALDLTFCDADAPDAGTGSCVPVRAGNRGPLTLGYRSD
                     ALRAWHTPANAGTSSLQPLYQLEDRPGSTVVTLAPYACGCLERRFIRGGTLRVDVTAS
                     ERLDYERVDYTLRTGHGDYPQSYPVDGGTTVACPAVTDGGTTPDGDGGVIQNYAGGCN
                     FTYQP"
     gene            complement(502991..504739)
                     /locus_tag="LILAB_RS02095"
                     /old_locus_tag="LILAB_02130"
     CDS             complement(502991..504739)
                     /locus_tag="LILAB_RS02095"
                     /old_locus_tag="LILAB_02130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935525.1"
                     /db_xref="GI:503701449"
                     /translation="MSRAVRVLAGALVSVVLVMACTDSYLYDPRRDTDVPVDRAVALD
                     GRFCTVGSNEVVRPIKLVVAMDASQSMRVSDPDGARATALVELIQNLPRDPEVSLAVM
                     LFAGSTTAFLTQQPGNPPQDGFVQVSSMDDAALRRLTEQLLTFRNPDTSPNRDSTDFV
                     KPLSDIYSLINTDIARSRLDPGGPQALAQARYSVIFLSDGKPTNDQDDELLRGDAVVR
                     IRQLRDLVEEVRVNTVHVFNPTQPVSSVCDLTGDGGCPMLIINQNADRLEQMATLGGG
                     NFRDFRNNEPINFLDFTFGQVRRAFIMKELVAFNFSAPPGSPVDEADSDGDGLTDARE
                     LELGTDPHKVDTDGDGFSDGVEVYFRDRGVDFNPTQEALPDGGGLDRGCPPALRGVDS
                     DCDGLLDCDEQFVGTNATLADSDRDGVPDGVEWLGGTQGASNDLDEDPDNDGLTNRME
                     LRMHTRPLEVDTADLSVNGYRYAFEADGPPDDLGRQCYRFRVENVLLAPTSASTDDAG
                     VVQRGAGFNDIAMSVAMVPGDDPTARTLIRTFRVNDVRYPVGGIKSPADGVIRVEPEQ
                     FVDGCPGRPDDVPPTP"
     gene            complement(504736..506715)
                     /locus_tag="LILAB_RS02100"
                     /old_locus_tag="LILAB_02135"
     CDS             complement(504736..506715)
                     /locus_tag="LILAB_RS02100"
                     /old_locus_tag="LILAB_02135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935526.1"
                     /db_xref="GI:503701450"
                     /translation="MRRLVRTSLLAAGLLASGLWSCSDAMLESRVDALSNLDDRLTLQ
                     GRVCTRPPNPSGFPVKVVVVIDESGSMCVSDPPGAQLDSGFCQRREILDIIPEGVTEP
                     ARVRALKRLVQQFREVNAQGGNVQVSVAPFETNVRNVWPPATTGDRFARPDNNIDSYI
                     EGLQSQLGKGTDYQGALSYAYSLISSDINAVAQSNPELLPRTRYVVVFLTDGTPYPRC
                     SATDNLSVYADPDNPDLTWADSLTDFCNLTNTTDQIDGFEVGTDRNQNYQLFSYVRRL
                     MELKDQYNVGDLRMHTVLLFNQEAVRACGPICQDIYGVYPGVEQARYPEAAKKIAAWL
                     LRRFADMGNGVYQEFNDTGEISNLGLGALDYSSFASRNVMKTLMVESLSSAPGDTGRV
                     LDSDGDGVPDAVDNSFTLKTNTFVADSDGDCLDDGFEHRREDQGFKAANDLDARGCNP
                     ASPLTPNCVCRDTDGDGLSQFAEDYLRTRTGIVDSDGDGVPDGLESRWGLDPLENSVA
                     GLDTDGDGIPDYQELRAGSDPTRRDKAFHERFGYQYETRIAEVRPDGSLCYDFTISNL
                     QLVTPPDRAGVKQGYNLFKVWFAEAPESGVSTDYGVWRTACAWAQYAPPSVRVPLGPE
                     LTFEDGDFRRPDTLSNPWNNQNDCVGIPPSGSANP"
     gene            complement(506750..508078)
                     /locus_tag="LILAB_RS02105"
                     /old_locus_tag="LILAB_02140"
     CDS             complement(506750..508078)
                     /locus_tag="LILAB_RS02105"
                     /old_locus_tag="LILAB_02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thrombospondin"
                     /protein_id="WP_013935527.1"
                     /db_xref="GI:503701451"
                     /translation="MTRARFASALTLGAFLVLSPAGALAQSNNNPDNPECLGDRCGMP
                     LEQGGGCGCGAGGSVWVNYTDDGDTLSYTDDADGDGRADDRDNCPFVSNRDQADDDGD
                     DVGNACDNCASLSNFQQRDADGDGIGDDCDPDQDNDGHNNDVDNCPLVPNTNQVDTDR
                     DGLGDVCDLDDDGDGISDGEDNCPLVYNPDQVLPEDVTVCRVDADNDNISDSSDNCPG
                     VPNPDQRDTDADGVGDACDPDMDGDSVLNTQDNCPAVDNRDQRDDDRDGIGDACDTRY
                     CLVTNSERPDDCLDPKAPFTVSAGGLFRTEKAGITIRPPLFANRNGAAMEYEWAVVKR
                     PSGSTAVVERPQGAVTLSRDWQYMYVDGSVPTFVPDKKGEYQLQLTARLAFSDRVFPD
                     QRVSTSTLTVFVGDESEGGTNCSSVPAGFSATALGAALLSVLMRRRRSQQ"
     gene            complement(508249..509838)
                     /locus_tag="LILAB_RS02110"
                     /old_locus_tag="LILAB_02145"
     CDS             complement(508249..509838)
                     /locus_tag="LILAB_RS02110"
                     /old_locus_tag="LILAB_02145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935528.1"
                     /db_xref="GI:503701452"
                     /translation="MRALTRSVWLIPVLLLSCSDAGLYALNGRGPGGKDRASFSGTVC
                     VPLAGGEAFPTKVIFALQGGEGVEREVVGFATEALSTLSSRFSGPFVQFSLVAYHTVA
                     TGLLGSFSDASDFQAALPRYATYQESGPVSVRAALRLAKTLLSGDMQTSCRGEVARTR
                     YVIVVMVRSQDTSCANPAFNVGLDSRCSALGNTTACSQCELTAITGEIKALTSQFSAG
                     EVVVQPIYVRGETPDPVTRQHVAAIAAAGGTEPLETDAAGLSGTLTNIPYAARTNTLK
                     LKRFFAYNRNVVVRAGQVLVDSDGDGLPDTDEELLGTDPTRQDTDQDGLMDGVEVRMG
                     LDPLAPDIINGCNVSLDEDGDRLNTCEERVLGTNACIGDTDGDALPDLVEALAMTNPL
                     ISEDLLDSDRDGITNVSEVEAHGDPLSADLDFHRERGYGYELVETTPTVDGRTCYQVR
                     VENVTVVPTRERPHPFIPGEVIPAGTNEVYLYLQAGRDNDPRGAGIGSLLIQDIHYSE
                     EGGRLPAGIIPLEPDTFITGT"
     gene            complement(510021..512483)
                     /locus_tag="LILAB_RS02115"
                     /old_locus_tag="LILAB_02150"
     CDS             complement(510021..512483)
                     /locus_tag="LILAB_RS02115"
                     /old_locus_tag="LILAB_02150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MtsA protein"
                     /protein_id="WP_043709046.1"
                     /db_xref="GI:760025912"
                     /translation="MGRMHHYAVACCRDAGKMACDAVFLARWVDGEPRHEFIPAPWGM
                     GDAPPRRRLARMSRNGRRAVLAVLGALGLAAGVVAHHLGGASPAAPEAPAGRPRLVSV
                     GPRLTSNETSQPLSIQGERLVPGLSLSLGPPLSLRLPLTVVDATHAYARLPAGLRFPE
                     DVPQAVVEARLAGPAGGESEGAARLTVVNDAAFADLTAMVGSPDGRTLYVASAPTDTV
                     FALDVESGRVERLSTGDGPSALAAWTDGDGRPWLGVAHRYQPELWLYALDAPGAAPRV
                     LPAPLGAEGLMVDGPGGVAFVAERVGDRVHALSLADGRARWSAPVDPNPRALARWRDV
                     LAVGSLQTGQLELLRQSDGTLVSTVVPGPGVAIIGGNTERFGEQVMGGKAPRFLVASE
                     RLGHVFMSSLGPNVGPNPRRMEVSANSGVSVVEPSRGVYVRHRGFGAGGTEGLALDDG
                     AGLLYAADVGLGLVRVLDARALVAGDATARRAVLQEVAVTPPQGTPRIRPAEDFGVRG
                     RAGEALHSGPSALALSPDARTLYVLNRFTRTVAVVDVREAKAGRARVVRQLPVETSRA
                     QAKRRLGQVLYYADLGRTGITCDGCHLEGHTGGVFYEKTQPNRIYRSTTLRGSRDTPP
                     YFTPASHISLVDTVRFVGARNRFHNPDPSPSEVEALALYNALIVTPPNPFRGEDGAPL
                     ETVTLPDGRVGRPAQGRALFEGKGACVTCHPAPLYTLDQDLETRGRYLDVGTPVALPL
                     RLEQQDLAPGAATPSLVGAWDVWPLLTSATAGYGVREGRLVVASRFALRALLESSGPR
                     HGHASALTPEERDDLLAFLLTL"
     gene            512586..512993
                     /locus_tag="LILAB_RS02120"
                     /old_locus_tag="LILAB_02155"
     CDS             512586..512993
                     /locus_tag="LILAB_RS02120"
                     /old_locus_tag="LILAB_02155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712305.1"
                     /db_xref="GI:760029255"
                     /translation="MRRFLLCMAVAQLLGIGTLIAPTDTWAQSRSRSSRKAKSRTAKR
                     AAKAAPKVPPKIETKGSSAVDPVTGDTATTATTALPQRGPARIDFDDRLIQGQTNKSG
                     AVYLYDRKELKTRSMIRERESFRSETLSTVYDP"
     gene            513033..515780
                     /locus_tag="LILAB_RS02125"
                     /old_locus_tag="LILAB_02160"
     CDS             513033..515780
                     /locus_tag="LILAB_RS02125"
                     /old_locus_tag="LILAB_02160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_013935531.1"
                     /db_xref="GI:503701455"
                     /translation="MSGQPSVLQVVILRDGLLVGTEVFVPGTYALGSDPASDLRLDDP
                     SVEPRHALLYFQNGRAAVQDAGSAGGLFVNGHRVSACEIRPVDEVLCGPFILKTRVLS
                     QKPQEAKPQPPPEVAALLGAAQAPSPFVAPPPQAAVPPPSAAPAHQLRPATAVPPNSA
                     TLPAARVPVAPPVQHVATQVAYPTPAQPVPAVAMVPPVAQAPQAHAQAGGYAQAPQVP
                     GHAQAPQAHGYVGGHAQAPQVPGHAGGHAQAPQAHAHTGGHAQPHQAHAQAGGLAHAA
                     AQPPQAHAGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVH
                     AGGHAHVVAQVPQAQVHAGGHAHVVAQVPQAQVHAGGHAHVVAQAQPTAIPASPGAPR
                     PAQQAPTGVPASTVPSARRRAAPEPAPSANTGMRLADELMADLAIDPLPEPTGPLLEE
                     QRTLTRPTHAPRIATGKGAAQLYLDLYWGAIRRDARRFAPDKKKPVQASLDLEGAMPL
                     WGFTLPDGAPFTLAESVNNAFRLFVPPGTDVEKSGNDGRFTPVTGAALESDGSRRFLT
                     LREGTAARLTQGQMSLVAYAAPKPARVFVNPLKGLPWLTLTFLGLFASALGAFLVMKP
                     HRPEVADFQQKSLPPVALRLIAPEPKKKEEAKKKLEAIKAQAKKPTKEKVAEKAPPKP
                     VEKTPPPKQPERAVAAAAPQNKALKALAKLSAAGPATNNLLAAVDKLGSGPGSKNVKN
                     SNYKLSGLIGKAPIANAGLGTFGLGGGGKGGGATLGKELLRGKGGGGIGALGAGGVGK
                     GKVGGTVTRATARSIASTQGTVDREAVARVINSHLNEVHGCYERGLLKDPGLAGKVVL
                     EWTIGASGRVVAAKTKSSTLRNASVESCILSRLKSWKFPAPKGGVVIITYPFLFNSVG
                     Y"
     gene            515831..516466
                     /locus_tag="LILAB_RS02130"
                     /old_locus_tag="LILAB_02165"
     CDS             515831..516466
                     /locus_tag="LILAB_RS02130"
                     /old_locus_tag="LILAB_02165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935532.1"
                     /db_xref="GI:503701456"
                     /translation="MRYALLILLLLTPGLVRAQAEALENPGAVSAIQERRFRMHHELL
                     LGVGVLPANAYYKGLVGSVGYTYHFSDTFAWQVGRGTYSYNLQTSLRRQLERDFNTSP
                     NAAAFQDQVQWMVGSDLIWSPLYGKMAFLNESVLHIEAFLLGGGTVVKLDRDGGFRPG
                     VNVGLGLRLFTGKTLSLRLDVTNNTVFTGATRVIQVPQIQFGTAFNFGATE"
     gene            516463..518055
                     /locus_tag="LILAB_RS02135"
                     /old_locus_tag="LILAB_02170"
     CDS             516463..518055
                     /locus_tag="LILAB_RS02135"
                     /old_locus_tag="LILAB_02170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935533.1"
                     /db_xref="GI:503701457"
                     /translation="MTSRSLIAALTSAALLVSPAPAAAQSAGGAQPTSPAPEQGSPPA
                     TDGKAPASPDAQAPAAQGASKPAEAPPPAPEKVDPAVFDQALQAYFDGNPRDAAEPLY
                     AWLQAAPRTDENYAWGQYFLARSLIDLGLTHAGASYLARIARERSNPNVLPRALDALK
                     ALTDRPHDEVMIDEQVFGALDLGFLPEETGAYAHYQQGLVDLRVGNERWANTHFAKLP
                     ETSAEASHAKFALLVTRLKHVKEPTDEIIADFLALSEDEKLTREARNEAALAVARLRY
                     ERKDFQGALEAYDRVKLPELDPGRASLYLEEAWTRYKLGELRASLGILTTLDAPSFRD
                     EFLPDKYLLRSLIYRDLCHYLPAKRAAKELTRRFADSLEAVRNREDLTQDVRLRRAAN
                     AHGSTQRAARFLQTLELEGERLGRYAGSFGDRLFSHLTKLYDLSRAEAVRVHDARLAE
                     AVRQEADTLLRAAEQVRLMEYEVGLKLYERVKKGARIVAPEDEQILSPTQTAYRFDGE
                     YWNDELRSYRVRIDSRCIEETP"
     gene            518052..521321
                     /locus_tag="LILAB_RS02140"
                     /old_locus_tag="LILAB_02175"
     CDS             518052..521321
                     /locus_tag="LILAB_RS02140"
                     /old_locus_tag="LILAB_02175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935534.1"
                     /db_xref="GI:503701458"
                     /translation="MTGHLTGLIAAALLAAAPGGAGRPGPGVNPIVSKAKEREELIAK
                     LKRDIFKVDRAIGETERLISKSRNAPYLPDLQFRLAELYVEKSRYVYYLQAESRPEGA
                     SGAIVSPETRLMKQKAVQMYHRLLREYPDFKDGDQVTFYLAHEQRELGQFDEMLKTLG
                     DLTRKFPGSPLRLEAEQILGDHFFDKAELGEAEKHYQAILEAPPSPVHDLARYKMGWI
                     RVNQAKHAEAVTFFEAAAASAPLPGVDVKKALNVKREALLDLVYSYTEAKPPKGALNY
                     FEKLSDSRATYALALDKLGNRYFIKQQYEWAIPALRKLMELQHDPELDLERGQKLYDA
                     IKASKGKVLPDPEDLRILVRAAVQSKKDPELTEAERKKHLVELEEMARDLSTLLHVEA
                     QKKNDKALYVSAADAYQTYLGLFRPQQHVRTMMKNRADALFSANEYPEAARQFEELAR
                     YHVKAKDAKGEEEALNAALLAHFSTLKPEEAQKRNAFEVADARQAMKLLGAEFVSRFP
                     RSGNALVVKFNIARAYYEDGEYPKAAELFTAFALSHPQHKDAPVAGNLALDSLRQLND
                     FKGLDATGKKLLGAPLPASFRADVQKILTQSRAEALDELALQSAQETGDVIQGLVKVA
                     DENKNSDIGEKALYGAFTAAREKRDMQAERELGAKLVKDYPKSQYLSDVLLTLGRHAA
                     EAAAFGEAAGWFEQVGQKLGGDFAAVDGWLAGARLRLALGEYKEAARDLEAATDIAGA
                     RKAEILVLLAETRLKQKDYARAKTAAEAALKLDRHSAAAAAVLAEVQATTAPTAPADA
                     LIATLTTAVQGPNGGTEEAAKGLWYLGEILYRGYKDLPADQVEEKVAALQSMEGIYTQ
                     AASLGYAEWAVASLWKLALAYGHIADVVEGTALPAGLSSAEAQQFRAAVKEQVTPLKA
                     RSEEAFKACLSRAESLEVFSAAVVGCRARSETAALPVPQPGAPTQPASLEELRKKAER
                     TLNVESLEALGLAYLDARQYGMAQLTFGRVTELQDTRASAHSALGLALLHMGDAMGAR
                     EAYGRAMDSDPTFGKARLNLAALRCRFGDVDGARRELAVLKDVASLAGNDVDGGWKAC
                     K"
     gene            521303..521812
                     /locus_tag="LILAB_RS02145"
                     /old_locus_tag="LILAB_02180"
     CDS             521303..521812
                     /locus_tag="LILAB_RS02145"
                     /old_locus_tag="LILAB_02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043709049.1"
                     /db_xref="GI:760025915"
                     /translation="MEGMQVRPARASWLGVLLAAALCACGGEGGRLEGSVTSLIDLRY
                     DRAEAQLAEGELAVNFVTQQGTGTNTVLKVSARVADMIPEGYTGSLDVNLAEVLDSGA
                     QRGAIGRNVLDEPARTFPALRVGGLKVKALPSQQGQRISGEFHVTFENGTHTYSGRTI
                     FGSFEATVP"
     gene            521809..522444
                     /locus_tag="LILAB_RS02150"
                     /old_locus_tag="LILAB_02185"
     CDS             521809..522444
                     /locus_tag="LILAB_RS02150"
                     /old_locus_tag="LILAB_02185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935536.1"
                     /db_xref="GI:503701460"
                     /translation="MKRFVLLTLPLLSACGPSYNLRVPDSLEKKLPYEARIELLEAEN
                     NLALAIDKVDEADNEIGRARDHIRRARSRQEAAEDEVDRASDEVSREVAKLAIAEAEA
                     RVEYLRARQRLSVGLRDVERLALRCAFAEFELARLHAARKAKVEGSERLDQQEFEEQV
                     SECKAEVKEERASLAGDEKEEKTAREAWEAKKAALAKKTFDARASPYVENL"
     gene            522445..524364
                     /locus_tag="LILAB_RS02155"
                     /old_locus_tag="LILAB_02190"
     CDS             522445..524364
                     /locus_tag="LILAB_RS02155"
                     /old_locus_tag="LILAB_02190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935537.1"
                     /db_xref="GI:503701461"
                     /translation="MKTASFLVLQLLTAQAAEPDTATLERTAAVESARLEDSPDDADA
                     LYRLGTAFLALNTPKKAVAPLKKLVAQEPDLIPPKLALARALRLSGEPEQAREVLDTA
                     IAAFPEESTLRAERGLLARVLDERDVAISQYAVAVELSPQDAELRFNLGEALQRASRT
                     DDAIEAYREALKLDGKLNVARVNLGKALAEKGLNGEAKETLREATRQKLGDTEAHYNL
                     GVLLMRENDLDGAIAEYQRTLAADPKHASAHNNMGVALNEKGDPRKATQAFLKAIAAD
                     PKFAEAHFNLGLAYYQLGDNVRALKAFEKAVVLEPRRSSGPYTQLGHLYLTQGKKKQA
                     VEAYKKAIEKSAEDRRKTTEAYQGLARAWLSLGKADEAVATLKTAVEAFPEDASARAA
                     YGDALRAKGDLDGAIAEYEEGVKLAPTPENRLALADVYAQKRVSAKARPLYQALLDEE
                     PGNRAARLALADLLLAMGDYVTAEGLLKPKDGEEADTAALARLGIVHSRRGRPDLAVS
                     ELEAVVAKDPAQLDARAELGFIYLRGGDGAKARKVLTSVLSVDPRHTLGLLYMGHTLY
                     QQGNTKGAEKSFRDAVQVDPNFAEPHNALGQLLEATKRVDEAKEAYKMAVQLQPDHSD
                     ARDALKRLTASAPTP"
     gene            complement(524503..525387)
                     /locus_tag="LILAB_RS02160"
                     /old_locus_tag="LILAB_02195"
     CDS             complement(524503..525387)
                     /locus_tag="LILAB_RS02160"
                     /old_locus_tag="LILAB_02195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_043712308.1"
                     /db_xref="GI:760029258"
                     /translation="MVTGVGRRRGAVLETVALVLVLSSAFLHAAWSALLKRHPNPEVG
                     VVSVISVVILASGLWALGMRGPAFPRVEGLAWALWAGVCESVYLAGLARSLRQAPLGL
                     AYTVSRGGAMLLVWPVSVMWLGEAVSAWTVSGVALLCVGLAVMNLSRPAGPTGAGVAW
                     AALSAVGIAGYHLSYKMALEVGAQPPALFATGLLVALPVLILERGRQQGWTALRRELS
                     LAPGLVLTAGVISALSFGLLLTALAGGGAGAVLTLRNTSIAFALALAALQGERLGRRR
                     LSGAALVAVGAVLLGVPA"
     gene            complement(525527..525997)
                     /locus_tag="LILAB_RS02165"
                     /old_locus_tag="LILAB_02200"
     CDS             complement(525527..525997)
                     /locus_tag="LILAB_RS02165"
                     /old_locus_tag="LILAB_02200"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935539.1"
                     /db_xref="GI:503701463"
                     /translation="MGHGAHGAGLTTRLPTPLRVGWTVVASSPGQVRLVADVERLAGF
                     AAPVEVRLSLPAGVTLMEGAATFTVPAGAAEGGYSATYVVAFDTGRPPMDDLVLVARS
                     EGAGFGVHAEARHVFGRALVMTPPQPVPRGPELPAALMTGAGRPRGAPDSDEEP"
     gene            complement(526416..528053)
                     /locus_tag="LILAB_RS02170"
                     /old_locus_tag="LILAB_02205"
     CDS             complement(526416..528053)
                     /locus_tag="LILAB_RS02170"
                     /old_locus_tag="LILAB_02205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935540.1"
                     /db_xref="GI:503701464"
                     /translation="MRFEAAVLCLGILVLACGPERDAPPCDAACAPEDAVCRARACAS
                     TFPDEALRAAVDCASMPAGGRCLGTRIVERCVDGVRLQEDCGVTDACVVAEGGAHCAV
                     GAACMEGGTRCSADGALQGCVQGQWRARECAAGCVETGGRGWCGAPGPTLSGTVRYER
                     RFPDATFSGWSAEPEWVPAGGFLVASFQGTALVDLQVSGWDGRFSVRVAAQAGVDDRI
                     VVYAAGLGSASRVAFAVADPGLRGARQVTEAPGGGARLWRWSLATRTVAERGVFSIPE
                     AEGSGAAAVFSALRIAWDEARLRYGREGLPVVAWLGFGTTWSCGACFAEWPVTAAGRT
                     WASQVWLPGDGDAAWWSEAMVLHELGHWVMASHGTSPDEGGPHYLGVPTFPGQAWSEG
                     WATWFSSDVRGSSRYYDRQGGTMFWMDLDARRPAAGAWTRPRPEDGLLQKLEASEVAA
                     ILYRLGKGTPSRQPLYAALAAPEMNAAPWRRGYQRHQWRVEAGQVVDVARTDLPSPCL
                     ADFLDTMMCQGFPRWVMDAATEPESAYPYPSHSPLCR"
     gene            complement(528287..529090)
                     /locus_tag="LILAB_RS02175"
                     /old_locus_tag="LILAB_02210"
     CDS             complement(528287..529090)
                     /locus_tag="LILAB_RS02175"
                     /old_locus_tag="LILAB_02210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter ATP-binding protein"
                     /protein_id="WP_013935541.1"
                     /db_xref="GI:503701465"
                     /translation="MSLEVRGIEVWRGRGRTLGPMDLTLRPGEVLAVVGPNGAGKSTL
                     LSAMSGELKCSTGEVVLDGVPLSRWKPRERALRLGVLPQESSLGFGFTALEVALLGRS
                     PHASRAEGSADLAAAVAALDATDTRHLASRSYLTLSGGERQRVQLARVLAQLSEPVPS
                     GHRYLLLDEPTASLDLSHQHLVLEAAARFAQEGGAVLAVLHDLNLAARYAHRLAVLAG
                     GHVVEVGAPASVLTQELVARVFGLRVQVVEWPGSPGPLVIPEGRAPLSP"
     gene            complement(529087..530175)
                     /locus_tag="LILAB_RS02180"
                     /old_locus_tag="LILAB_02215"
     CDS             complement(529087..530175)
                     /locus_tag="LILAB_RS02180"
                     /old_locus_tag="LILAB_02215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter permease"
                     /protein_id="WP_043709051.1"
                     /db_xref="GI:760025917"
                     /translation="MSASGLAPVSANYRARERVPPAAPRPWLPLALLLLCVALLSLAV
                     GAVSVPPLALAGSLLEQVGLDLGPRLESVQQAVLLSIRLPRVTLGIMVGAVLATCGAA
                     LQALFRNPLVEPGLLGTSSGAALGAVAAIVLDVALSAHLGSLRMLAVPGAAFAGALGA
                     TLLAHRLGGGGGRTETARILLAGVAVSAGAGAGIGLLTQVATDAQLRSITFWTWGSLG
                     GASWDVVGAATPPLLVALGLLLREARTLNLLLLGEREAWHLGVDVERLKRRLILAAAL
                     GVGAAVSVSGVIAFVGLLVPALLRLALGPDHRRLLGASALLGASLLVGSDLLARTAAI
                     PAELPVGALTSVLGVPVFIGLLSRKGAA"
     gene            complement(530172..531068)
                     /locus_tag="LILAB_RS02185"
                     /old_locus_tag="LILAB_02220"
     CDS             complement(530172..531068)
                     /locus_tag="LILAB_RS02185"
                     /old_locus_tag="LILAB_02220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter substrate-binding protein"
                     /protein_id="WP_013935543.1"
                     /db_xref="GI:503701467"
                     /translation="MRRASGLSLLFMAMTSLAHAAAPARPQAEAAAKAPVAAAKLVTI
                     GPAITETVFALGAGGQVVGVDDTSLALEVARKSPKVGYQRALSSEAIIALGTSQLLAS
                     EEAGPPGVLEQLKAAGVDVVVLPNKHTVEATRERIRALAKRLGKAEQGEALVKQLDAD
                     LRKAQARTAARKDAKPPRVLALYARGANVLMVAGAGTAAGELVTLSGGVNAIAAYSGH
                     KPLTAEAVVEAAPDFILMPASSLEPVGGEEGLSRTPGLSQARGWRLITVDDVHFMGLG
                     PHLGKAVSRLQDGYASPARDSR"
     gene            complement(531068..532153)
                     /locus_tag="LILAB_RS02190"
                     /old_locus_tag="LILAB_02225"
     CDS             complement(531068..532153)
                     /locus_tag="LILAB_RS02190"
                     /old_locus_tag="LILAB_02225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter"
                     /protein_id="WP_013935544.1"
                     /db_xref="GI:503701468"
                     /translation="MNQTANSDVVSEPVRLRQRWQALRDEQPRTRIRDAAEQLGVSEA
                     QLLATGLGETVVRLDLRLDALLPRIETLGRVMSLTRNAHAVHEKRGTWRNIELHGKQG
                     LVLDEEIDLRLFFSRWTFGFAIREPHGDGLRRSLQFFDASGMAIHKIYVEEAGREETF
                     DALVKEFTHAEQSPRLSVVPATPAAAPRPDSAIDVEGLRSGWRALQDTHEFFALLSRF
                     KVARTQALRLAEPELATAVKPDALTWVLEKVAASALPIMIFVGNPGCIQIHTGPVKNV
                     KAMGPWMNVLDAGFNLHVRADHVHSAWVVRKPTRDGVVTSVELFDEAGENIGLIFGKR
                     KPGVPESQEWRALAEALAQAMPAREVA"
     gene            complement(532181..532882)
                     /locus_tag="LILAB_RS02195"
                     /old_locus_tag="LILAB_02230"
     CDS             complement(532181..532882)
                     /locus_tag="LILAB_RS02195"
                     /old_locus_tag="LILAB_02230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935545.1"
                     /db_xref="GI:503701469"
                     /translation="MSRLAPRSSFLGRAVAALLLAGSLSACGDDLELPPDPQNPDPQN
                     PGEQEEDAPVNGTHTTHVANGDGSYTTAVNATGSSEWIGLDLDNGTQVSKETDAAWDV
                     AFQRFNILSRGGVSGSGDVAVAVLTETDFAQVTQAPADGYLVDAEDGEDRGTDPDSAF
                     NVGDGWYAYDMSTHALSARRNVYVVRSDEGAYFKIALQSYYDDAGTPGMLSFRWAKVP
                     APASAGSALAQPSQH"
     gene            complement(532925..534928)
                     /locus_tag="LILAB_RS02200"
                     /old_locus_tag="LILAB_02235"
     CDS             complement(532925..534928)
                     /locus_tag="LILAB_RS02200"
                     /old_locus_tag="LILAB_02235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_043709053.1"
                     /db_xref="GI:760025919"
                     /translation="MSWRGCLLFAACSLPWAAWGSDSEAPAGEAAATEVTSPGAQSVP
                     AGAHQAAPLEPEEVRGARTVVTASRSPERLEDSAVATEVITRADILASGARDASELLA
                     AHPGLQVTQTFAGATVQLQGLAPEYVLVLVDGERVAGRVAGSVDLSRLSTEDIEQVEV
                     VKGPSSVLYGSDAVAGVVNLITRRARRPLGAELRASYGNMQRLELDATGEAKGEDWGL
                     RLSGGLARRDAYHLDPASIGTTGSSLDGIDVSAGGDLRTGDSATVQANATYARRVQRG
                     VDVGVTGAIFDRAARDDSLSARLSPRWTLSNGATLRVDGAYAWFNRRYLRDQRRSSAL
                     DTIEDTREQQGRLGAQLDAKLGQSHAFVAGAELLGEWLQADRLGEDGRGRRGRVSLYA
                     QDNWTLVPRLKLTLVPGARVDTDTQFGTAVTPRLAARMDPASWLTLRGSYGWAFRAPG
                     FQEMLLDFENPSVGYMVRGNPDLRPERSRSFNLSVEVKPADSSLLWVSAFQHNLQDMI
                     GVSTEMSGPQQLFTYVNIARARVRGGEVGIRQQLPGRVSAELGYTLTDGRAEETGLAL
                     EGQARHRLTAQATWRHRVTGLEAWVRGALVGPRPFYPDTDGDGVANPYDAKTYVTVDA
                     RLGWRMREELQFFVLGTNLANAGNPTDLPIPPRAIQAGISARL"
     gene            complement(535060..535251)
                     /locus_tag="LILAB_RS02205"
                     /old_locus_tag="LILAB_02240"
     CDS             complement(535060..535251)
                     /locus_tag="LILAB_RS02205"
                     /old_locus_tag="LILAB_02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709055.1"
                     /db_xref="GI:760025921"
                     /translation="MMRDGCHGEGGARELRCMCGSLLARLVPEGVELKCRRCHRTQVV
                     PLERTPPEGGGAQVGGSGR"
     gene            complement(535360..535998)
                     /locus_tag="LILAB_RS02210"
                     /old_locus_tag="LILAB_02245"
     CDS             complement(535360..535998)
                     /locus_tag="LILAB_RS02210"
                     /old_locus_tag="LILAB_02245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935548.1"
                     /db_xref="GI:503701472"
                     /translation="MARRRPNFNKTLRSLIRDIAAKMPEFGHVKAGRILVVAGEARRA
                     SRGTVKPLCFRGGKSTDRSGRRKPIIRIRRKRMLYCITLRPLFFRGSTAQARVETVIH
                     ELFHMSRRFDGTLHSGRRHDVLGRNFSRKLKPLVRRYLKLCPPELLASMAHSGEVRIL
                     QWLERPGPAYLPGGSRRVRKVYTEDQLYSGVARMVTPKVRLARDTSARSKVH"
     gene            536001..536897
                     /locus_tag="LILAB_RS02215"
                     /old_locus_tag="LILAB_02250"
     CDS             536001..536897
                     /locus_tag="LILAB_RS02215"
                     /old_locus_tag="LILAB_02250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709058.1"
                     /db_xref="GI:760025924"
                     /translation="MVDSLAEKPLSGLLGVSTLSSVMRLPSPMFRLAVVLSLCVGCAS
                     APTRPSSPATLTAQRTVIASQGLTDATLRYEAEVSSPGEGVVERADYELVADGQVVKT
                     GTAKLGVALTPGTPADISFEERAPYVKNAEDLARLSAEQGTLLLALRGTLVVRSGDQE
                     QTIPFAASRATRMPRLPTVVVEELDGARYSDEEVQLNLRIGVRNPNPFPLRLEGLTWT
                     ASVAGKTLDSGTLAHADTVDASATGVYPVELAVTKDTWGPEVKALITQGLLPYGVTGE
                     VTGPLLRVPYSLTGEVKLNVSR"
     gene            536910..537620
                     /locus_tag="LILAB_RS02220"
                     /old_locus_tag="LILAB_02255"
     CDS             536910..537620
                     /locus_tag="LILAB_RS02220"
                     /old_locus_tag="LILAB_02255"
                     /EC_number="2.3.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl/phenylalanyl-tRNA--protein transferase"
                     /protein_id="WP_013935550.1"
                     /db_xref="GI:503701474"
                     /translation="MPIYLLSDEHPELFPPPERADKSGIVAVGGDLRPERLLAAYARG
                     IFPWYSEGDPILWHSPDPRFVLTPDMLHAGRSLRKAMARGVYEVRYDTAFRRVITECS
                     RVPRPGQSGTWITDEMMEAYVTLHEAGFAHSVEAWAEGELKGGLYGVSLGAAFFGESM
                     FALAPDASKVAFVTSVERFRDWGFQLIDCQVETEHLARFGAVNWPRKRFLAALAKALK
                     EPTRRGKWTALSKSAGPL"
     gene            537674..538459
                     /locus_tag="LILAB_RS02225"
                     /old_locus_tag="LILAB_02260"
     CDS             537674..538459
                     /locus_tag="LILAB_RS02225"
                     /old_locus_tag="LILAB_02260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935551.1"
                     /db_xref="GI:503701475"
                     /translation="MRWSSTLLLPLCLATTACGTSAKHQALIERRDAIRLADAEREQG
                     AREQYRSDTGFQDTRWGMTRSEALAVLPAHARLIGAWEDVHVTDVVAGHPADIYYVFA
                     EGQLAAVTLSFRAPGAVRGNFDSVAELLTRKYGKPEAMEDSARDAESRLALAQMSNNL
                     SEASANYHAWRSGVRPSGPAVDNFGRQLEANARTDAALAHYDYLLQGLWKDADTELRL
                     TGSQAPGARSLMLTYTSLRLQPYLAKELAVRDEQRKVEQSREL"
     gene            complement(538523..539518)
                     /locus_tag="LILAB_RS02230"
                     /old_locus_tag="LILAB_02265"
     CDS             complement(538523..539518)
                     /locus_tag="LILAB_RS02230"
                     /old_locus_tag="LILAB_02265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935552.1"
                     /db_xref="GI:503701476"
                     /translation="MHLVVRLTTQALAWSLTLLPLAASAQFDDVDSFPSAEPERGCPK
                     RPDIVPFTARNLVGLSGAGWLAHQAVIPEAKDRYFSEAERDRSGVKLVPAEDDVRKLG
                     APDPAVPLWVFGKADAAPCRAVPVVWWAVRMGTDADRKTYLMSELQVECDVLPPGRLS
                     GTPVALRQKDAPTGCKLRRPDDNANSAEGRGLPLELADVLPARACEAPECERKWEIFS
                     SRWDDGSAVFDIAASWMKRDGKKDPCEWATEDYTTLLLRPAGALAPVPLRSGGAFFGA
                     LYDSTGLRTVLSRDMGTLNVHDAARPKAAPKTVRYGSPTEEELLNAKRTLSPCKK"
     gene            complement(539622..540401)
                     /locus_tag="LILAB_RS02235"
                     /old_locus_tag="LILAB_02270"
     CDS             complement(539622..540401)
                     /locus_tag="LILAB_RS02235"
                     /old_locus_tag="LILAB_02270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709061.1"
                     /db_xref="GI:760025927"
                     /translation="MSARMYVVGALLALLVPALAGAWPVDLSVPLEPKKERFHKLDTV
                     DWVQVEDASVAEAELLPGSNELLLTGQKEGRTLLLLYAGGRFAVWRLTVGSPPPEDAA
                     PRLAAARKACPDLNATTGAGRSLSASVKDSKCRLALLELLKTDAFMARDLALTFDVAI
                     LQEQLASVGEGLEPLGLEASYSGAGVVVSGSASPEVHRKALWELFFRSVGRVPLNDQI
                     EEVKPPEPSDAGAPDAAVPAVAPAREIPVEVLPLPTKPRKR"
     gene            540456..541808
                     /locus_tag="LILAB_RS02240"
                     /old_locus_tag="LILAB_02275"
     CDS             540456..541808
                     /locus_tag="LILAB_RS02240"
                     /old_locus_tag="LILAB_02275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prohead protease"
                     /protein_id="WP_013935554.1"
                     /db_xref="GI:503701478"
                     /translation="MPTWTLWVACLALSFVRALVAASESALYGVSDLRAQELADSQPG
                     RATRRVLRHKTDREPVATALRLGMVLSGFQAAAIGAFVPPRMLDFSRYGDAEWLPVAT
                     VAAGALLVGVLATLMEVTMRGLANGSPERWALRLSGFTALLVTVLYPPMRVAMALLNL
                     MARTFGRTLRFEPPPPPLEELEKLLAAQAAKNEVDKSAPQLIRSIFELSDKRCRDVMV
                     PRTEVVTVDITVDTDELLRLLAEENHSRIPVYRDDVDHVIGVLHARDIIPLLQHPELI
                     VLHDIIRPAHFVPWMKPIGDLLRDMQKQKIHMAIVVDEYGGFMGVVTLEDILREIVGD
                     IGDEFEVEEKQVEKLADGSFLVDAALEVDAFTQSFGFPLPEGDFDTLGGFLSSMAGHL
                     PDVGERFAYNGWQFVVASKEGPRIDRVRMSRGKSGITKDARDGLAREPGREEQATAKS
                     "
     gene            complement(541849..542730)
                     /locus_tag="LILAB_RS02245"
                     /old_locus_tag="LILAB_02280"
     CDS             complement(541849..542730)
                     /locus_tag="LILAB_RS02245"
                     /old_locus_tag="LILAB_02280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709063.1"
                     /db_xref="GI:760025929"
                     /translation="MERWKMRATGSSRVGVVGLAALLLSHTGCSTTSEYVRGPRLREV
                     PLGETHRDTLESVVDASYVGRVAVKRTTCTEVSTEFSKNRIDTTTSPPMDSLLAGLAM
                     LGGGGLLMSMSDGESEDEDIDLPMTLGVVLALASIYPLVTALTDEDVTRAEVATGEVE
                     AERSQRCEDRTFALSGPLHWSVSLGAAKRTGRTGKDGAVALRQPLSELVEQAITDEAS
                     VRRLVAGRGIGFRLELERAPAADFRLDSKALPDSYFRRFADAYGRQLGGGERARFENC
                     ELIGKSARETLECYWSQ"
     gene            complement(542693..543265)
                     /locus_tag="LILAB_RS02250"
                     /old_locus_tag="LILAB_02285"
     CDS             complement(542693..543265)
                     /locus_tag="LILAB_RS02250"
                     /old_locus_tag="LILAB_02285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709065.1"
                     /db_xref="GI:760025931"
                     /translation="MLPLRRCMLPISLGVLSAASALAAEKSPPPGPPAPTRKVDPTKA
                     QTEEWLREHIEAWNDSEVHVTVKDCRVMVLDKPRERTEIVDLRGLLLPIEVIRLNGGN
                     DATLRLRVKQKHTGTYSMFRKCSAENRYCAEPTGKFQSLPYVDLSVTSVRDFVPGRQT
                     DVDKSLRLERALEHYSKLCGAMEDARNRLF"
     gene            complement(543365..543850)
                     /locus_tag="LILAB_RS02255"
                     /old_locus_tag="LILAB_02290"
     CDS             complement(543365..543850)
                     /locus_tag="LILAB_RS02255"
                     /old_locus_tag="LILAB_02290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935557.1"
                     /db_xref="GI:503701481"
                     /translation="MRSRRAVVFLGLLAGGLAASGCLGSVPFRPRAYEEAVRVASFQV
                     DFRQDGTGVLDLDLRVTNPASDAATLAAVDFTLRVDGRRVAVGTQQVAAPLAEDGSAP
                     LRVLFPLASARATGGPEPVPRRVQVEGGVVLRFGGTERRAPFQAERVLPLAWVPPLSG
                     D"
     gene            complement(543852..544766)
                     /locus_tag="LILAB_RS02260"
                     /old_locus_tag="LILAB_02295"
     CDS             complement(543852..544766)
                     /locus_tag="LILAB_RS02260"
                     /old_locus_tag="LILAB_02295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013935558.1"
                     /db_xref="GI:503701482"
                     /translation="MADAPDLGGYEVVGRLAVGGMAEVYQARARVTTQRSPGEPDEIV
                     IKRLHPSFRSDTAYVKAFVDEAKLTVRLRHPNIVRTYRLFKAGPDYLMVQELVSGRTL
                     GYMQELLLKAGAAMPPESACYIAWCLLKALDYIHRAKVGENGATIVHRDVNPANLLLG
                     INGDVKLTDFGVAEVEGMMRGDAGALRGTLPYMSPEQVLGLPVDARTDLYAVGIILWE
                     LWSGRRLFAGEHEAELMHKVRDARVPLLTSSPELPDYAVQVARKALFADRARRFQTAA
                     EFIKALESLSRRAGWPLTVEALQPLLGG"
     gene            complement(544802..546235)
                     /locus_tag="LILAB_RS02265"
                     /old_locus_tag="LILAB_02300"
     CDS             complement(544802..546235)
                     /locus_tag="LILAB_RS02265"
                     /old_locus_tag="LILAB_02300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase"
                     /protein_id="WP_013935559.1"
                     /db_xref="GI:503701483"
                     /translation="MNVLFISSEVAPFSKTGGLGDVAGALPAALASLGHDVKVITPRY
                     RDMRGAEQLVPTGQSLLLRFPFGELSGPILSARVSERLEVLFLENAFLFGNRHGLYGD
                     AWGAYADNHRRFAYLSVGALQAAQRLRFIPDVVHANDWQAGLSPVALRRGFQAGPLAQ
                     AKSVFTIHNLAYQGQFPKDVMGDLGLPWDLFTAHDGLEFHDTVNFLKAGLVFSDALTT
                     VSPTYAKEIQTPEQGYGLEGLLRHRAHRLHGILNGVDTHEWNPEDDAHLPARYGLKDL
                     TGKAVCKRELLARFGLEDGPAPVFGFVSRLAWQKGVDLLLEALPTALHADLRVVGVGS
                     GEGPLEEGLLALQARYPKQVGVHLGFDPALSHLVEAGADFFLMPSRYEPCGLNQMYSL
                     RYGTVPIVRATGGLVDTVEGGLDGNGILFEAFHKSALLAAIRRALALYADPPRLDEFR
                     RRGMEKDFSWGASGRRYEALFHDLMAE"
     gene            546236..546898
                     /locus_tag="LILAB_RS02270"
                     /old_locus_tag="LILAB_02305"
     CDS             546236..546898
                     /locus_tag="LILAB_RS02270"
                     /old_locus_tag="LILAB_02305"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P21159.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine/pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_043709068.1"
                     /db_xref="GI:760025934"
                     /translation="MRTLTCAPGESTAKVHTSPAPLMLHRVMIPPDPIQRFAELFARA
                     KQAIPVDPNAMVVATVGDDGRPSARVVLLKDFDARGFVFYTNHESRKGREALAHPYVA
                     LCFYWQPLNEQVRVEGRVERVTDAEADAYFQSRPRGSQVGAWASLQSQPLPSREDLVA
                     RVAEVEQKYAGQPVPRPPHWSGLRVVPDRIEFWHAQESRLHDRHVYLREDGGWRTERL
                     YP"
     gene            complement(546912..547601)
                     /locus_tag="LILAB_RS02275"
                     /old_locus_tag="LILAB_02310"
     CDS             complement(546912..547601)
                     /locus_tag="LILAB_RS02275"
                     /old_locus_tag="LILAB_02310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C-factor"
                     /protein_id="WP_043709072.1"
                     /db_xref="GI:760025938"
                     /translation="MRYVITGASRGIGFEFVQQLLLRGDTVEAGVRSPEGARRLEPLK
                     HKAGNRLRIHALDVGDDASVRAFATNVCTSPVDVLINNAGVAGLWCALSDVDYADMAR
                     TFTINALGPLRVTNAMLPGLRRGALRRVAHVTSRMGSLAENTDGGAYAYRMSKAALNM
                     AVRTLSTDLRPEGFVTVLLHPGWVQTDMGGPDATLPAPDSVRGMLRVIDGLSPEHSGR
                     FFDYQGAEVPW"
     gene            547681..549099
                     /locus_tag="LILAB_RS02280"
                     /old_locus_tag="LILAB_02315"
     CDS             547681..549099
                     /locus_tag="LILAB_RS02280"
                     /old_locus_tag="LILAB_02315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_043709074.1"
                     /db_xref="GI:760025940"
                     /translation="MHHMPRTHLMNVAVVGGGISGLAVAHGLRSRGTAAVLLETSARL
                     GGAVGTHARAGYLVEQGPNSFLDREPATRALAAALNLEGRIRVADASAKRRYVYTRGR
                     LRSVPASPPAFLTSDILPLGARLRVMGELFSSRAPEGTDESLAAFGRRHLGPVATRVL
                     LDAVQTGIYAGDVERLSVEATFPLLVKLEREHRSLILGAIHAQKAQARAKALLPPGDA
                     PKLTGALSTFDGGLQVLIDALASSLGDAAHVGARVEGLTRVDGGWRLAVEEHGQRAEL
                     SASHVVLAVPAHVAAELLQPLDDALAAQVSRIEYAPIAVVHLGFDAGTLPAPDGFGFL
                     VPFEEQRRLLGAIHASTTFPFRVEGGRVLYTCMVGGARQPDLVQRDEAELAALALEEL
                     RALAGVTARPTFTQVFRWPRGIPQYNVGHLERMAGIDAALQRWPGLHLAGNAYKGIGL
                     NDCIRNAARLAAALSDEENVRK"
     gene            549369..550433
                     /locus_tag="LILAB_RS02285"
                     /old_locus_tag="LILAB_02325"
     CDS             549369..550433
                     /locus_tag="LILAB_RS02285"
                     /old_locus_tag="LILAB_02325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935564.1"
                     /db_xref="GI:503701488"
                     /translation="MPETSSEGSIVRATLRALVAPRRLLPILVVSVALMTAQVRFSPT
                     PLWVAFGLGLQMCLLFVAVAPVSYRVLFPEGLDFSHGGIRLLLYATVGSGVVLTSGFV
                     VPKLLGLGPTFLTQPTNLAVCGALFLVGGWGLGRDIGFEESLGRERARAARFALEAEQ
                     AQLLALRSHLDPHFLFNTLNAIAEWCREDGAVAEAAVLRLSTMLRSVLAGVRSATWPL
                     AQELELIRTLFELHLLRDPDLFQLTLNVPADVGEIPVPPLVLLPLAENAVKHGPAAGH
                     RGPLSLDVTARGHEVEVAIENPGPSRGPREGSAGLPTVERRLALAYGSAARLVLDGRE
                     ARTRVAVTLPRAGPQPGVLT"
     gene            550565..551203
                     /locus_tag="LILAB_RS02290"
                     /old_locus_tag="LILAB_02330"
     CDS             550565..551203
                     /locus_tag="LILAB_RS02290"
                     /old_locus_tag="LILAB_02330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_043712310.1"
                     /db_xref="GI:760029260"
                     /translation="MRAGGVDVVLLDIHMPGLSGLDALALLPEGGHRVILCTAHAEHA
                     VQAFEHGAVDYVLKPVEPARLQKALERARARAPVAPPSVSGPPKLSPAPARSLGRLPI
                     PTRQGIVLVDPEAISHAALEDELVTVFTTQGDFLTDFTLNELVEKLPSEHFHRVHRRA
                     LLNLTHVARLEPLDTGGYLARTLRGHAVEVSRQSARELRRMLGLRRGVEEEG"
     gene            complement(551254..552069)
                     /locus_tag="LILAB_RS02295"
                     /old_locus_tag="LILAB_02335"
     CDS             complement(551254..552069)
                     /locus_tag="LILAB_RS02295"
                     /old_locus_tag="LILAB_02335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709080.1"
                     /db_xref="GI:760025947"
                     /translation="MHPTDVRCRSLRRTLAMWMASSLLLAACGGAEAESLADAESQAV
                     ASQSLGGPSEESADRRIIVYQTTSLQLMRVDNQGRSHLVAERTGAPVVSPDGNRAAYA
                     KLPDGHRPGDLVRSSDLYVLNANSGKSTRVTQGFDDSEPVWTPDGRVVLFQSTSRTGV
                     PSLWRVKQNGKDLTQLTNVGTSQFSSAYIPNPALGGTVEWDADRRIIVYTTTSLRQGE
                     DGEVRIIAFDRDYDVASAYSLGKGSEASWTERGTVVYSRNEGGRVVTVEARVP"
     gene            complement(552219..553643)
                     /locus_tag="LILAB_RS02300"
                     /old_locus_tag="LILAB_02340"
     CDS             complement(552219..553643)
                     /locus_tag="LILAB_RS02300"
                     /old_locus_tag="LILAB_02340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043712313.1"
                     /db_xref="GI:760029263"
                     /translation="MTMARLLIVSLLVLCACSSLRGQADSMARKGLLVEAAAIYDDLS
                     RQNPNDGELVLVRDNLRLRALTRLLSDARRARVEGRDEDAEDSLLRFLNHRAEWNTKL
                     DGGLESSLREEVAGTRRHLQKLVGAPAGRGHALTAEQALLRKQPLLTHPELSRVARDM
                     EWLVLQSGKASCLRLRDTSTEDSPHWRELVYRYCGHWREYAPRPASAPELFGPPSWSG
                     AVEGLDAAQQARLEARLTQAFEASAWFSPGGPARPEFKLGGRFVTERDSQAVALTAPW
                     TESVPYTDHEDRTETIEEPYEAEEEYTDEDGKTRTRTVTKYTSHTHTYSVPVTRYRDV
                     PRTFEYHALRLSQAHHLAVASAATLDARRSPFVLAMQDQLSESGHEHDVTFEKGKVRP
                     SQPSFTPAETWLDAKVEALAAAFSRQLATHWQESYCSTPSLTLDEAARCARAGAAVPA
                     QVARVLSDILGADATQVPILFASP"
     gene            complement(553732..555225)
                     /locus_tag="LILAB_RS02305"
                     /old_locus_tag="LILAB_02345"
     CDS             complement(553732..555225)
                     /locus_tag="LILAB_RS02305"
                     /old_locus_tag="LILAB_02345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_013935568.1"
                     /db_xref="GI:503701492"
                     /translation="MGMAIHQEDFRPEDHARFSRRLAESLEALRALLARPGFGVGPPT
                     VGAELELCLVDRLGFPLPVNREVLARTSDPRVTLELDAFNLEVNLRPGPLAGRPFTAL
                     REEVESAVAAVRQAASTQGARVAVTGILPTLREADLGSGALTGEPRYRAMSAAIRQRR
                     GAVPFQVAIRGEEEALALTWNDVTLEGANTSLQYHLRVAPGDFARMYNAAQLATAPVL
                     AVSGNSPLFLGRKLWDETRVALFRQAVDDRGEPGEGGFQPHARVSFGHGWVREGAYEL
                     FAEAVALHPPMLPVTGEESPRERVAAGEVPGLDELRLHQSTVWSWNRAIYDPKDGGHL
                     RIEFRALPAGPTTVDMVANGAFLLGLTLALAERVDALLPALPFVHAYGNFIRAARQGL
                     DAELLWPADAAPSPQPVLATELVKRLLPEARRGLVGAGVDTREADTLLGVIERRVSLR
                     RTGAVWQRQVLARLESQMPRRDALAAMLERYLQHAESGAPVHAWPVE"
     gene            555393..556472
                     /locus_tag="LILAB_RS02310"
                     /old_locus_tag="LILAB_02350"
     CDS             555393..556472
                     /locus_tag="LILAB_RS02310"
                     /old_locus_tag="LILAB_02350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_013935569.1"
                     /db_xref="GI:503701493"
                     /translation="MPSDTSANLYDLTRPALGALLAGWGFGPYHRDQLWTALYRRHAA
                     SFDELDGLKPELLRALREHTRLGQLATHHESFSGDGFTHKLLLRLDDGQTIETVLMRF
                     KGRATVCISTQAGCAMGCVFCATGQMGLSRHLTPGEIVGQVLHVNRILRASGEALRNV
                     VLMGMGEPLHNYEHTMSAVDVLVDAMGLAMGPRFITLSTVGVVPGIRRLADEERPIHL
                     AVSLHGATDAERAALVPAGRRWPLDELMDACRYYSEKRKRRIFFEWTLISGRNDTAEH
                     AHTLGQLLQGMDAHVNVIPLNPTVGYDGGPSRPESVRAFQDVLAAYEVPSTVRQRRGI
                     DIDAGCGQLKAKVERRTRSSVPTSA"
     gene            556777..557160
                     /locus_tag="LILAB_RS02315"
                     /old_locus_tag="LILAB_02355"
     CDS             556777..557160
                     /locus_tag="LILAB_RS02315"
                     /old_locus_tag="LILAB_02355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935570.1"
                     /db_xref="GI:503701494"
                     /translation="MLSIQEHATVDEASSELLDFVLEPYNWLSLPRTGMDPATWPGQN
                     TLYQRRVGSLRICASVDVAATLDVFLHIAFRAPGLTPVKAADHLESFLKQRLPLTPNS
                     EWQVEVDERRWIHFSRRYAGPPLKA"
     gene            complement(557150..558748)
                     /locus_tag="LILAB_RS02320"
                     /old_locus_tag="LILAB_02360"
     CDS             complement(557150..558748)
                     /locus_tag="LILAB_RS02320"
                     /old_locus_tag="LILAB_02360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate cyclase"
                     /protein_id="WP_013935571.1"
                     /db_xref="GI:503701495"
                     /translation="MTDISLEEYKALRTLQRAVDDALEESLREREPLTQTFRRCFPLV
                     LSLTGARAVAITTRDEELVEQTWGEGDWSDRHPGALLEGAAGVRRLDADTLASQPLDV
                     AGARVGSLGLLFAGDATAPEAAARLLRLLDTVAEQLDTVLCLVHTASEKHQLILQCNG
                     HLANPVFEAGMDLAVLTLAQRVRLPGFLLLYRDAVQPHLLHYRTYRGGHLEFESGEQP
                     QAGLEAAIRQHGPRLLLGEDSALRQLFPGRTTEAVLISGAAAAHGPLGKIVVWNDGGF
                     STYAMDLIRVLASTLSQRLQDYNRERIHLSQFFPNAVIDALLQDPAYAQHLRAQDQEV
                     GILFADINGFTRICEQGFDSPRSIGRFVDEWSQRAVGCIWEHGGVFDKMVGDCVIGLF
                     GPPFFKSTPRERAQAAVRAACDIQAFTAALGAREEVAALCERVKLPGLGVAVGVNLAH
                     ANCGLFGPNRQYTAFSSGMNQAARLQSLAGFRETLVMDSVHDALAGAEDAFFQGLRFG
                     PLTETPVKNVAQPLRHYRLEPLTP"
     gene            complement(558783..559637)
                     /locus_tag="LILAB_RS02325"
                     /old_locus_tag="LILAB_02365"
     CDS             complement(558783..559637)
                     /locus_tag="LILAB_RS02325"
                     /old_locus_tag="LILAB_02365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase"
                     /protein_id="WP_013935572.1"
                     /db_xref="GI:503701496"
                     /translation="MRIAHCSDVHITEDYFSLPLHRLGWRRWVALVELTVGGRARRYA
                     RAPQALAAIARDAQASQVDHFILSGDLTAYALEGEFSGARQSLGALADDPRRCTVIPG
                     NHDVFTPGSHRTGRFARHFGHLLESDLPEHRREGAFPFVRLLGTEAAVVGLLSARVPR
                     TPGLSYGVIGPAQLGGLAALLKDPRLEGRAVLVVVHHAPLNPRGRPDHWHHGLRDAEA
                     LLKLLPGPRYAVLHGHIHRRYHHPATADRPHVFGAGSSTEAGHEGYWLIDVADGQVTG
                     GQQQTPAL"
     gene            559806..560753
                     /locus_tag="LILAB_RS02330"
                     /old_locus_tag="LILAB_02370"
     CDS             559806..560753
                     /locus_tag="LILAB_RS02330"
                     /old_locus_tag="LILAB_02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-Q tRNA(Asp) ligase"
                     /protein_id="WP_013935573.1"
                     /db_xref="GI:503701497"
                     /translation="MSAVRGRFAPSPTGRMHLGNIRSALLGWLQARAAHGRFLLRVED
                     LDRARCKPQHVEELLRDLAWLGLDWDEAPLFQSQRDGLYRDAQAKLEREGLVYPCFCT
                     RAEIARAASAPHGLSDEGPRYPGTCARLTREQASERARTRAPAYRFRARPGELRFVDG
                     VQGPYTQDVDAAVGDFVVRRNDGVASYQLAVVVDDAATDITHVLRGDDLLSSTPRQLQ
                     LYTALGLPAPAFLHVPLVMGEDGRRLAKREGAFALAELRERGVAPERVLGLLAAWSGL
                     GDGSPLTLAELVHGFRPEKLPRAPVVAGEAALRKALGLE"
     gene            560820..561848
                     /locus_tag="LILAB_RS02335"
                     /old_locus_tag="LILAB_02375"
     CDS             560820..561848
                     /locus_tag="LILAB_RS02335"
                     /old_locus_tag="LILAB_02375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709081.1"
                     /db_xref="GI:760025948"
                     /translation="MAMFAPNTSAFAPLRALSGIRRGSTMAAIVENQAPGGVSAVAGN
                     PYKLSWGAIFGGAFVALALWLLLNSLGLALGLSTVDPNDPGSARAAGIGTGIWSAIAP
                     LIALFCGGFVAARSAGRLDKGGGALHGAVLWGLTTLVGTALLGMLLSSVIGTALRAGG
                     AVVGATGSAMAGAASGGGQAAQTFGLDANDALGPINRRLQAEGKPTITANQLQAATSE
                     VLSTALRTGNLDREVLVTSIADNTRLSRQDAEGIADRVSQQFTAFTGRVGQMGEQVQQ
                     GALQAAQPTSRVFWGIFASLLLGLVSAMLGATVGVSRRQRIAAEGAIATPPPRPTEPT
                     GPRREVYP"
     gene            562034..563872
                     /locus_tag="LILAB_RS02340"
                     /old_locus_tag="LILAB_02380"
     CDS             562034..563872
                     /locus_tag="LILAB_RS02340"
                     /old_locus_tag="LILAB_02380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_013935575.1"
                     /db_xref="GI:503701499"
                     /translation="MSRSTTYLLCLATLSAVSSGCFLRTGAILDALNTPGDPRAAPLP
                     VPIQERAARLTRTHLMDAYADPAEAARWMSALGNAPQPIIEQVDCLKQTAGGDNSACY
                     ERFLAAAMEAPLWGLPPLPTTVDPAAPAPREVDAARFLANALGIAGSLVALRDAQGDR
                     VPLQVLTRGIREGAESAAQYVSARRWSRTLGRPSNAVVLSGGGANGAFSAGAIWRLLG
                     VLEQCRGKPAPEGCGDARIDLAAGSSTGALISTLVDLFHTPGHEAAARQLLVSNYTCS
                     VESDLYCVNDTWIWKIASDLRGLVQFDGIYGKLRAAVVPEQLTNGTELVAVSVDFDTG
                     DVYGVSDQDPENFAADATPQQRVEGIINGVVASIVEPVLADPVPWLPARAGRMKGSFY
                     DGGVRSGLPLLQAVQRGAERVLVLSTGGVEPSPEHPPENAVGVLMRTIDLFVAQPRVG
                     EVQQGELAAVGRRFAEHNVCVARLARVADPDGVNAFCRRTGAGFVPREPGALRAATNM
                     WLGSARFDQVASSWRSSWMFRPDSQLQTASGYGFSPEVMRPLFKEGVKHFQQRCHEVL
                     RLFEIRGTRATAECDRPVDDAVAEAEARFAPLAQCTQGKPEQRSCK"
     gene            563901..564557
                     /locus_tag="LILAB_RS02345"
                     /old_locus_tag="LILAB_02385"
     CDS             563901..564557
                     /locus_tag="LILAB_RS02345"
                     /old_locus_tag="LILAB_02385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935576.1"
                     /db_xref="GI:503701500"
                     /translation="MSDRSSLIRWLVIPGVSLGVLILSAALSYWLTRPVHDAPLPVGP
                     PPAEERPTAQPPDTRGAPTPGLSPPSATPPPVRPPPAFPSARSEVPAPPPTSGDPRRV
                     VEVEPVIEATSGRIHAEDIRAAIQAVTPLVQQCFEDAAQRNRGPQTVKLRFTVEAGRE
                     GGVMSAGELVSSTIPDPFVQACALDSLLDVRFPAPYGGGKATVVYPFEFRVPGEETGR
                     "
     gene            564598..565434
                     /locus_tag="LILAB_RS02350"
                     /old_locus_tag="LILAB_02390"
     CDS             564598..565434
                     /locus_tag="LILAB_RS02350"
                     /old_locus_tag="LILAB_02390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013935577.1"
                     /db_xref="GI:503701501"
                     /translation="MPVTVEQLGPHDAEALRGLLSKDPISNLYLLGLLEEFGIAPRGR
                     VPFAFYGRFDGQALTAAVFVGGDGGLVVPSASDATATSVIADALASNLTLRSTVGDKS
                     SVDALLRSLAPGKPRLSRTQRLFSVSADDLGPFTNPLLRLAKEEDLPRLLPLAQGYVR
                     EVHERDPLAEDPRGYEARVIQRVRQRRTYVLEENGALVFKVDIGSRSQYGAELEGLYT
                     LPSERRKGHALLCLGQISRHLLSSLPRLTLRIDERDDSTARIARKVGYLAGRTWRLVL
                     VD"
     gene            565463..566086
                     /locus_tag="LILAB_RS02355"
                     /old_locus_tag="LILAB_02395"
     CDS             565463..566086
                     /locus_tag="LILAB_RS02355"
                     /old_locus_tag="LILAB_02395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-(MS[2]IO[6]A)-hydroxylase"
                     /protein_id="WP_013935578.1"
                     /db_xref="GI:503701502"
                     /translation="MSRPTPSRRPLSGEGPVILHAATDPRWLPLALERFDEVLVDHAH
                     CEKKAAANALSLLQAYPDLPGLPAQMARLAREESAHLARVLDLMAARGLTLTKDAGDP
                     YAQGLQKLIRTPAAERRTDRLLVAAVIEARSCERLSLLAEGLTDPALARFYGELAQSE
                     DGHQSLFYRLAVAASAGDEARVKARLEWMLEREAQVITDVGLRAAIH"
     gene            complement(566091..567944)
                     /locus_tag="LILAB_RS02360"
                     /old_locus_tag="LILAB_02400"
     CDS             complement(566091..567944)
                     /locus_tag="LILAB_RS02360"
                     /old_locus_tag="LILAB_02400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_013935579.1"
                     /db_xref="GI:503701503"
                     /translation="MTIAIVLGVVVIALVLFSFDTLPIEVSSLVVVCLLALTGVLTPA
                     QAFEGFSNDTVIFIFTLLAMTEGLASTGVVQLVGQRLAFFARFGHQTFVMAMMVAVAV
                     FSSIISNTVTTAAFLPVAIGAAQRAKVPKSKVLLPLAYASMLGGMVFLYGTSTNLVMS
                     AALQRAGLPGIGVTELAPVGLPLAIIGIIGVVLLAPWLLPAREGRGGMEDWTLRDYLT
                     EAVLPPDSRYVGKELGDISEGLGLRVIGIIRDGGALPAVPGYRLRGDERLLIEGNREA
                     ILRVKDLRGIAIRPDVRLSDEELRDKDSILIEASVPPGSPLVGRSLKETLFVERYGMV
                     ALALHRKPAIQRVTKLQLLGRIFGERSLSMLPLSVGDVLLLRGARDRVDELARGGNLT
                     VLSGHEYQPPRYGKALLAVVLFLGALVAGSLNVVPLSVAGLTGMLLMIATGCVDSRTA
                     FRVDWRVVLLIGSMMALGLAMEVSGAGAFIGDKVAALGAYGGPRMVMVLLMVLTIVLS
                     APMSNQAAALVVLPVALNAAQQLGLDARPFAMAVTLAASCSFITPLEPSCVLVYGPGH
                     YRFTDFFRLGTPLTTVLVVLLAVAVPWVWPLEKGASAAPRPAVGLRAPPGP"
     gene            568155..569948
                     /locus_tag="LILAB_RS02365"
                     /old_locus_tag="LILAB_02405"
     CDS             568155..569948
                     /locus_tag="LILAB_RS02365"
                     /old_locus_tag="LILAB_02405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_043712315.1"
                     /db_xref="GI:760029265"
                     /translation="MASTQVAAEGQQAPTKNPTLLAWVAKMAEMTQPDRIVWCDGSEA
                     EKKRLTDQAVQEGILIPLNPEKRPNSYLHRSNPNDVARVEHLTFICTPNKTDAGPTNN
                     WMEPEAAYTKLGNLFSGCMKGRTMYVVPYAMGPIGSPFTKLGVEITDSIYVVLNMRIM
                     ARMGKQALDMLGDSDDFNRGLHSTGDVDPDRRYICHFPQDNTIWSFGSGYGGNVLLGK
                     KCLALRIGSYLGREEGWMAEHMLILGVTSPKGETTYVAAAFPSACGKTNFAMMIPPAE
                     YKGWKIETVGDDIAWMHPGPDGRLYAINPEAGYFGVVPGTNYKTNPNAMESIAKDTIF
                     TNVAMTPDGDVWWEGKDGEVPEELTDWQGRPWKKGSTEKAAHPNSRFTAPMSNNPALS
                     PKANDPTGVPISAIIFGGRRSNTVPLVLQAFNWTHGVFLGATMGSETTAAATGKVGVV
                     RRDPMAMLPFCGYHMGDYLQHWLDMQKHIAQLPKIFQVNWFRQDKNGKFMWPGFGENM
                     RVLEWIVNRVHGRVPTQETLLGWVPRADEGLNLKGLDLASDVVTEVTSIKEDEWKSEL
                     KSQEVFFEQLGTKAPDALMLQRKLLMARLDH"
     gene            570092..570910
                     /locus_tag="LILAB_RS02370"
                     /old_locus_tag="LILAB_02410"
     CDS             570092..570910
                     /locus_tag="LILAB_RS02370"
                     /old_locus_tag="LILAB_02410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709082.1"
                     /db_xref="GI:760025949"
                     /translation="MRLAFVLSVVLALAPPVAFAQRGKSAGALIKDGERLYQAGKYRE
                     AAEALKKAHEAQPHPRLIYNIAISLENAGDLREAVSWYQQYVGATDGTDATLLKRSAR
                     SIDRLRVLIEKEDQATAAANAERQRLQEEADAARRQAEEEQLAARRAEEESRRQQEAE
                     LQRALTSYKRQRIGAFAAAGVGAAGVVAGVLFGMQARDAREQFDGATSVTSKDELADK
                     TRGRALLADVGFGVGLAGVITAIVLYPKEGPPVAGEVRVTMAPKGAGAGMAVSF"
     gene            570910..572340
                     /locus_tag="LILAB_RS02375"
                     /old_locus_tag="LILAB_02415"
     CDS             570910..572340
                     /locus_tag="LILAB_RS02375"
                     /old_locus_tag="LILAB_02415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013935582.1"
                     /db_xref="GI:503701506"
                     /translation="MRALGLMMTGSALLMAGCSFTTAGGLTECETSSDCDTAQVCNAG
                     YCLPQPVGCGTVYGPTTAANAIPLGATVPLSTSDGPDESEIQALNSIKLALDEINQRE
                     GVNGRPFVLHICDTRSDAARAAEQAQWLIRERQVPMIFASSSGQALSVATHTVPNGVL
                     MITYSGTSPDIATINDKIGTEAGLVWRTAPSDVLQGRIIGDLLQGRIQVNGAPLYDAV
                     SKVGISYVNDPYGQGLFGVTLGRINLPPENVTSSQYTRNGTDFSNVAQRIVTNAPDVE
                     VLIGFSEDNVRIINQTAAAGRDNQRWFFTDAGKDRGLFTALGNNRHLVTGAYGTSPAQ
                     AREDLVYRLFAQRFNSAFGEDPGQYSFTAHAYDAMYMVALGAAYAAGPDVNSPQAITG
                     ARIADGLALMTPDADGTPLNFNLGTEGFASARAAIRNGQVIDVTGASGNLDFDATGEA
                     PSEYELFRVTATGEFETVQLIAPPTE"
     gene            complement(572355..573524)
                     /locus_tag="LILAB_RS02380"
                     /old_locus_tag="LILAB_02420"
     CDS             complement(572355..573524)
                     /locus_tag="LILAB_RS02380"
                     /old_locus_tag="LILAB_02420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_013935583.1"
                     /db_xref="GI:503701507"
                     /translation="MSRFSERTDFARTPNPLALALERHRASGRPLLDLTESNPTRVGL
                     PLPDAALLAPEDAFTYQPEPLGLVSARQALVADFAARGAQVSAAHLLLTASTSEAYGW
                     LFKLLCEPGDNVLVPAPCYPLFEHLARLEGVQTRSYALPRAHGFGLDAREVAAACDAR
                     TRAVLVVNPGNPTGHFLHEGELAALADVCVDRRLALLCDEVFAPFAWDAAAPGRVATV
                     AGRALPMLTFALGGLSKAVGLPGLKLAWTHVGGPGHLRDEALARLEWVGDTYLPVGTP
                     VQRALPALLAHAPRFQAAVLERVRGNRQRLLAARPRGATWDVVPAEGGWSAVLRIPRV
                     PGEEATCLALLDAGARVQPGYFYDFGGGAFLVLSLLPQPEVFAAAVEVLTRTLGP"
     gene            complement(573521..573799)
                     /locus_tag="LILAB_RS02385"
                     /old_locus_tag="LILAB_02425"
     CDS             complement(573521..573799)
                     /locus_tag="LILAB_RS02385"
                     /old_locus_tag="LILAB_02425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015346893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935584.1"
                     /db_xref="GI:503701508"
                     /translation="MADIIDLTFLADVRRLYKKLIDQRGLSYFLQKEGPRLFHIEPSK
                     VELVLRTALRARDPQLPRPHDKAIEHCRKEVRRDLIRRVANAMLQTGL"
     gene            complement(573932..574615)
                     /locus_tag="LILAB_RS02390"
                     /old_locus_tag="LILAB_02430"
     CDS             complement(573932..574615)
                     /locus_tag="LILAB_RS02390"
                     /old_locus_tag="LILAB_02430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="WP_013935585.1"
                     /db_xref="GI:503701509"
                     /translation="MAQTDKPFQIFVTGTDTGVGKTQASCALLSLLADAGLRPQGFKP
                     YESGCASLRAPADALALRAAAGSALSVDAVCPHRFRLPVAPGVAASRLGREPDWDVTL
                     AAWRRLRGGNAVVEGAGGLFVPLDSKHDVIDLIATLRLPVLLVARAGLGTLNHTALSL
                     QALAARRIPVRAVLLSRGTSAKDASERDNRRLLEARHGVPVLGPVPHLPDARKRHAAF
                     RRALRPLLP"
     gene            complement(574602..575783)
                     /locus_tag="LILAB_RS02395"
                     /old_locus_tag="LILAB_02435"
     CDS             complement(574602..575783)
                     /locus_tag="LILAB_RS02395"
                     /old_locus_tag="LILAB_02435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_013935586.1"
                     /db_xref="GI:503701510"
                     /translation="MSDEAVAAAWAREDLEALSERGLRRYLEPLDSPQGPVVRVGDET
                     LVNFSSNDYLGLASSPTVRAAALAAVERYGVGTGASRLVVGDTAAHHRLEARLAAFER
                     AEAVRLFNSGYAANTGIIPALVGPGDAVFSDALNHASLVDGCRLSRARVCVYPHADVE
                     ALERALAQTPARRKLVVTDTVFSMDGDVAPLRDIVTACRAHGAALMVDEAHATGVLGH
                     RGAGLCEELGLEGQVDLRMGTLGKALGVMGAYVATSRAVADLLVSRARPFVFSTALPA
                     HLCAAAEAAVDAVEGDPDLRARLWRNIRRFAEGLRVLGVRAEPRSAVFPLILGEPERA
                     LDAARRLREAGVLVKAIRPPTVPEGTSRLRFCLSAAHTVGHVDLALEALRTVGVRRGP
                     D"
     gene            complement(575790..576824)
                     /locus_tag="LILAB_RS02400"
                     /old_locus_tag="LILAB_02440"
     CDS             complement(575790..576824)
                     /locus_tag="LILAB_RS02400"
                     /old_locus_tag="LILAB_02440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935587.1"
                     /note="catalyzes the formation of biotin from
                     dethiobiotin; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_013935587.1"
                     /db_xref="GI:503701511"
                     /translation="MPDTATVASEFSGHAHVAAPPPPGVAVRHDWSLDEVKALYELPL
                     LDLVHKAQTVHRAVFVDNKVQLCSLLSIKTGGCPEDCSYCPQAARYKTGVKAENLMAV
                     PDVLDAASKARAAGATRFCMGAAWREVKDGPQFDSVLEMVRGVRALGMEACATLGMLS
                     ESQAKRLREAGLSAYNHNLDTSPEHYGDIISTRTFEDRLRTLDRVRGAGISVCCGGII
                     GMGESVADRCNLLRTLANQEHHPESVPINALVAVEGTPLQAQQRVETVDMVRTIATAR
                     ILMPQSMVRLSAGRQQMNEEAQLLCMMAGANSLFFGEKLLTTGNPEYTQDMALLEKAG
                     IRPLEPRQEG"
     gene            complement(576967..577236)
                     /locus_tag="LILAB_RS02405"
                     /old_locus_tag="LILAB_02445"
     CDS             complement(576967..577236)
                     /locus_tag="LILAB_RS02405"
                     /old_locus_tag="LILAB_02445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_013935588.1"
                     /db_xref="GI:503701512"
                     /translation="MGIIAFLVIGLLAGLIARALMPGNQSMGLLATTLLGIAGSFVGG
                     FIASLFRSDGNVFDLHPTGLLFSVLGALLVLFLVGLAGRGRRVHV"
     gene            577420..578787
                     /locus_tag="LILAB_RS02410"
                     /old_locus_tag="LILAB_02450"
     CDS             577420..578787
                     /locus_tag="LILAB_RS02410"
                     /old_locus_tag="LILAB_02450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_013935589.1"
                     /db_xref="GI:503701513"
                     /translation="MAKAKTHYTCQACGYKTAKWLGKCPDCGAWSSLLEETDPKADER
                     RPAWGASGGAARPMLLKEVSGETETRRRTGIAEFDRVLGGGVVSGSIVLLGGDPGIGK
                     STLLLAALDRLARHGPVLYVSGEESLRQTKMRAERLKVEGDSIHLFAETDAERVLTAT
                     EALKPQALVVDSIQTMYLPELGNAPGSITQVREVAGRLMAYAKRTGVPTFLVGHVTKE
                     GSIAGPRVLEHMVDTVLYFEGERGHPFRILRAHKNRFGSTNEIGVFEMKGAGLVEVPD
                     PSALFLSERPVGKSGSVVTSTLNGTRPLLVEVQALVAPTGYGTARRTAIGVDGNRVAL
                     LAAVLEKKEEIPLVGCDLFVNVAGGMQLTEPACDLAVCAALVSSLQNRPLDPKTLVLG
                     EVGLAGEVRAVGQVEPRLAEAAKMGFQRVVMPAGSARRLEDAGPKMKIVGVETLGDAL
                     VAMFD"
     gene            complement(<585891..>586514)
                     /locus_tag="LILAB_RS02415"
                     /old_locus_tag="LILAB_02460"
     CDS             complement(<585891..>586514)
                     /locus_tag="LILAB_RS02415"
                     /old_locus_tag="LILAB_02460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013941603.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043712318.1"
                     /db_xref="GI:760029268"
                     /translation="VQNVSALVAYGVGEDGHRHLLAITLGGSESAESWLELLRQLLDR
                     GLKDVRLVIADGHAGLAAAARQSLPEARLQRCTVHLTRSVLAKAPWRLRGRLGKETSA
                     IFEAPNRQGARKRLEALQEGLGRQVPEAMECLREGFAAATCFFSFPKAHWKRLRSTNG
                     LERLHGEVQRRIRSVGAFPDRASALRLITAVALEVTGVWDDRRYLDMS"
     gene            complement(586535..587035)
                     /locus_tag="LILAB_RS02420"
                     /old_locus_tag="LILAB_02465"
     CDS             complement(586535..587035)
                     /locus_tag="LILAB_RS02420"
                     /old_locus_tag="LILAB_02465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011985390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013935592.1"
                     /db_xref="GI:503701516"
                     /translation="MDDTEFESPAHEAVQADLRALFRGAIRMTLEALLEEEVGELVGA
                     GRWQRMVGRADVRNGSYLRTLVTTAGAVDVAVPRTRHSGSAGDVLGRYKRRSGELDEA
                     ITSAYVQNVSTRRMGKVTRALMGEAVSRSGGEPGDEDAGGEGGGAAYPAPHPGLSLPL
                     PGCHLP"
     gene            587680..589854
                     /locus_tag="LILAB_RS02425"
                     /old_locus_tag="LILAB_02470"
     CDS             587680..589854
                     /locus_tag="LILAB_RS02425"
                     /old_locus_tag="LILAB_02470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_043709084.1"
                     /db_xref="GI:760025951"
                     /translation="MKRQLTWFMLAVGVQLSACGTESIADAQLPEAPAIEDTPAVQAE
                     AVDDGATTLYEDALGPGWADWSWATRNLAAASPVASGSRAISVTFGPWTGLYLHHSGV
                     STSGLEFLEFQVHGGATSNPALTTYATVGNQARPTIAINRYCDGGAIKAGAWTRCRVP
                     LTALNVANVTMDGIAIQEGAGRNLPVMTFDSLRLGTATLSAPSGLKAGASATDVSLTW
                     NGVSGATGYHVYRATSQTGTYAKRTTTPLTNTTYRDINVSAGATYWYAVTAVGTGGEG
                     LRSTPVSATVQPPQQQVAISVTPTSASLAPGASRTFTAAVTGSTNTAVTWSIQQGGAG
                     GTITHAGQYTAPRTTGTYHVIATSQADTTKKATATVSVAATQPGSGKWVSGYYTGWNA
                     DLYPPEKVDFSALTHIIVGRVTPRPDGTLNTAFDNNNGPQIARTLAQRAHAAGRKAII
                     MVGGAGEHAGWVSAASNANRARFVQNLLNAMDTFGYDGLDIDWEPVEAADKPNLLALV
                     KELRAARPDMLLTFPIGWINSNFASDADPWFANLAPYLDQINIMSYEMIGPWDGWQSW
                     YTSALYGESGNRPTSVSSSLQGWARAGIPKAKLGMGIPFYGMAWRNITGPYQDFTHWS
                     DYVGSDNAFTYQKIQQLSAAGTYRWDAVAAASYVTFNTPVEDGTVRWISYDSPQAIAA
                     KGAYAKDHGFGGTIIWTINQGCTNPTTGANPLLDAVKGAFLQ"
     gene            complement(589919..590470)
                     /locus_tag="LILAB_RS02430"
                     /old_locus_tag="LILAB_02475"
     CDS             complement(589919..590470)
                     /locus_tag="LILAB_RS02430"
                     /old_locus_tag="LILAB_02475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase reductase"
                     /protein_id="WP_013935594.1"
                     /db_xref="GI:503701518"
                     /translation="MRKLKYHVATSVDGFIAHEDDTYGAFMQTRLIQDSEHVTDFVAS
                     LATYSAALMGRRTYEVGLKEGVTDPYTNLETYVFSRTMKESPNPRVKLVSEDAVGAVR
                     RLKAQEGGDIYLSGGGAFAGLLFAQGLVDEVLLKMNPLILGAGIPLVSSLRQVVDLEL
                     KSTKVYGNGVLLLRYAVLPRPKA"
     gene            590776..592269
                     /locus_tag="LILAB_RS02435"
                     /old_locus_tag="LILAB_02480"
     CDS             590776..592269
                     /locus_tag="LILAB_RS02435"
                     /old_locus_tag="LILAB_02480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="developmental sensor histidine kinase SasS"
                     /protein_id="WP_013935595.1"
                     /db_xref="GI:503701519"
                     /translation="MAHVPPHTSRWRDALGSLSARLLVAFLVPTLLFVAVAGTAVYQL
                     ARTILEEELGTSLSAIAAATATQVHGERLLTVEPGDDVASTRTWRNFVRTFEGIAEAS
                     GVRRIYAVDTQGRVRVDVGGGLPVGAEMPELARDRLELTRVFEGARAASQVLFTGSDG
                     RLYKTGYAPILYEGRVVGAVGVEGSAVFFGPLQELSRTFATMGAVALTALAVIALVTA
                     RGLARPLRRLMASALRIGRGDLTTPVPPEPTLEIGVLARELEDMRGALESRDRQLKMM
                     LAGVAHEVRNPIGGIALFSGILKEDLQAGAHAEAGAHVERIQREVAYLQRIVEDFLAF
                     AREQPLARAPVEAPALLSVACELMAAEASARDVTVDLDAAPAVLEADGSLLTAALVNL
                     VKNAVQASPPGGRVRVSGAPNGGHYTIQVRDAGPGVPGAERERIFEPFFTTREKGTGL
                     GLPLARKIALAHGGALRLDSAPGDTRFTLTLPLGGTPGDSAAITLSR"
     gene            complement(592253..>593196)
                     /locus_tag="LILAB_RS02440"
                     /note="chemotaxis protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(594287..595036)
                     /locus_tag="LILAB_RS02445"
                     /old_locus_tag="LILAB_02495"
     CDS             complement(594287..595036)
                     /locus_tag="LILAB_RS02445"
                     /old_locus_tag="LILAB_02495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqC"
                     /protein_id="WP_043712320.1"
                     /db_xref="GI:760029270"
                     /translation="MARPEAAPHRYAPPDLTPTAHPRWLEAMLESLREDWNTACWPPL
                     FRATADGQRPPLRHWRRVLAHFFPIVEAFPKYMGLSLAKTTYGQRPGDASARRWLLQN
                     LGVEAKHAEWFIDWMRGIGLAPEDVFRQRPLPEVRALHEHLLDTCARGTLAEGVAASN
                     WAVEGITGVWTREVVEPFRAYAEEGARIDAYSMMWLKVHARYDDQHPEEALEIIKLST
                     DASSGEPFRVQAAARKSLRMYAAALHACCRD"
     gene            complement(595289..595870)
                     /locus_tag="LILAB_RS02450"
                     /old_locus_tag="LILAB_02500"
     CDS             complement(595289..595870)
                     /locus_tag="LILAB_RS02450"
                     /old_locus_tag="LILAB_02500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_043709085.1"
                     /db_xref="GI:760025952"
                     /translation="MESDASSAMALQALLARHVPEDVKEQEDLERMRHFAHALAQPFS
                     REQREAHFTGSAVVVDPAGARVVLLHHRKLQRWLQPGGHADVTDAGEMAATALREARE
                     ETGCRVFLHPTAPQPLDVDLHTIPARRDEPEHHHLDVRFLVVAENPDALAHDPAESFG
                     VRWLTWDEAMTHADEAPLRRMLAKARRVVAGAP"
     gene            596014..597423
                     /locus_tag="LILAB_RS02455"
                     /old_locus_tag="LILAB_02505"
     CDS             596014..597423
                     /locus_tag="LILAB_RS02455"
                     /old_locus_tag="LILAB_02505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_013935598.1"
                     /db_xref="GI:503701522"
                     /translation="MARILVIDDHDTLREGMTVTLTRSGHAVSAVRSGQDGLAAYRKA
                     PFDLVVTDLKMDGMDGIAVTKSLKALDAAAVVMVVTAFGTIETAVQAMQEGAYDFITK
                     PFPPEVLRAKVDKGLELASTRKQVERLTARTDAHDTDAALTHGNLVGDSEPMQRLVSN
                     VLKVAQSDATVLVRGESGTGKELVARMLHQRSPRRDGPFVVVHCAALAETLLESELFG
                     HERGAFTGAVKRKLGRFELADGGTLFLDEIGEIPASVQTKLLRVLQEKEIQRVGGEDT
                     LKVDVRVVSATHRDLQAEVKAGRFREDLYYRLHIVPLTLPPLRERPEDIPVLARHFVA
                     KHAVRVNRRVTGLDDSALRALARHAWPGNVRELENVIEQALVFAEGERLTDLDLPSHL
                     TATGTSRLDAGLPVLQGDRPLPDILEDLERQLIARAYEKASGVKTETARLLGIKTSAL
                     YYKLEKYGFLPRETPPEEG"
     gene            597597..598643
                     /locus_tag="LILAB_RS02460"
                     /old_locus_tag="LILAB_02510"
     CDS             597597..598643
                     /locus_tag="LILAB_RS02460"
                     /old_locus_tag="LILAB_02510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="developmental regulator SasN"
                     /protein_id="WP_013935599.1"
                     /db_xref="GI:503701523"
                     /translation="MTPRALALLLSLLLAMPGQAASGLEAVRGRAQVARAETRALRGQ
                     QQTLRDELNGLAARIETLKARRQGRLMAGTDLEDALRRSQELSGQLTRLAQAVVAAEG
                     EAERAHLALHTALSDELARLLAAWEGTMDRGQRAKLLESVRSVRAEREAVRAALPASQ
                     VPSLDRATAGGDDPEDLLAQADTLRDTGDKVRERLKALRGRITEVREERDLDRRMNDF
                     LGEESMFDDHDRRLRLRMGSDRSIQVERSEPGTPMFQGDDAAPPGPNVGGRPNEGADP
                     DPGPSPTPTPFSARAADRRPLVETQRAQDLASGGPVDLAAMEAEAARLEALARELEGR
                     ATKLERRAQELGVP"
     gene            complement(598665..599237)
                     /locus_tag="LILAB_RS02465"
                     /old_locus_tag="LILAB_02515"
     CDS             complement(598665..599237)
                     /locus_tag="LILAB_RS02465"
                     /old_locus_tag="LILAB_02515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709091.1"
                     /db_xref="GI:760025958"
                     /translation="MTAPPAARYIEPMRLVSLLVAASLGLSACASSTFTTEVKGESTV
                     PAGPPGDVTLLNGLPAISSFAGMDFDKNQDFKNQGIRKSEVTSVKVESLTLKVLSPND
                     QDLTFLDSVEFYARAGDREERIASRQDVAQLDLRPPNPVLSLRVDNVELQPYVSAPTM
                     SIIIRGRGRMPEREVRLQAVVKLQVETGLL"
     gene            599284..600363
                     /locus_tag="LILAB_RS02470"
                     /old_locus_tag="LILAB_02520"
     CDS             599284..600363
                     /locus_tag="LILAB_RS02470"
                     /old_locus_tag="LILAB_02520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935601.1"
                     /db_xref="GI:503701525"
                     /translation="MVRGAVARSFAPLLLVLAMLAAGRAPAAEWEGALRGSARLLLDT
                     NAPRDYSDRTTRGPERDFAFSLLGAAEGRGSFERAQLVGRYELGARKYVLYQEEDTLV
                     QSGAMEASHALGTSLGIGLEGHAKDRRGGSRSYSDLGTTAFLEYAPDVRLALRVRAGA
                     RRFVYRPAPTANFGGPEVGVLGRYRFDRRHSLSVFGDWNARRFGTAPRARPPGTGGSS
                     GLLPGRRQDGALTAGASYTYRGPVALGLTYAFQELSSNSYGETLRRHRVSANAGVRLP
                     WRVTLLAQGSLGLTQYPDGIYLSPEIILVEEDEGQNSLSAKLARPLTDTLDLEASWGI
                     WSTRLPRNALTYTRQVFSVGFTWRY"
     gene            complement(600374..600688)
                     /locus_tag="LILAB_RS02475"
                     /old_locus_tag="LILAB_02525"
     CDS             complement(600374..600688)
                     /locus_tag="LILAB_RS02475"
                     /old_locus_tag="LILAB_02525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015346870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_043712322.1"
                     /db_xref="GI:760029272"
                     /translation="MSDARLEQFKKMVADFPDSPMSHFSLGKLYLERRQYPEAAHALE
                     AAVRLDPTYAAAMVALGDAWAGAGEAGKAREVLERAREHALAQGHPGLAEEIDERIAD
                     LA"
     gene            600978..601310
                     /locus_tag="LILAB_RS02480"
     CDS             600978..601310
                     /locus_tag="LILAB_RS02480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein IOJAP"
                     /protein_id="WP_043712324.1"
                     /db_xref="GI:760029274"
                     /translation="MAHRIGNLLLDKKAQDVVILDVRGMTSYADYFVIASAETDRQVS
                     AMAENVQVQLKTGDAPLRPIGTEGFETGQWVLLDYGEVVAHLFLTDLRAHYDLEGLWA
                     DASREKLA"
     gene            601312..601776
                     /locus_tag="LILAB_RS02485"
                     /old_locus_tag="LILAB_02535"
     CDS             601312..601776
                     /locus_tag="LILAB_RS02485"
                     /old_locus_tag="LILAB_02535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_013935604.1"
                     /db_xref="GI:503701528"
                     /translation="MKVRLLSIGKDRSGLYEPAVQEYARRLGHYTRFELVELSEASGK
                     RLKPGDAKAAEAEAILARRKPQDWLVALDERGALLDSVELSRYVGKAQTGAKDLLFII
                     GGDEGLDASVRDAANLTLSLSKMTLPHRLARVVLIEQLYRAFTILKGEPYHK"
     gene            601840..602997
                     /locus_tag="LILAB_RS02490"
                     /old_locus_tag="LILAB_02540"
     CDS             601840..602997
                     /locus_tag="LILAB_RS02490"
                     /old_locus_tag="LILAB_02540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551357.1"
                     /note="mutations in this gene result in a compromised
                     ability for drug-inducible mexXY expression; expression is
                     inducible by the same ribosome-targeting agents that
                     induce mexXY; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709094.1"
                     /db_xref="GI:760025961"
                     /translation="MRTDASSGQLPSSAPRAPVRVIASAQSWVEGEAVRQLEAMARLP
                     GMKLAVGLPDLHPGKGAPVGAAFTSEGFLYPYLVGSDIGCGMGLWNVDLLARKARPER
                     WAGKLDLEGPWTGDAEGFLQEHGVKSSGYEAALGTVGGGNHFAELQRVDAVHDSKVFS
                     ALGLEADRLLLLVHSGSRGLGEAILRAHVDRHAAGGLADDSPDARTYLTRHDHAVEWG
                     RANRALVARRMLDGIGAMGQRVLDVCHNSVTPRRDTGRTQWLHRKGAAPSDEGPVVIP
                     GSRGALSYLVIPTGESHTSAHSLAHGAGRKWTRTAARERMRERFTAESLTRTAFKSHV
                     VCENKDLLFEEAPPAYKPIDRVVTDLVEAGLVRVVATLAPVLTYKTRARSE"
     gene            603227..604768
                     /locus_tag="LILAB_RS02495"
                     /old_locus_tag="LILAB_02545"
     CDS             603227..604768
                     /locus_tag="LILAB_RS02495"
                     /old_locus_tag="LILAB_02545"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635276.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="WP_013935606.1"
                     /db_xref="GI:503701530"
                     /translation="MTPAHKVLLCILDGWGIRQERDNNAILLAGTPHLDKLASPYPFT
                     ELQTAGLAVGLPEGQMGNSEVGHTNIGAGRIVYQDLVRINRAAESGELAQNPVLRAAL
                     DGVKADGKALHLLGLVSPGGVHSSMDHLFALLKAAKERNVAHVYVHAFLDGRDTPPQS
                     ALGYVEELERFLHETQTGRIATVSGRYYAMDRDKRWDRVQQAYEALVFGRGPKAPDAL
                     SAIRASYAEKVTDEFVKPTVLAGGDGTPVGRIQDGDAVLFFNFRADRARELTQALAFP
                     EFKEFDRGGLRLGRYLCMTQYDETFKLPALFEPDQPQDIFPELLSRQGLRQFRTAETE
                     KYAHVTFFFNGGREVTYAGEDRHLVPSPRDVKTYDLKPEMSAYEVTAELVKRLDSGKY
                     DFALVNFANPDMVGHSGRLDAAMKAVKVVDECLGALGKACERNGWVLAISADHGNCEQ
                     MVDPETGEPHTAHTLNPVPFHLIHPDFRGQKLRPGILADIAPTLCKVMGLPQSKEMNR
                     QGLLP"
     gene            604788..605489
                     /locus_tag="LILAB_RS02500"
                     /old_locus_tag="LILAB_02550"
     CDS             604788..605489
                     /locus_tag="LILAB_RS02500"
                     /old_locus_tag="LILAB_02550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_013935607.1"
                     /db_xref="GI:503701531"
                     /translation="MLKALLDLLYPPSCLACTKVLPGPEGFFCETCDTALERLPPACC
                     RTCAEPGAFPGDTCPRCRASPPPFTRAWAPFAHEGPLARAIHRFKYEDHPNLAGPLGE
                     LLAGEAHSFLSRAPGLVVALPLHKRRYHARKYDQAQLLAGALAKATGRQAPVGLLTRH
                     RETQRQVGLSEADRASNVDGAFAASSNVSGQRVLLVDDVFTTGATARAAASALREAGA
                     VQVEMLTLARAFSLE"
     gene            complement(606306..607622)
                     /locus_tag="LILAB_RS02505"
                     /old_locus_tag="LILAB_02555"
     CDS             complement(606306..607622)
                     /locus_tag="LILAB_RS02505"
                     /old_locus_tag="LILAB_02555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935608.1"
                     /db_xref="GI:503701532"
                     /translation="MLLGGARGQEDEFDVLLRNAGLDARDARPVAGNPLTPKHAARLL
                     DALLRRDVTLGQFPARLAVGFMLREVLATGEVSRAELVRRVARFRHLAVLRPDGRLAW
                     VRSGRTQQRVADVGWKDGAFRAHGFELGRFYDGRTGVFRLLNDELREESGFPLADVHD
                     DADVVSRTLDGAEEAFVGLALAVGKFFSTSPAESLAALRELPAGVVALLRSSPEYLER
                     FGYMTRGEQVQAVSRLVTNLIATWGTASAATRTLEGTALATAEVPALVLSAQGTVAMR
                     LVAAPVGRAAAVLSGGPGAAIILHRVTVPGGHSTPSDGPGRWEAATESMKEPALRYEK
                     QVTGAPEGQIYKVEDVSFDGFNEGVLLEAKGPGYAKFIPDAAENGGWYQGFRKIVTQA
                     ERQFAVANGTPVRWHFAEREAADFVRELFRTEGLGRIRVVYTPPLP"
     gene            complement(607782..608564)
                     /locus_tag="LILAB_RS02510"
                     /old_locus_tag="LILAB_02560"
     CDS             complement(607782..608564)
                     /locus_tag="LILAB_RS02510"
                     /old_locus_tag="LILAB_02560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposition helper protein
                     truncated"
                     /protein_id="WP_013935609.1"
                     /db_xref="GI:503701533"
                     /translation="MSTYDELVPVLKKLRLSGLLQSLEVRCREAADANLSLTEFLYRL
                     LADEVERRDGKQLDVRLRRAAFERPSTLEDFDFSFNTSVPRAKVLELGTCTFVERHEN
                     VLVVGPAGVGKSHLAQALGQRACRAGHAVLYVSAHDMLTQLRASRADNSYERRLLRFT
                     TPALLIIDDLGLRPLTGEEGVDLYEIIRRRYERAATCITSNRALEEWPPLFGDALLAS
                     AAMDRLLHHSHVLTIEGDSYRNPPLAKRTRAPRAAHADTAAR"
     gene            complement(608619..610190)
                     /locus_tag="LILAB_RS02515"
                     /old_locus_tag="LILAB_02565"
     CDS             complement(608619..610190)
                     /locus_tag="LILAB_RS02515"
                     /old_locus_tag="LILAB_02565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013935610.1"
                     /db_xref="GI:503701534"
                     /translation="MDRLQELVRLHRLGTPARQVARVLRMGVDVERNYRRVLEAAGLL
                     RGDVQVLPELEVLKAAVLAARPAAPPAPQQTSSLEAHRAQVESWVAKGLQPQAIFTRL
                     QMEAGVPVGSLSAVKRLVGSVRRAQGVSEEDVAIPVETAPGEVAQVDFGEVGRLYDAD
                     TGTLRRAWVFVMVLGYSRHLFATLVFDQRVETWLRCHEAAFAYFGGVPRCVVPDNLKA
                     AVVRAAFGVDGERALQRSYRALARHYGFIVDPAPPRAPEKKGKVEAGVRYVKGNFFAG
                     RAGEDARECEVALQRWLRDVASVRVHGTTGRQPRLLFQQAEAAALRALPAAAWAPEVW
                     HEARVHRDAHVMYGRRLYSVPWRLIGQRVWLCVTAHDVRVYAQDERVATHPLRGEGHR
                     STVEAHLPEARAALRHRSRGHWEARAARLGPHTEAYVRAVFDADDVLSQLRCVQAMVV
                     HLEGFPRERAEAACRRALHFGNLRYQGLKDILRRGLDLQPLPQDGHLAIATPAATAAP
                     PAPRYARDVRTLLLR"
     gene            610728..612146
                     /locus_tag="LILAB_RS02520"
                     /old_locus_tag="LILAB_02570"
     CDS             610728..612146
                     /locus_tag="LILAB_RS02520"
                     /old_locus_tag="LILAB_02570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008672175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935611.1"
                     /db_xref="GI:503701535"
                     /translation="MSKVMLEVPEEVAKLLKVMEAKLRQEGAAGKSFGEVDPEGALKA
                     IDEAAAALQCDAKRRLLQGYDVDAPRLQLAGQLHSRVGRYTATYKTRQGPVEVERSLY
                     RQVGVRNGPTVDTVSLRAGCVADGWMPEAAVPMAYLLARGTSREAEATARQMGVLPYC
                     RASFERVGHEVGALYGGQRSRVEVVLAQEMQVPRGTRGVSVSMDRVAVPMEEPKKRPV
                     GRPRKGAPTRPVDVVWRMAYAACLTFHDAHGEALGTIRYGRMPRGEAREVAERLARDV
                     QALVSRRRGLYVAVLTDGAPELHALLDEALATHAPAAKKPVRLVDFWHLMEKLGAAAR
                     VVAGEETASALREKWKLSLLNTPGAAWAIAMALHASGKRHVVLGDGKPVHEALTYLEN
                     HGERMHYAEARARGLPIGSGNVEATCKSLVSLRMKRPGARWKEASGQHILDLRALVLS
                     ERWDAAMNLTLAPQRAEVRRAA"
     gene            complement(612179..612901)
                     /locus_tag="LILAB_RS02525"
     CDS             complement(612179..612901)
                     /locus_tag="LILAB_RS02525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015348856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709097.1"
                     /db_xref="GI:760025964"
                     /translation="MVETYYAAAYWRARKESSDECASRVVALLESIAGVEASFASWFR
                     QSKARKDAWKKPVTPNQTELAKALERTKDRHHEDLGYRIGGWNGASEDSDACSFDAAV
                     GIYSEWVNNFWLFELPIHGASAERVLTARVLSGLLRGMATALDPDWGVAMSHAHREIA
                     DPTGRANVQIGWVTYLAHRLGVVPPLPAPVRIEPVEDKGTLIVLTPERLTADNPEHVA
                     LAERVRELLDRAGLLKPLQAQP"
     gene            complement(612915..614471)
                     /locus_tag="LILAB_RS02530"
                     /old_locus_tag="LILAB_02580"
     CDS             complement(612915..614471)
                     /locus_tag="LILAB_RS02530"
                     /old_locus_tag="LILAB_02580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709099.1"
                     /db_xref="GI:760025966"
                     /translation="MRAGHWVVGVALLLTGCAGVESSTRRETFHQRAALPGERWTASG
                     EDAEYEPEAEAAEGASRQPLHRRHLFRDGMLLGGARGQEDEFDVLLRNAGLEGRDARP
                     VKGSALTPKHAARLLQALMGRDVTLGQFPARLAVGFMLREVLATGEVSRAELVRRVER
                     FRHLAVLRPDGRLAWVRSGRTQQRVAPVEWREGAFRAHGFELGRFYDGRTGVFRLLND
                     ELREESGFPLADVHDDADVVSRTLDGAEEAFVGLALAVGKFFSTSPAESLAALRELPA
                     AVVALLKSSPEYLERFRYMTRGEQVQAVSKLVTNLIATWGTASAATRTLEGTALATAE
                     VPALVLSAQGTVAMRLVAAPVGRAAAVLSGGPGAAIILQRAGTAAKDGAPSKGPGQWG
                     PAKESMSPRARRYQEQIAGHSADEAYWVGGVGRDRGGVKFDGFDAGVLLEAKGPGYAR
                     FFEELDPKRWFKNSGAKALGEQALRQVKAAKGMPIRWHVAEETAVPALRKLLQDRGIK
                     GIEVVFTPPL"
     gene            complement(614487..615644)
                     /locus_tag="LILAB_RS02535"
                     /old_locus_tag="LILAB_02585"
     CDS             complement(614487..615644)
                     /locus_tag="LILAB_RS02535"
                     /old_locus_tag="LILAB_02585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013935614.1"
                     /db_xref="GI:503701538"
                     /translation="MLVRKVAINEEQVRAFLENLFGEDRRAKRVLSLSHATLGVVHAA
                     SLSVHAIGQALAWARGGVQKHGIKQVDRLLSNEAVDVWKLAASWVPYVLAERTEAVVA
                     LDWTDFEADDHTTLVASLVTSHGRTTPLLCLTLKKSAMAGNRAQAEDELLLRLKECVP
                     EGVQVTILADRGFADQRLYALLAQAGFEYVVRFRKDVRVEVEGGHQRPAAEWIPASGH
                     AKKLTEVHVTADRTPVPAVVLVHQKGMKEPWCLATSLGAASARQVVDLYARRFSCEET
                     FRDVKDLRFGMGLSTVRVKSPERRDRLLLVSALAQVLLTLLGAAGESLGMEKGLKANT
                     VKTRTYSLFRQGCMYYQAIPMMKEERLRPLVERFAELLRHHPVFKEALGFI"
     gene            complement(617722..618633)
                     /locus_tag="LILAB_RS02540"
                     /old_locus_tag="LILAB_02595"
     CDS             complement(617722..618633)
                     /locus_tag="LILAB_RS02540"
                     /old_locus_tag="LILAB_02595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935616.1"
                     /db_xref="GI:503701540"
                     /translation="MRATSSVILLLVLLMAEGTPAQGTLAPANGARRIELGPDGSGAL
                     TEIAVSPGLSTVILFDSELAQDGVDVEESGSFSNVDIGRTTMRLVPSGRGQPGEKFRM
                     SVRFRDGAAPPGALFLLTIHPARADSVVEVYRNARTVESYQQEAREARSETLRCQEDN
                     ARLMLERGAPSGLAGLLATGGVDANGVAGRIVTNTVTSDPRSALNLLRIQSYRAKARV
                     ALEVSLHDLRGERPWVVSGATLRGSPGTELKVLSVWQSSPIVSGESARVVVEAEAPAE
                     SARGAFSLKLWEADGPRTVTIGNVTFP"
     gene            complement(618669..620507)
                     /locus_tag="LILAB_RS02545"
                     /old_locus_tag="LILAB_02600"
     CDS             complement(618669..620507)
                     /locus_tag="LILAB_RS02545"
                     /old_locus_tag="LILAB_02600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_043709107.1"
                     /db_xref="GI:760025974"
                     /translation="MRLRGPALAELPPGAQVMGYTVERRLGSGGFGAVYLARCEGRAY
                     ALKLLDLARVGGRVEREVSILLKLSHPNVVGLHGFGEWPVASPSLGVIVMEYVEGRQL
                     DVWASEENPSARQVARVVLDVARALEASHEAGVLHRDVKELNVMVRASDGVAKLVDFG
                     VGDYAGAPGITVDILPPGTPEYRSPEAWSFFRRNARVPGAFFTPGASDDLWALGVVLY
                     RLLTARPPFPTDHFMLADAVIANEALPPCQVNDRVPAALSEVCMALLAKTPASRTPSA
                     GALRVALEALLQGADAAWDVPLCDAYGDDTATTEGGMDSHEKWLNEALRRPRRGRRPD
                     MDPPLQWEGRAPPLDEEPAAARTPRPVRTSRGWRMGAMALLVGLVSAGLVWSGRPPRV
                     AVPAPTRQEVARPGSSSQAGRAAALPSGAESTPAAVAAPAMLPEATPVKMEKTESPTP
                     PKPARKGAGAMRRPIVAAAACMGLACPGAQVRPPPPPEPCPERAVEVMEKLGVKVGDH
                     WGVSFLVNKPQVIKVTDGPAELLLLADWNRMPNSTIFSGRLIVSDRVYGRFTHARTRD
                     GKSFPVCLELESEFLVKGLAREPGDDSPTSARVFTTGDVRAVDAFE"
     gene            620877..621236
                     /locus_tag="LILAB_RS02550"
                     /old_locus_tag="LILAB_02610"
     CDS             620877..621236
                     /locus_tag="LILAB_RS02550"
                     /old_locus_tag="LILAB_02610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_043709110.1"
                     /db_xref="GI:760025977"
                     /translation="MNEELAITIGTAAREAREKLGMTRAEVAERVGLVEPAYRRMERG
                     KVLPSVTVLHRLSLTLGLSPEVLLGTAPQATGKKSSRPPLLDAETAELRRLLSLARKL
                     DAEKLDALLHVADALTR"
     gene            complement(621233..622396)
                     /locus_tag="LILAB_RS02555"
     CDS             complement(621233..622396)
                     /locus_tag="LILAB_RS02555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015348851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_043709113.1"
                     /db_xref="GI:760025980"
                     /translation="MPSTTDSGRPPAQSRVPRPPATPDAPQPLFTVGGVRYEAVRELV
                     RMPTGEVLLQALRYALEEEVPGRCLVRRLPSPSTYEERKRLSDEIQLAFRLNHPGIAQ
                     VFHLKIHRNTPHVVMEYVEGPSLDTLVSAGMARGKPVSEALALYIGAEIADALHYAHT
                     LRGEDGRPLGIIHRDVNPRHLYLGAHGGVKLANFGAAYSLMVGRLESPANLVRGDVAY
                     ASPEYLERLPLSPASDIFSLGVVLVELLTGKHLFDVEDVPLPPEGLSSLRVEQFTSLP
                     LTQMRVLLSSFSPADVEAAVAGLSPDVKAILHSALRIVPDERFATAADMGGVLRAALT
                     KRYPSYGRQDARQEVARVIAEGSCLRDVVEFGEAGLYPEGLDAHELGALGEED"
     gene            622580..625285
                     /locus_tag="LILAB_RS02560"
                     /old_locus_tag="LILAB_02620"
     CDS             622580..625285
                     /locus_tag="LILAB_RS02560"
                     /old_locus_tag="LILAB_02620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M1"
                     /protein_id="WP_043709116.1"
                     /db_xref="GI:760025983"
                     /translation="MRSLLPLLLAAAVLRCAHAPEATPAAPVATAPEWPEPQPPALRL
                     PESVRPTRYALDLKLLPAEPTFSGSVSIDVEVSEAARQIWLHGQDMEISQARVEAGGR
                     TLEARAVTASEGRLGLLLPETVQPGKARIHLAFTGKVDRERSQGLYAVEEDGEPYLYT
                     FFEPVDARRAFPCFDEPGFKVPWTLRITAKEEHVALANHPIVSREKLPDGLARVTFAE
                     SKPMPSYLVAFVVGPFDIVDAGTAGRNAAPLRFIVPRGRGAETAYAASVTPRIVSLIE
                     DYFDMPYPYEKLDVAVVPRYWGTMEHPGLVALGQPLTLIRPGEETLARRKWYVHIANH
                     ELGHYWFGNIVTCNWWDDIWLNESLTSWLDRKTVDPFDTSWGFGLEQSVQSASFALET
                     DTLAATLPVRKPATTHDEVLGAFDNGTTYAKGSAILDMFEAWLGEERMRDLLRGHIKK
                     NEWGVTSSEDFAATLSAAAGPDVARAFRSFIDQAGAPRIAAELQCQPGAPAKLKFTQE
                     RYVPAGSTASKDQTWTIPVCVRAGSGETSERTCTMLTGATSELELPGKRCPSWVLLNA
                     GGTGYYRSGYTPQQLSRVLAAPERALTVREHLTLLSDMEAGVRRGDLPLGEVLRHVPT
                     TARAEHRLIRQRGASLLGFVHPERLSDDERARYRKWVAAMYGPRARALGWEPRPGDDD
                     AVKAQRPGLLSLAALRGEDPVLVREANRLVKAWLADRKAVHPEAVPLALVVAARNGDK
                     AFFDTLVARARATEDRTERSRIFTTLGAFRDPALVREALALVTGSEFDVRDTRPILTG
                     FITVAQTRALAWAFLQEHFDALASRMRSDEVAGLIGLVGTLCDDASAAEAEAFLGPRA
                     AKLDNAPQALTEALESIRLCAASASMNAQSVRDFLKKAPATSSAR"
     gene            625360..626115
                     /locus_tag="LILAB_RS02565"
                     /old_locus_tag="LILAB_02625"
     CDS             625360..626115
                     /locus_tag="LILAB_RS02565"
                     /old_locus_tag="LILAB_02625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013935622.1"
                     /db_xref="GI:503701546"
                     /translation="MFDVARYLERIGVGPEPSLAGLHRAHLEAVPFENLDIHLKRPIR
                     LDTDAFFQKVVVQRRGGFCYELNGLFARLLTALGHRVTLLSAGVATDSGTPPFGPDFD
                     HLALQVEDGQGRWLADVGFGECFTEPLRLDTHDVQVRAGRAYRLSPEGDDLVLWSEKP
                     AGWKPEYRLSLVPRQLADFEGMCRYHQTSPDSIFTQRRLCTRATPDGRVTIKEGTLVL
                     TRGGARTEQPLADEAALRRALAEHCGVILPGPE"
     gene            626256..629918
                     /locus_tag="LILAB_RS02570"
                     /old_locus_tag="LILAB_02630"
     CDS             626256..629918
                     /locus_tag="LILAB_RS02570"
                     /old_locus_tag="LILAB_02630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935623.1"
                     /db_xref="GI:503701547"
                     /translation="MSRFTLLAAVFVLTCPLWAQAKPAADGIARAHAAEAMKQASSPR
                     SAASLLRMHALVDEVEDLTPLLSTYAYVASRRSSDPNARATAQMLLLDTERARGRLVR
                     ANEVKQWLGYVGDYYVTGGFENEGKAGCDTDFGPEAAHLDLSATYPAAKGGNATWRKL
                     TANTADGYIDLATAIRPNREAVAYAVTWLEAPQESRVSLGVGTSGAFRLWVNGQLAAK
                     EDRYNLPRPDQSRVSVRLRKGLNRVLVKVCQEAGPLGFYLRQESPTVRATLPAKAPAL
                     ERGAAPQPQPLPTLTSALRALVEKHPDDAALRGDYARVLNFFRAYDAREHTASAEAAL
                     AAERAPKDASLQLLAAQTQRDDMNERRRFLEAALAADPAMPEARVALAEHELDGGHPE
                     RVQPLVAPVLEKRPDDVNARLVLARAHEALGERPRAHALVEETFRLQPRAPRAVRAAA
                     QVSRHLDRSREAMDRMRVVLALRFDDTSTRHMLATMLAEAGQVDSAQREYAQLVKLNP
                     FDNGSRVRLAELKASNGAVEEAVALFAEARELSPDEPEVYEREGRALLAAGRREPALA
                     SFERSLVLRPQNPGLKEALRALKGESTATGMQYLVDAQPLAKEAEAYVHEDALYLVDN
                     TYVRVQQSGLSSRLHQRVVKVYNARGVDAFRTVPVTYSPDRQEVRVLRARVIKADGSV
                     VESYGENDRNINEPWTGMYYDARAKILSFPSLAAGDTLELTYRLDDTAQDNLLSDYWG
                     DVESVQGVYPKVRFQYLVDMPQARPLYWNKRKLTGLESAQESLDGGRVLYRWNAKHVA
                     KVVPEPGMPGWAEVAQNLHVSTYQTWDQVGRYWWGLVRDQLQPNAELRQTVDQVLQGV
                     DRKNELAVVRAIYNFVVTNTRYVALEFGIHGFKPYRVDRVLARRFGDCKDKASLIHAM
                     LQVAGVESRLVLLRMRNLGSIGEEVASLAAFNHAIAYVPKFDLYLDGTAEFHGANELP
                     SADRVANVLVVEPTGKSTFLTTPEAKAADNATRMSLDVTLRADGGAEITGASTVGGQH
                     APDYRRAYRPEATRKSTFERAWAQSFPGLTVHEVKLSDTTRLDDNVALDFRMSIPRYS
                     EVLPGGMRFLPFGTGRTYQQAYASLAQRRFDLVMSSPWTNGFLLRYTLPAGWTVAELP
                     QAVEETTKFGHIKLSYRLEGGKLVAEGEVALTTARVSADDYPAFREFLGRVDRAFGRR
                     VLIQNAENRTASSTTP"
     gene            complement(629978..632146)
                     /locus_tag="LILAB_RS02575"
                     /old_locus_tag="LILAB_02635"
     CDS             complement(629978..632146)
                     /locus_tag="LILAB_RS02575"
                     /old_locus_tag="LILAB_02635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_043709118.1"
                     /db_xref="GI:760025985"
                     /translation="MSRLLLVSNRLPVTVKVEKDTVSVVRSAGGLATGLRRPHERSGG
                     LWLGWPGDVSRLTENQRARVDAQLAEQRCVPLTLSASEVSRYYEGYSNRVLWPLCHYM
                     LDRIPRQDRDWEVYRKVNERFADLVAKHYQPGDTIWVHDYQLMLVPGMLRQRLPGARI
                     GYFHHIPFPSSEIFSTLPRRHELLKGLLGADLIGFHTVSYVRHFSGALLRHLGLDTDI
                     DRVIWEGRDVRVGAFPMGIDAQSFESLASEPGMLDEVANLRRSAEGQRILLGIDRLDY
                     TKGIPRRLLAVQRVLERTPAWRGRLRFIQVAVPSRTSVEAYANYRELVDELVGRINGT
                     YGTVHNVPVHYLYRSFNERQLVGLYRGADVMLVTPVRDGMNLVAKEFCAARPDDDGVL
                     VLSEFAGAAAELGGALVVNPYDVDAMADAIEKALGMAEEERQTRMRSMRKQVKSRDVH
                     WWTSSFLERLQALPPVSVRAEAGAAEALAEMKQSERLQLLLDYDGTLVGYAPRPELAA
                     PDAGLKELLEKLVARPGISVSIVSGRPKETLEEWLGDLPMGLYAEHGLWSRPAQGEPW
                     RMLDGVTFDWKERVRPELEAFSARVPGSFVEEKTASLAWHYRLVDAEFGALQSRELRL
                     YLAEKFAGQSMDILPGDKVVEIRPQGVHKGRVVGEATKGAAPGTRVVAVGDDRTDEDL
                     FASIPPGGLTIHAGNKPSRAAFRVKGPAEVRALLAGLLEP"
     gene            complement(632161..633312)
                     /locus_tag="LILAB_RS02580"
                     /old_locus_tag="LILAB_02640"
     CDS             complement(632161..633312)
                     /locus_tag="LILAB_RS02580"
                     /old_locus_tag="LILAB_02640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935625.1"
                     /db_xref="GI:503701549"
                     /translation="MPRLLAPSQRWLFSPGVDLSVFAGSALVSVAFVLAAPWLGVAGD
                     TPLWAWLLFVVCVDVAHVWSTLFRTYLDPEELRTRPGLYLGAPLAAYVAGVLAYLVSP
                     GTFWSLFAYVALSHFVRQQYGWVALYDRKARVSPLERRLDAAAVYAATLGPVVWWHAN
                     LPRAFWWFMPGDFLAGLPSWAGTVGLGLHAVVLIAWAGCQAARVVRGEGVQAGKVLLV
                     VATWVAWFGGIVVARDDFTFTVMNVVLHGVPYFALLFRYARGRLAEGGYGAGAALLRA
                     GLPGFLLFLVALALAEEFLWDQAVWREHGALFGEGLVTLPPDVLALVVPLLALPQATH
                     YVLDAFVWKPGRQPALLSRLGWAPMATGHPGPSSGMPPVSTMAIPARSD"
     gene            633393..634652
                     /locus_tag="LILAB_RS02585"
                     /old_locus_tag="LILAB_02645"
     CDS             633393..634652
                     /locus_tag="LILAB_RS02585"
                     /old_locus_tag="LILAB_02645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_043712326.1"
                     /db_xref="GI:760029276"
                     /translation="MHAAPPEALTHGDKVGVGLAAEVPLPPPRFRRRLLAVMLLAGWV
                     PLVLLGVVAQAALERVLSVSIAPVEGVLDEVAAELARRELPRDSLNEARLNLAQAELA
                     RRALVRRVPAFITALVLISGAALSVAAVLLGRALTRPVRTLTEGMWAYARGDLSVRLS
                     APDAPRDELQFLLGQFNRMGQELLSQRERLKSAEQIAAWQDVARALAHELKNPLTAMK
                     LSLARLSRTDVPTPHDSTRITEAVALLQEEVDLLMRMTQSFSTFARLPAPRFQDVPLR
                     PLLAEVCTLYAGTSPVPVELRPGEEATLRADPDGLRRLFGNLVKNATEASAASAAPVH
                     VTLESPQPGTVRVTVADGGSGVPTVLEGAALTRGLFSTKPGGSGLGLPISQKIVHEHG
                     GSLRLEPAPGGGTLARVELPLTPPASA"
     gene            634649..636001
                     /locus_tag="LILAB_RS02590"
                     /old_locus_tag="LILAB_02650"
     CDS             634649..636001
                     /locus_tag="LILAB_RS02590"
                     /old_locus_tag="LILAB_02650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_013935627.1"
                     /db_xref="GI:503701551"
                     /translation="MKPGPRILVVDDDSGVLKALRGLLSDEGFTPVEARSTAEATRAL
                     DAPEGPPAMMLLDLRMPGETGLELLARLPRPFATPVVVLSGEASPAEAVQALRLGATD
                     FVEKPPSPERLLTAIRNALALGALQEERERLLDALARPGHLVGDSPSMAALRQLIARV
                     GPSDTAILITGETGTGKERVARALHLASGRKGRLVAVNCAAIPSTLLESELFGHEKGA
                     FSGALSRRAGRIEQAHGGTLFLDELGDMPLELQAKLLRVLETKEVERLGGTLPVPVDA
                     RVVAATHQDLARAVKEGRFRQDLYFRLNVMPLQVPPLRERPEDLLPLARAFAAEFAGP
                     QASLVLAPGAEAALRAYPWPGNVRELRNLIERLNLLRGEGPLTLGPELVSAPRAAAVA
                     ARPSLGQKSYREHVEDFERELIRAALQEGESIAGAARLLQVDRGNLYRRIKALGLPVT
                     "
     gene            636107..637579
                     /locus_tag="LILAB_RS02595"
                     /old_locus_tag="LILAB_02655"
     CDS             636107..637579
                     /locus_tag="LILAB_RS02595"
                     /old_locus_tag="LILAB_02655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018652252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935628.1"
                     /db_xref="GI:503701552"
                     /translation="MSNRIGRSTFVPPTPTPAATAQERERAGRATAQGTPAAKAQVDQ
                     FETRGGARKASLLTGTSAQAARVEPPPSKAADLQPRVHAATGYAAHFGANGQRGGTAF
                     VEGQGSVALPPGSGRGPSFHAEAGKPLTVTLDPSRVMKSTEKLELVWRMVPGGTETAI
                     PLSDGTRDPATGKLNTIPATFELPQDAFGLVRMSIRSTDASGRVSNQWDPSYDAAVAP
                     PEAATVVFSDDWKTTVEGSLRAGDTLKLAYDKDRLAELIGKTPSDVVASVSFNGEPPI
                     DVPLTVTPDAEGKPGAMFMPSLKIPLEATQMSLWFKGQGEGATGWDSSFGKNFQFDIG
                     TARDDADPGWKAEMLRSKSFPNLTEEKFVGIGPSTQRYNCIAWTLGVRDEWVWPGTKV
                     EDFDKLYADQGFKPLDTVDLSHDPDLEKVVIYGLEPRSGTGPLEVTHGALMDEQGRFT
                     SKIGTQPLIRHNSADDLSGPSYGEPVRVYVRPRQPPVNAS"
     gene            637576..637896
                     /locus_tag="LILAB_RS02600"
                     /old_locus_tag="LILAB_02660"
     CDS             637576..637896
                     /locus_tag="LILAB_RS02600"
                     /old_locus_tag="LILAB_02660"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935629.1"
                     /db_xref="GI:503701553"
                     /translation="MSDVAARFDRLAQEWEAHCAAHREASNPFVFLNHPSFESLVALG
                     RPAVPFVIERYREGSLFWGAVLRRITGIDTYGDGVVGKLDATRRGWLDWWTQHEAEFT
                     RGEA"
     gene            complement(637910..638119)
                     /locus_tag="LILAB_RS02605"
                     /old_locus_tag="LILAB_02665"
     CDS             complement(637910..638119)
                     /locus_tag="LILAB_RS02605"
                     /old_locus_tag="LILAB_02665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712328.1"
                     /db_xref="GI:760029278"
                     /translation="MAWLAVGLILVYRRAVPAAWKRQCIYTPTCSRYGLRAIQKYGLF
                     RGALRTWGRIRRCNGVLYLGGQDAP"
     gene            639400..642108
                     /locus_tag="LILAB_RS02610"
                     /old_locus_tag="LILAB_02670"
     CDS             639400..642108
                     /locus_tag="LILAB_RS02610"
                     /old_locus_tag="LILAB_02670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935631.1"
                     /db_xref="GI:503701555"
                     /translation="MTPDDTRGTQTQGRREDGSVTPDDTRGTQTQGRREDGSVTPDDT
                     RGTQTQGRREDGSVTPDDTRGTQTQGRREDGSVTPDDTRGTQTQGRREDGSVTPDDAR
                     SAQPQGRREDGSVTPDGTPGTQTQGRREDGSVTPDDARSAQPQGRREDAAATAAPTRA
                     EPHKAQRSACPDDFEDAEEEGPDDSGVLSPLQLTVDGRLLTPGRIELHGLRWLTEAQV
                     RTYIGAPPSDSQALLSGGEVHQLLRRLARSGLFARVEPRVRVAEAPHPAVLEVHLEEN
                     PVVTAVEVEGLQDLQSSEILDELLRLPHRFPTEDEDDESFTATLRVDSRRGTLSIVRP
                     CPPRYPPRDWVARLERDTLRPGILLGGVAHGLERTLKRLRDDGYMLASLSAVWSPDGK
                     LVVTVDEGRLEAVEVRGVDADIAARVQDALDLKPGTVFLRSDARRAVQRLESRLPFLE
                     PADVDDDEATRPPRARIIETREPDGTRAYHTQELPREKPRHRERVEFEVNWKQFADWW
                     DDVSASESITLEGKKLVVHLRPRRPDFDVDLLPMHTQVTGFSPGLAGRLRLWDAKDRA
                     HATVDAALTIPLRWGGQSLPDDPEGTQRQRRVNMLGGAKLQVPKVGLAELGAQVYDFT
                     DTLDRWRMGDIDSSLYSALINRPDREYFRRKGLTAFATWRWAEDFLAGVEYRTDRYES
                     MRSFTPPFSLFRNDSAPFTNSPVTEGRFDSVVVRMEYASNVPAAASVGSLFRTPETSL
                     FDREGDWEHRASLRGLLTLEVGTGPGSEGADTRFWKLVSDIALEVPTGWDSGVSLRVR
                     SAGGSRLPEQKREALGGWTALRGYGFKEYRGDVSVLTTAEYRWSALGVFADLGTVRTD
                     AAWTDARLGLGASLLLGDSVRFDVAWRTDERATATPEARLLFQRTF"
     gene            642114..642722
                     /locus_tag="LILAB_RS02615"
                     /old_locus_tag="LILAB_02675"
     CDS             642114..642722
                     /locus_tag="LILAB_RS02615"
                     /old_locus_tag="LILAB_02675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935632.1"
                     /db_xref="GI:503701556"
                     /translation="MDWPLTRVGRRLGTALVAVAGLYAPTVPAEEPRTTCTATLSGRR
                     VMVRSEAFDFVSPELDRLVRLGMAGKLEVELTLWRRNTVWFDARVEMARVTQVLAFSN
                     GAYVLDGRPLPEGPSALPLERVAWSLEKRPEPGARYQVRINVRLHVVTAASLGRVAAW
                     LTQGKQAPDEEGATLTGSVLLRSVAEDLVRGADARCDVTRPP"
     gene            complement(642743..645100)
                     /locus_tag="LILAB_RS02620"
                     /old_locus_tag="LILAB_02680"
     CDS             complement(642743..645100)
                     /locus_tag="LILAB_RS02620"
                     /old_locus_tag="LILAB_02680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_013935633.1"
                     /db_xref="GI:503701557"
                     /translation="MSLKEYPPGTSFPGVIGRTDEESSPAWPAPLRAKPGAPNVLFIV
                     LDDTGFGQLGCYGSPIRTPNLDRLAKGGLLYNNMHTTALCSPTRSCILTGRNHHSNGM
                     AAITEISVGYPGRNGSIPFENGFLSEMLAGHGYSTYCVGKWHLTPAEQTSAAGPYSRW
                     PLGRGFERYYGFLGGDTHQYYPDLVHDNHQVRPPKTPEEGYHLTEDLVDRAIGFIADA
                     KQVAPDKPFFLYFCTGAMHAPHHVPREWADRYKGQFDDGWDAYREKVFQRQLATGVVP
                     PGTQLSRHDPDVQAWAGLSPEERRLYARMMEVFAGFLEHTDHHIGRLIQSLEDSGELE
                     NTLIMVISDNGASPEGGLHGSVNELKFFNNTPESLEQNLAAMDELGGPRHFNHYPWGW
                     AWAGNTPFKRWKRETYRGGTTDPFIVHWPRGIQARGEVRSQYCHAIDMVPTVLECLGL
                     DAPTEIRGVAQSPIEGVSFRYTFHDADAESRHHTQYFEMFSHRALYHDGWRAVCPFPG
                     PSFSESHEGFGTLKLTEAKLRALDTEGWELYHVAEDCSETRNVAARERDKLIELIARW
                     YVEAGRYNVLPLITPSRELFAVERPQISRERERYVYRPHTSPAPENVAVHVLNRAHAI
                     TAQVEVEDGVEGVLLCHGGLTGGYSLFIKDRKLHYVYNFVGEKEFHLESAVDVPKGHA
                     ELRFEFQPTGAPDVPAGKGAPGRGRLFINGDLVAQRDISETMPLVISLGEGLTCGRDE
                     NSPVSQQYQPPFAFKGGTLTEVVVDVSGEHVHDPVTETNTVMARQ"
     gene            complement(645211..646854)
                     /locus_tag="LILAB_RS02625"
                     /old_locus_tag="LILAB_02685"
     CDS             complement(645211..646854)
                     /locus_tag="LILAB_RS02625"
                     /old_locus_tag="LILAB_02685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal"
                     /protein_id="WP_043709121.1"
                     /db_xref="GI:760025988"
                     /translation="MAAVELTRRELVAAFLGSAVAASACRKARPRARVPGAVVDKAVE
                     VGHQLRGGPLPRADLVEPVEVLVVGGGVAGLSAAWRLAGAGVKGVRVLELEAEPGGTS
                     RSGRNAVTAYPWGAHYLPAPLEDRGPVVRLLRELGAVAGVDDAGRPHYEESLLIHEPE
                     ERFFYRGHWYEGLYLHAGASAEDLQELRRFEARMNGFAAARDAKGRRAFAVPSGLSSD
                     DAEWTALDTLSMAAWLAREGFRSPRLKWVVDYACRDDFGTTAEHVSAWAGIWYFTARQ
                     DGNGERSEGYLSWPEGNGRLVRHLVSALPHGAVERNVLVHTVAPVEGGCRVDALEAGT
                     GRPRAFLAKQVVLACPRFIAAHVVAPWRRERPAWLGSFTYGPWVVANLTLSSPPRSRG
                     FPLAWDNVFYESRSLGYVVATHQTLRQDEQGPTVLTWYLPMDGADVKAEREKALSASY
                     ADWEALVMADMLPAHPGIAEQARRLEVQRWGHAMVRPSPGFMWGAAKQAAAESLGRSL
                     HFAHSDLGGMGLFEEANWFGVRAAERVLAELGRREASWL"
     gene            complement(646836..648332)
                     /locus_tag="LILAB_RS02630"
                     /old_locus_tag="LILAB_02690"
     CDS             complement(646836..648332)
                     /locus_tag="LILAB_RS02630"
                     /old_locus_tag="LILAB_02690"
                     /EC_number="2.5.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935635.1"
                     /note="catalyzes the formation of spermidine from
                     putrescine and S-adenosylmethioninamine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="WP_013935635.1"
                     /db_xref="GI:503701559"
                     /translation="MNKTLLYISVIVIATCGLIYELVVGALASYLLGDSITQFSTVIG
                     GYLFAMGIGSYLSRYIERGVAQRFVEVELAVALLGGICAPMLFLTFTLTSLFQVALYG
                     SVIAIGALVGMEIPLLLRILKDQLKFKDLVSQVLSLDYVGALAASLAFPLLLVPKLGL
                     VRTSLLFGVLNAGVALWSTWLLAPLLGNPLRLRVKAVGLTVLLLVGFVMGDRLTTFYE
                     DQLYADDVVHASSSPYQRIILTRGKRGFSLFLNGNLQFASLDEYRYHESLVHPAMVRA
                     GKVENVLILGGGDGLAAREVLRYPEVRSVTLVDLDPAITGLATNFEELVKLNRHALTD
                     PRVRVVNGDAMQFLTESTARYDVVVVDFPDPNNFALGKLYTTGFYKLLKKRIAPEGVA
                     VVQSTSPLFARRSFWCVETTLRAAGFWTEPYHALVPSFGEWGYVLIAHEAPGRQRPLP
                     EGLLFLDDATMASLTQFPPDMGPLPAEVNRLNNQVLVHYYEAEWQRWN"
     gene            complement(648353..648580)
                     /locus_tag="LILAB_RS02635"
                     /old_locus_tag="LILAB_02695"
     CDS             complement(648353..648580)
                     /locus_tag="LILAB_RS02635"
                     /old_locus_tag="LILAB_02695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002635242.1"
                     /db_xref="GI:488711363"
                     /translation="MLLLGVVVSVQGVLASIIYSLIGLAVFVAGFYVIRLIMPFDVHK
                     ELEADQNTAVGIVIGSFIIGLAIIVAAAISG"
     gene            complement(648768..650669)
                     /locus_tag="LILAB_RS02640"
                     /old_locus_tag="LILAB_02705"
     CDS             complement(648768..650669)
                     /locus_tag="LILAB_RS02640"
                     /old_locus_tag="LILAB_02705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709124.1"
                     /db_xref="GI:760025991"
                     /translation="MTQGKCPSCGAMVEFTAGSAQVVVCAYCQTVVARKGLDFESHGK
                     IGGIVPTDSPLQLRAEGRYQKVAYTIVGHLQKDHGAGPWDEWYVEFADGRTGWLSESE
                     GVFHLMFDMGVEEGVALEDLHPGERLHLRERAWIIEERGHGRVVAAEGQLPSDVDPTQ
                     DAWYVDATGPKGAFLTLDFGTRGHSPEAFIGEALKLEQLGIPAGQLRPRVRKVALQQA
                     RCTQCNGNLELRAPDKSLRVACPYCGALLSVEKGGLSFLRLLEKPERPPTIPLGTKGK
                     LDGAEWICIGYLERSCTVYGVRYPWEEYLLYNASRGFTWLMDSNGHWVFLKPVPAGEV
                     SVAPGVAAFHEHRRYKCYQQVTAVTEKVLGEFYWKVHAGEWAHATEYVAPPYSVNVDA
                     TDDEVSYTLGEYLEPDVVKEAFGLKEPLPPREGIAPSQPNPNKAGLRSAFIWTGIWVL
                     ALFVLAGVLSATARNQVVLEQPVVVPPGTAPGTPAAMHFSEPFELPERGNMKVEVQAA
                     LDNDWLGIQGDLVNQDTSDVVSFYEELSYFRGRDIDGDWSEGSTSGSAYLSPLPAGRY
                     VLRTTAAFDVKPNRKMPMTYNVKLTHDAPDSGWFCFALVLLALGPVVAMYRSHSFETR
                     RWADSNVGE"
     gene            complement(650666..650974)
                     /locus_tag="LILAB_RS02645"
                     /old_locus_tag="LILAB_02710"
     CDS             complement(650666..650974)
                     /locus_tag="LILAB_RS02645"
                     /old_locus_tag="LILAB_02710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="WP_043709127.1"
                     /db_xref="GI:760025994"
                     /translation="MPGSLKDAAALAALFEALIVVLDLKVVGQPQWHVFPEPGGITGL
                     TLLAESHLGIHTFPEHGFAALNVYCCRERQRPDFEALLARHLGATSCVVRELKRGVTA
                     "
     gene            651147..652127
                     /locus_tag="LILAB_RS02650"
                     /old_locus_tag="LILAB_02715"
     CDS             651147..652127
                     /locus_tag="LILAB_RS02650"
                     /old_locus_tag="LILAB_02715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935640.1"
                     /db_xref="GI:503701564"
                     /translation="MTPPQLEPPLPQSTAPAPGAIHRLTRTLRGLPPAERWWGPGCAG
                     MAGWLKHAASSLPEEDLTPRFRALLARVRQGLPVLPEEAKRHQYVLVRGMLGDELPGY
                     LLDNVQRLERRGLDVREAAVDTEGLLADNVAVLREVLRDAEYFGRTVVMVGHSKGGVE
                     CTATLARYPELRHVVRAVVTLQAPYGGSAIAHDLATTPQLRRLIDFAFPLLFHGVSRS
                     VEELSYPQRRAFIARYPYPADIPTVSLATSRLSRVSTLYPLQRYLRERYGYLADGMVT
                     AVDAEVPGARVVRLDDMDHAEAALRGLPGLVRYHPGDVTEVMVALALETR"
     gene            complement(652131..653144)
                     /locus_tag="LILAB_RS02655"
                     /old_locus_tag="LILAB_02720"
     CDS             complement(652131..653144)
                     /locus_tag="LILAB_RS02655"
                     /old_locus_tag="LILAB_02720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_043712330.1"
                     /db_xref="GI:760029280"
                     /translation="MPAALQLDSTEPVELPKVEAPSLEGLSVAQLAPAPLTEEELVER
                     FDALRREHADVRERQPGEEVALEDDVLLDVLGFANNRLMPFSARENWWARVAADPVLP
                     GFFEALVGAKVGQSFGIELTLPDTYPVEALRGQQARFLLEVKAAKALKLLEDDAPELL
                     ARLGAGSITDVMRRLGDALAQERNAEVDRLTRERVMDVLVERTPVELPSSLVDEELRR
                     RWAEAERPILQRKDFQPDELQEALEGWLNDPLTRADAVYRLTLGLALRAIAERDGIQP
                     DRTATEAMLADLADFTGVSREALGVAVKEDAALARRLYEMALRSSTIDHVMKKVTLTP
                     PAA"
     gene            complement(653317..654276)
                     /locus_tag="LILAB_RS02660"
                     /old_locus_tag="LILAB_02725"
     CDS             complement(653317..654276)
                     /locus_tag="LILAB_RS02660"
                     /old_locus_tag="LILAB_02725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935642.1"
                     /db_xref="GI:503701566"
                     /translation="MAPPIRRNEPRPVPPPPVTARPTPPPPPPPPAPAKQEDRFEAAH
                     NVVGQFANGAKIASDSVAGTQVREGTGPRRFGNTALPGGNGSIVEGTNTRLSRGAGAV
                     GLAASVSQLPGAGYLAARDVRDAFRNPSGESINKAAGSVASLASTGLNVVKGGLEVAG
                     NVSNFRAATNAARTAFQAAAPEALRTGAGANRVVGAATDAALAGGSRNVVRGAAAAVA
                     EEGAERAARLAGNAARGALRNGGTAVARAAGRFAPGLNVAIAVADTAAAVSTIRDPNA
                     STGKKITSGITALGSIAAATNIPVVSQAGAVVSTVSSFVGSFF"
     gene            654463..655203
                     /locus_tag="LILAB_RS02665"
                     /old_locus_tag="LILAB_02730"
     CDS             654463..655203
                     /locus_tag="LILAB_RS02665"
                     /old_locus_tag="LILAB_02730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclophilin"
                     /protein_id="WP_013935643.1"
                     /db_xref="GI:503701567"
                     /translation="MRTQILTTVLLCLTLTACKDSDKKESMGGTPPPAAQAPAKPATP
                     PAQPQAAPPAEAASGEWTQKVQAGQDLYATLETNQGAVAVRLFSKDAPKTVANFVGLA
                     TGEKAWTDPKTGQRVEGKPLYDGVIFHRVIPGFMIQGGDPTGTGRGDPGYRFEDEFQS
                     GRTFNKPGLLAMANAGPGTNGSQFFITTSTPNYLNNRHTIFGEVVSGYDVVEKISNVP
                     RDGRDRPQEPVVIQKIVMSDQAPAGAGK"
     gene            655206..655940
                     /locus_tag="LILAB_RS02670"
                     /old_locus_tag="LILAB_02735"
     CDS             655206..655940
                     /locus_tag="LILAB_RS02670"
                     /old_locus_tag="LILAB_02735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_013935644.1"
                     /db_xref="GI:503701568"
                     /translation="MERALRHVATRLGELDCHIIDALPEGASPELAVVLSHGLGAPAT
                     DLVPVGPELMAFQPALADRVRFIFPGAPLEWGYGGRAWFPLPDAVMRGEQRDWEQFAR
                     DVPPGMPAARRALMSTVDALCAAMKLPYGRVVLGGFSQGGMVSTDVALRLDEPPAGLC
                     ILSGTLTSEPEWRARAQARTGLPVFQAHGRQDPLLPLANAERLRDVFVASGLTVDFHA
                     YDMPHALVTEELEALAAFLAARLGGR"
     gene            655945..656358
                     /locus_tag="LILAB_RS02675"
                     /old_locus_tag="LILAB_02740"
     CDS             655945..656358
                     /locus_tag="LILAB_RS02675"
                     /old_locus_tag="LILAB_02740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935645.1"
                     /db_xref="GI:503701569"
                     /translation="MFHAKELTVASRGRGFTDITADVQRAVAESGARQGLCTVFLHHT
                     SASLLLCENADPDVRGDLESFFSRLVKDGDPLFVHDAEGPDDMPAHVRTVLTQNALNI
                     PVKDGRADLGTWQGVYVWEHRTSPHRRRVTVSVVS"
     gene            complement(656362..658047)
                     /locus_tag="LILAB_RS02680"
                     /old_locus_tag="LILAB_02745"
     CDS             complement(656362..658047)
                     /locus_tag="LILAB_RS02680"
                     /old_locus_tag="LILAB_02745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="WP_043712332.1"
                     /db_xref="GI:760029282"
                     /translation="MAVSSPGPLPGASHSAALFEAWQRTAADAGTDGGVAGTAEAALA
                     PPPLPVPHDATAEDAAVARGEVPALSIDPALDDLAQPEEEEAAPDAEALPLPEQLTVI
                     PDELHPGEELVLGPDGEPLEDMGLVLEDVEPVAEPVGVEVDAGTDLAPHAIPFAPDAG
                     SLRVRRSIVVRQEPRRDAPPVGTVAQDMRVRWRGDTAIRGPDCEAWVQIEPRGWVCER
                     YLEPNFREPRVRELPKLREGELTPGIYARVVGKRVRAYPSLKLARARRRGVLLKGSVS
                     VQLRGQVRIRRKTYWRTTDGQYLEARVLREYRPSSFEGVDADAIAELPPTFAWAQSRT
                     RPTAHVEVRAAPDARAARETVLPPRTLVAVKALSDDGHWVSIAEDHWVARDDLHVAWF
                     SHAPPQVEPGARWLDVDLDAQVLVAYEGERPVYATLISSGKQGTDTPEGLFRIWIKFA
                     EADMTGSGTAGNETYRVATVPWTMFFQDDYALHTAYWHDRFGQPMSHGCVNLSPKDAR
                     ALYAWAAPQVPVGWSMVHATEDAPGSWVRIRGQARPTGKARKVAVAATRVGAP"
     gene            658506..660092
                     /locus_tag="LILAB_RS02685"
                     /old_locus_tag="LILAB_02750"
     CDS             658506..660092
                     /locus_tag="LILAB_RS02685"
                     /old_locus_tag="LILAB_02750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013935647.1"
                     /db_xref="GI:503701571"
                     /translation="MKLAETAPNPSPEALPAASLSLDEVRRVTQLLEAISVDRFLLAG
                     LPEEDRIAFLSAAGRVVHPDRDTKSRMAKALRRDKKKTKREHDRAIRNTTEIRTLRRS
                     PIFTVPALPAPPPTEAGPERVLEQPRRCYVCKAEYRKLHFFYDAMCIECADFNYAKRT
                     QRADLSGKVALITGARVKIGFQASLMLLRSGARVIATTRFPNDAAKRYLLEPDFADWS
                     HRLHIHGLDLRHAPSVELFAKYIEQTHDRLDILINNAAQTVRRPPGFYGHLLPGEMRR
                     ADDLPAAARALLAGHDACVATVQPTAALGPGSTTGGSELATTWRSSDPALGIHSSAAL
                     SMLPYALEQEGDVRALFPQGRLDADMQQVDLREVNSWRLRLAEVQTAEMLEVHLINAV
                     APFILCGKLKPLMLRDRSSPGHVVNVSAMEGSFSRGTKTDKHPHTNMAKAALNMMTLT
                     AAPDYARDNIYMNAVDTGWVTDEDPAQHAERKVQELDFQPPLDIVDGAARVVDPVMAM
                     ENSGDYVWGNFFKDYRHTAW"
     gene            660178..660603
                     /locus_tag="LILAB_RS02690"
                     /old_locus_tag="LILAB_02755"
     CDS             660178..660603
                     /locus_tag="LILAB_RS02690"
                     /old_locus_tag="LILAB_02755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712334.1"
                     /db_xref="GI:760029284"
                     /translation="MTSMKGISTEMHPYLRMTAPPGVTGIADLAFEPGMPLFRGRLLL
                     GGVLPVGWTDLTLRELEPGRRFVEESPMSAMRQWRHERRIVEAHAGVDIIDQLDFEPR
                     FGGWLTEAFVRRLFEHRHSVLRRALTPSLGGRASREKPA"
     gene            660610..660936
                     /locus_tag="LILAB_RS02695"
                     /old_locus_tag="LILAB_02760"
     CDS             660610..660936
                     /locus_tag="LILAB_RS02695"
                     /old_locus_tag="LILAB_02760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935649.1"
                     /db_xref="GI:503701573"
                     /translation="MSPEEQFHVEVLKLLLQVATVDGRVAHSEIEHILDTARGMSVPL
                     PELAALTRCLQNNAPLPPPNMGILRTNPAAVVREAKALIASDGSVHAAEIELLRQIRE
                     LLGIVS"
     gene            complement(660952..662298)
                     /locus_tag="LILAB_RS02700"
                     /old_locus_tag="LILAB_02765"
     CDS             complement(660952..662298)
                     /locus_tag="LILAB_RS02700"
                     /old_locus_tag="LILAB_02765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935650.1"
                     /note="DNA-binding response regulator in two-component
                     regulatory system with ZraS; response regulator/sigma54
                     interaction protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013935650.1"
                     /db_xref="GI:503701574"
                     /translation="MSSARILVVDDDPQARDLLQRLLGPLGAVTQAPDPRRATERIAE
                     GAFDLVLTDMAMPEPGDGLKVLHEVKAQLPDTPVVVVTAFGNIEGALDSIQQGAFDYL
                     AKPFDVDAILRVARRALEQKRLVEENRSLRQQVERGSLMLVGRSPALLEVYKQVARAA
                     ASNVPVLITGETGTGKEMVARALHKRSPRMNGPFIPVDCGAITESLMESELFGHAKGS
                     FTGASGTRRGVFEEASGGTLFLDEIGDVGMKVQSQLLRVLQEGEIRRVGESIPVKVDV
                     RVVAATNKDLKARVAEGLFREDLLYRLDVVHLHLPPLRERSEDIPALVEHFAGRHARG
                     GVRPVVTPEANARLAAYDWPGNVRQLENVVARALALNVTGVLGPQDFPEPIGDASTTK
                     MAGLAGDMPSLAELSRRYAAQVLQHVGGNKSEAARLLDVDRKTLYKLLEAAPEGES"
     gene            complement(662295..663725)
                     /locus_tag="LILAB_RS02705"
                     /old_locus_tag="LILAB_02770"
     CDS             complement(662295..663725)
                     /locus_tag="LILAB_RS02705"
                     /old_locus_tag="LILAB_02770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935651.1"
                     /db_xref="GI:503701575"
                     /translation="MASSRISIRGYRTGFFFVVVLLSAVTAFTLWTEVRTGRQVDVLV
                     QEALERAGSIGRIRVDALSLESAIEAHIRATGDAERRAADAVMEQILADIRASSESYT
                     RNLPQGEKALWYRFNAACQGLADQVRAAAVFSQRREAERARRHLAERIRPLAAELDAL
                     GGALEEENAAEARRLVNRFEDLRVRNTALGAGATLLAILLSSLVGWRVTSLLKRQEAI
                     IQGQLEELGRHNQELDAFTRRVAHDLISPLAPLKGYLTLIRRTGAVNDAGALEMLAQC
                     ESSAVRMGELIEALLRFCRAGTRGERTVGELDTAVTTVLLEVAQTAAAQGVALERELA
                     PGVAVDCPGQLLQVSARNLLTNAVKYSAGRPDARVKVRVATEGNLAVLEVVDNGIGMA
                     PGAQASLFQPFFRAPEVRNLPGHGLGLVTTKRVVEAHGGTLVVRSEEGKGTRVVVRFP
                     RVVRPAAGTGGAQTTPAAAGMRKVGT"
     gene            complement(663772..664239)
                     /locus_tag="LILAB_RS02710"
                     /old_locus_tag="LILAB_02775"
     CDS             complement(663772..664239)
                     /locus_tag="LILAB_RS02710"
                     /old_locus_tag="LILAB_02775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935652.1"
                     /db_xref="GI:503701576"
                     /translation="MRFLCFATALAVLGAGCATGVPLERLEAQVLEADRWRREYEAER
                     ERSEAFALRLAQLESALERLRLERAEAEQARAALLEELVRTEADRHALEEHNTQLLAL
                     EREVNELKELKEMHEELSDVWYESALERARRRLNNPPQPAVPPAAGNVAPTAP"
     gene            664538..664780
                     /locus_tag="LILAB_RS02715"
                     /old_locus_tag="LILAB_02780"
     CDS             664538..664780
                     /locus_tag="LILAB_RS02715"
                     /old_locus_tag="LILAB_02780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935653.1"
                     /db_xref="GI:503701577"
                     /translation="MKTVFAAAFLAAATAFANTPAPAAEPAAEARPAAVEAAPEAAEA
                     PAAEEAKAEAAPEAKPAKKAKKPAKKAAKTTATGAQ"
     gene            665067..665660
                     /locus_tag="LILAB_RS02720"
                     /old_locus_tag="LILAB_02785"
     CDS             665067..665660
                     /locus_tag="LILAB_RS02720"
                     /old_locus_tag="LILAB_02785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_013935654.1"
                     /db_xref="GI:503701578"
                     /translation="MIEAFTKVSEASKLLLEKGLCPSTGVETLRMVGHALGVDRAYIL
                     ENRVQGTYGRFITDMRHAWAEAPTPSPLANPVMRAFSFREFAPGWVDMLEAGMVVACP
                     TRDAPPMMKDLLERQGTQSILLCPINPSRQQWWGMVAFEDCHRPRAWKPEEVTLLKSL
                     ARAVAASVRHGQMRSSLDQVRNSLRQAVSSRTPVSGL"
     gene            665776..667605
                     /locus_tag="LILAB_RS02725"
                     /old_locus_tag="LILAB_02790"
     CDS             665776..667605
                     /locus_tag="LILAB_RS02725"
                     /old_locus_tag="LILAB_02790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013935655.1"
                     /db_xref="GI:503701579"
                     /translation="MSSIDPTAISRPRSPDIISGYHIDKLVGSGGMGEVHKATQLSLG
                     RTVAVKLLNPELAKDPSFIARFQKEAAALAALSHPHIVSIVDKGKTDTTYYLVMEFVD
                     GPSLRELIREPQLDVMGALRRMLQICRAIEYAHGRGVIHRDLKPENILLDQQAGGIAK
                     VSDFGLASFLDDASPSSRYALTSTHVSMGTLSYMAPEQRVDAKSADARADIFSLGVIL
                     YEWLTGEVPLGTFDPPSRRKPGLDPRLDAIVTRCLKPDPEDRYPSVTTLIADLELLVP
                     GSLPSLAPVKLTHIQRLRQGVRKVVRVALQAAAVLLVLAALAVLGREWLRSGEKPVAP
                     QPGAALNADLGPPSPRSMPGRLETGSEKRTVSVGDGPDAPSLLVAGRPVEAEDKAIIF
                     PPVEERSQSRVGRARLDVVGLDGDIAVLKALVRADPPPDTWKRRAYVMLYGPALQAPA
                     AALLLQGSTGRYVALIHDGAGAPLRLEWALGERRGTMLGLASPEGEAALELRVDADGV
                     MQGYVGKGKDQRAIGEPLNLGPGWMEHFGDAPVPAFGCIEGTCRAEGLVYTVRRAPPE
                     PEPAAKAVVAAVPAKAVPARRPPPPPPKRQPAKGSSKGPTRRR"
     gene            667691..671485
                     /locus_tag="LILAB_RS02730"
                     /old_locus_tag="LILAB_02795"
     CDS             667691..671485
                     /locus_tag="LILAB_RS02730"
                     /old_locus_tag="LILAB_02795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935656.1"
                     /db_xref="GI:503701580"
                     /translation="MRTIRIGFAALALVTALAGCHRSTSTATPRVLETAAEQAQKGTP
                     QARTLAFAGFHALLVAGDATLAQQRFDDALARDAGDVYALAGQSLMARRAGRPDRALA
                     ASLELAARAPTHPLAAVAARHVLDSVGTSRALDDDILRGVERALAAGATGEAAYLLRG
                     ARMSVAVVRGDAEARDAAMHQLGGVSESSLVGPFSPFHVLAWDERTPVSQEGSLAGPF
                     TSAFGPLPVRTVHAPDGRMDLTGEPGQGDLYVQAFDADVTEPGLYVARTVSGTSHQVL
                     MNGAPLLERRAWERATSTVTTRAVQLPAGKHRFVVRQLKGGTSGLLTFALLRVDGRPS
                     GVRFSAATGPAPRPWGGKAELSDETPGVFATTESVKLALHEEAGELLAVVLAVRDGLQ
                     RDSDGARRLMATVDANTPALLWLRAEVAAADRTVPSKVARGRATRDLESVLAKDPDNV
                     AAMLLRADLFLDEGQPAPAMELLKTASEVARPAGHPVFMLRARAALALEVEALAEESL
                     AAALEAQPGLCEALTLQYSLARRRDAAERSDTLVASLAGCPGTVMRQAEHARARGDVE
                     TATKLYAEMQARDPSSISLGTTLANLYVSKRRFDDATEVLQKLATVWPRNAELVKRMA
                     DVREYAGQPAEALELRERALALAGDDLTLRRAVERAKTGQELLQAHAVDGREAIRAYE
                     AEPVSGGSAAAFVLDAAAVRVYPDGSIVNRIHTVQKALEQSGVQEIAEVNVPRGAQVL
                     ALRTLKADGRVLEPENIEGKDTVSLPGVAVGDYVEVEYLLAEPPRGPAQPGFTASAFY
                     FQIANQPNAWVTYTVVAPRGVGMKVDAHGMKVPEPKVDGDVEVFHFETRRVPPFIPEP
                     DAPPSANEYLPFVIVGAGDTGNENLVKLYGDAFQDRWIRTAEVDAFARKAAEGKSGLD
                     AVKALHAAVMQRFSGRDASLSQTAASTVAQDRGSRLTVMKAGLDALGIPSRVVAVRTF
                     NTDPAPYTFPQDALLPYAALRVELPGEAPVWVDTSVRYGPFGELPELAMGGREAWLLP
                     EPGRPLQKVQTPPMKEVPGKEVKLALKLSEDGTLSGQGEETYSGFEAAQIAEAFNQLS
                     AESRNQALQGAVARYFGGASLSSVKLEHQEQVGAPFVLRYEFTVPRFGRLEGGQRMAL
                     GPLTFPAQLGRRFVQLSTRRTPLYIDTTEASRTQVTLTMPKGWKLADPQASLQAENAF
                     GRFTRTEKQDGATLSVTESLRLPRNRVQPNQYELFSGFTGDVDLIQTRELVLVKPSPG
                     GE"
     gene            671587..672534
                     /locus_tag="LILAB_RS02735"
                     /old_locus_tag="LILAB_02800"
     CDS             671587..672534
                     /locus_tag="LILAB_RS02735"
                     /old_locus_tag="LILAB_02800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709131.1"
                     /db_xref="GI:760025998"
                     /translation="MTPRWWACLVTLLAAPMVHAQTAPVPASEPGYSEYAYDDTEFQD
                     EDTAPVAPYAPPQLPTENPSARPFAGAVWASGHWYWDGNEWRFNAGTWLAPMDGYRFI
                     NGYWEPDGRMWRWVSGGWARHDSAMVEIPIAVTSEELSTQQAPPPLRVEHAPPPPAPS
                     YVWTPGYWYWAGANYVWVDGMWAAPPRPGLVYVSSRWVRRGPSWFFSAGGWATRGSVR
                     ITVPVYRHAHVTVARRHPHYFMHSWRRYPAVRHHVYHYGSGYRRGPSPVRHHYRGNDN
                     RWGGRGNYHRASPGRHGGRHGASPGGHRRGDGGRRGGRD"
     gene            complement(672631..673758)
                     /locus_tag="LILAB_RS02740"
                     /old_locus_tag="LILAB_02805"
     CDS             complement(672631..673758)
                     /locus_tag="LILAB_RS02740"
                     /old_locus_tag="LILAB_02805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginase"
                     /protein_id="WP_013935658.1"
                     /db_xref="GI:503701582"
                     /translation="MSAAPVPLRRALVVGAVMLLSPMGCASSGVARTGSGQPTAPDAP
                     APAPAPAPKWGLVIHGGAGVISRENLSPEREAEVRAALTQSLQAGHAVLASGGSALDA
                     VSAAVRILEDSPYFNAGKGAVFTHDGVNELDAAIMDGKTRQAGAVAGVRHVKNPSSLA
                     RLVMEQSPHVMMVGEGAEAFAKSQGVELVDPKYFYTEDRWQGLQRALEKERARQQPSS
                     SIPAGYDPVSGDHKFGTVGAVALDKTGALAAATSTGGMTNKRHGRVGDSPIIGAGTYA
                     DARCAVSATGHGEFFIRYAVAHDICARVEYQGVPLRQAADAVINDVLVKVGGEGGIIA
                     MDREGNVAMPFNSAGMYRGTIGEDGEPVVAIFRDAADAAVK"
     gene            673949..674620
                     /locus_tag="LILAB_RS02745"
                     /old_locus_tag="LILAB_02810"
     CDS             673949..674620
                     /locus_tag="LILAB_RS02745"
                     /old_locus_tag="LILAB_02810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_013935659.1"
                     /db_xref="GI:503701583"
                     /translation="MKKLRGLRVAVLAADGFEQVELTAPVKKLERQGAEVTIVSPHKG
                     RIRGMNLLVPGKKVSVDASLREVKAADFDAVFIPGGFVNPDLLRQSALALDFVRDADA
                     LDLPMAVICHGPWVLISAGLVEGRAVASWPGIRDDVRNAGGRWVDEPVMRDGNWVSSP
                     GPRQMFAFIKGMVELFAEKMPEVSARAPLVPVRHEAPALWPRLLAGTLATAALGLGAR
                     RLALR"
     gene            complement(674672..675214)
                     /locus_tag="LILAB_RS02750"
                     /old_locus_tag="LILAB_02815"
     CDS             complement(674672..675214)
                     /locus_tag="LILAB_RS02750"
                     /old_locus_tag="LILAB_02815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeS assembly SUF system protein SufT"
                     /protein_id="WP_043712335.1"
                     /db_xref="GI:760029285"
                     /translation="MRGMMAVLERDVSATIIPSGDRVVLPAGSELRVTQTLGGNITVQ
                     DPYGQLFRVDEKDGGALGEEYAPKEKPAGDPSEFNEEQVWEQLRTVYDPEIPVNIVEL
                     GLVYACKAEPLPEGGQRVDIQMTLTAPGCGMGPVLVEDVRTKVGSVPGVAETRVELVW
                     DPPWGQERMSDVARLQLGWM"
     gene            complement(675229..675684)
                     /locus_tag="LILAB_RS02755"
                     /old_locus_tag="LILAB_02820"
     CDS             complement(675229..675684)
                     /locus_tag="LILAB_RS02755"
                     /old_locus_tag="LILAB_02820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifU"
                     /protein_id="WP_013935661.1"
                     /db_xref="GI:503701585"
                     /translation="MSSDDLRDLYQEVVLEHSKRPRNYRVVDGATAEAAGHNPLCGDQ
                     LVVTLKVEDGVIKDVGFQGQGCAISKASASLMTGAVKDRTRPEAEALFELVHKLVTEG
                     PESVDVDALGKLAVLSGVSEFPARVKCASLAWHTLRAALEGRGEAVSTE"
     gene            complement(675681..676904)
                     /locus_tag="LILAB_RS02760"
                     /old_locus_tag="LILAB_02825"
     CDS             complement(675681..676904)
                     /locus_tag="LILAB_RS02760"
                     /old_locus_tag="LILAB_02825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013935662.1"
                     /db_xref="GI:503701586"
                     /translation="MSGFDVKQVREDFPILHQEVRGRPLVYLDSAATAQKPRAVIDAL
                     VRFYQHDNANVHRGVHVLSERATEAYEGARETVRRFINARDVKEIVFVRGTTEAINLV
                     AQTYGRKNIGAGDEVLITQMEHHANIVPWRMLCEQTGAVLKVIPVDDRGELVLDAVDA
                     LLTERTRILAVTHVSNALGTVTPVKELIRRAKAKGIPVLVDGAQAVTHFPVDVQDLGC
                     DFYAFSGHKMFGPTGIGVLYGRKELLEAMPPYQGGGDMILSVTMEKVTYNRVPYRFEA
                     GTPNLEGAVGLAAAIRYLEALGMANVAAHDRELLAYATQALESVPGLRLVGTAREKTG
                     VLSFMLADVHPHDVGTILDREGICIRTGHHCAQPVMQHFKVPATSRASLALYNTREDV
                     DALVRGLHKVLEVFQ"
     gene            complement(676901..678241)
                     /locus_tag="LILAB_RS02765"
                     /old_locus_tag="LILAB_02830"
     CDS             complement(676901..678241)
                     /locus_tag="LILAB_RS02765"
                     /old_locus_tag="LILAB_02830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeS assembly protein SufD"
                     /protein_id="WP_013935663.1"
                     /db_xref="GI:503701587"
                     /translation="MTAALAHYLDVATRFQAAPEQASAPRWLKRLRADALAHFERQGL
                     PTTRDEAWKYSRLGAIADGTFIPAARDARDAAHLSSVVERLGLPGPRLVFVDGRLAPE
                     LSSVAGLPRGLTLKPLRDAVREDGELLESLLGQRALSNEHAFTALNAALLEEGALLRL
                     APGALSEVPVQLLFLTRGDGPVLASPRILVVAGESSEATLVETYASAGPAGSSATFTN
                     AVTEVTLGDNASLHHYKLQVEADAALHLGALHARQGRDSRFASHAFAFGGAMARNEVH
                     AAFAGEGGDATLNGLYVGQGAQHLDNRTALDHAVPRCTSRELYKGVLDGQSRGTFHGL
                     IRVRPDAQRTDSRQQNRNLLLSESAQADARPQLEIFADDVKCAHGAAVGRLDAQALFY
                     LRSRGVPQAEAERLLTYAFAREVVEAVPAGPVRANIESLLALKLPGAAQREVKA"
     gene            complement(678238..679026)
                     /gene="sufC"
                     /locus_tag="LILAB_RS02770"
                     /old_locus_tag="LILAB_02835"
     CDS             complement(678238..679026)
                     /gene="sufC"
                     /locus_tag="LILAB_RS02770"
                     /old_locus_tag="LILAB_02835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935664.1"
                     /note="part of SUF system involved in inserting
                     iron-sulfur clusters into proteins; in Escherichia coli
                     this protein forms a complex with SufBD; the SufBCD
                     complex stimulates the cysteine desulfurase SufS in
                     conjunction with SufE; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_043709134.1"
                     /db_xref="GI:760026001"
                     /translation="MALLTVRNLHARVAGKDILKGIDLEVAPGEVHAIMGPNGSGKST
                     LASVLAGRDGYEVTQGEVLFDGKPLLELSPEDRAAAGVFLAFQYPVEIPGVGNIHFLR
                     TALNAQRRAKGLEELDAMDFLQLAKEKSKLVQLDAAFMNRSVNEGFSGGEKKRNEIFQ
                     MAVLEPRLAILDETDSGLDIDALRTVAGGVNALRSPERGMVLITHYQRLLDSIVPDKV
                     HVMAAGRIVRSGGRELALELEEKGYGWLGLDGGKAKAPAAEARR"
     gene            complement(679029..680465)
                     /locus_tag="LILAB_RS02775"
                     /old_locus_tag="LILAB_02840"
     CDS             complement(679029..680465)
                     /locus_tag="LILAB_RS02775"
                     /old_locus_tag="LILAB_02840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase activator complex subunit
                     SufB"
                     /protein_id="WP_013935665.1"
                     /db_xref="GI:503701589"
                     /translation="MSTETLQELTRRPYAAGFVTQVESDTFPPGLDEDVIRALSAKKG
                     EPEFLLDWRLKAFRHWKTMTEPTWQAVTYKPIDYQAISYYSAPKQKPVKASLDEVDPE
                     ILRTYEKLGIPLHEQKLLQNVAVDAVFDSVSVATTFKDKLAKAGVIFCSFSEAVREHP
                     ELVKKYLGSVVPYSDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAAETGQF
                     ERTLIVAEEGSHVSYLEGCTAPMRDTNQLHAAVVELVALDNATIKYSTVQNWYPGDAE
                     GRGGIYNFVTKRGVAHRAAKISWTQVETGSAITWKYPSVILKGDDSVGEFYSVALTNN
                     LQQADTGTKMVHIGKNSRSTIVSKGISAGRGQNTYRGLVKVLKSAQNARNYTQCDSLL
                     LGDKCGAHTVPYIEVKNASAQVEHEASTSKIGEDQLFYCRQRGISQEDAVSMIVNGFC
                     RQVFKELPMEFAVEAQKLLGVSLEGSVG"
     gene            complement(680462..680980)
                     /locus_tag="LILAB_RS02780"
                     /old_locus_tag="LILAB_02845"
     CDS             complement(680462..680980)
                     /locus_tag="LILAB_RS02780"
                     /old_locus_tag="LILAB_02845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_013935666.1"
                     /db_xref="GI:503701590"
                     /translation="MLRMSKMTDYGIVLMTELARAEGDTRTTRELAARTRVPLPSASK
                     VLKGLLQAALVVSHRGANGGYGLARPAGELSLAELVAALEGPVALTECGVHPTGGAPC
                     ELESVCQVRGHWRLINSAIQEALGRLTLADLIAPAPRVPERLVGLGTPARPAPSPAAG
                     HPASASATGVRS"
     gene            681166..682356
                     /locus_tag="LILAB_RS02785"
                     /old_locus_tag="LILAB_02850"
     CDS             681166..682356
                     /locus_tag="LILAB_RS02785"
                     /old_locus_tag="LILAB_02850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine utilization protein EutJ"
                     /protein_id="WP_013935667.1"
                     /db_xref="GI:503701591"
                     /translation="MRRPLMLLATLALAVVACEKKTAPAPAAPSPEGQATGTAAAPVD
                     SDTILLGEVGSLTGSEATFGVSARNGIELALNEANEAGGVKGKKLQVRVYDSQGRPEE
                     GAQAVTRLITQDKVVAILGEAASSVSMAMAEKAQAGQVPMVTPTSTAPEVTQKGDYIF
                     RVCFIDPFQGLVMAKFARENLKLSRVAVLRDNKSAFSMGLADVFTEKFKAFGGEVPGD
                     ESYSKGDTDFRAQLTSIKRLKPDAVFVPGYYTDVGIIARQAREIGLKVPLLGGDGWDS
                     DKLYELGGSALEGSYFSNHYSPDNPDPVLQKFLARYKATYGSVPDSVAALAYDAARVT
                     IDAMKRAPDLSGPSLRDAIAATRDFPGVAGRITLDANRDAVKEAVVLKVSGGKAQFVT
                     TVTP"
     gene            complement(682381..682560)
                     /locus_tag="LILAB_RS02790"
                     /old_locus_tag="LILAB_02855"
     CDS             complement(682381..682560)
                     /locus_tag="LILAB_RS02790"
                     /old_locus_tag="LILAB_02855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935668.1"
                     /db_xref="GI:503701592"
                     /translation="MRKSLRPSRSARGQSMVEYAIVTASLLVFSVGGWPFLVALLNAL
                     HRYFNSIYYVIQAPI"
     gene            complement(682557..683414)
                     /locus_tag="LILAB_RS02795"
                     /old_locus_tag="LILAB_02860"
     CDS             complement(682557..683414)
                     /locus_tag="LILAB_RS02795"
                     /old_locus_tag="LILAB_02860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935669.1"
                     /db_xref="GI:503701593"
                     /translation="MSDAASRPVVRIPALLFSVAVVGGLIGFSWEHAVYRGSDSHQEW
                     SPPELDTDVEVSSRAWVRTPAEEAILQRALVHFPPYPNATRPEALAADYLGPGAPMAV
                     AWFSTPDTPARVLEHYTQALLAKGLPVLHQRQGEKGGYVGYWSPATEEVRLVSTLAQG
                     GETLVFVSSGQVGAMLQRAAAVPDWVPVPGELAEARTVNFNLEGASHHVVAGQLTASS
                     PTEAARRYGDLFRERGWSVGPSVPVAPDGVAFEVLKESASGRAVLRGHSPGPGVEVQL
                     TLLRRSVAP"
     gene            complement(683414..684523)
                     /locus_tag="LILAB_RS02800"
                     /old_locus_tag="LILAB_02865"
     CDS             complement(683414..684523)
                     /locus_tag="LILAB_RS02800"
                     /old_locus_tag="LILAB_02865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935670.1"
                     /db_xref="GI:503701594"
                     /translation="MKRAARRGAASVEMAVCMLVIIPVFLYSLFLFDLLRHMLDAQET
                     SLTTAWDYTVLDYEKEPESVATEDGGTTTEAFSGFEMAQAYSRYMYCDHESGLDSYGP
                     GKGPECQDDESHHTDVVAHACWLNVGGQQVYCSLDADDVGAYDDPLHQSYRSTFGRGG
                     LIRCSARLGVQNYLLPEQFLPEFSRVRLAKEKQERANGVHNNATGKFSDGGTQAGKGE
                     DVYLLPEEKIAILTDTWALTEHADVRPGTAGGRGMHERVTQLYQNPDNSGFTDMSSAS
                     ERLVNQAIRSGLLNPGLRLEPQSYKTPGDDPRNPSLAIKPDESGDGAVEEVEQQGGRQ
                     GYFSNEWQDWENNNNQRSYEARGNWYLGCERAESC"
     gene            complement(684520..686097)
                     /locus_tag="LILAB_RS02805"
                     /old_locus_tag="LILAB_02870"
     CDS             complement(684520..686097)
                     /locus_tag="LILAB_RS02805"
                     /old_locus_tag="LILAB_02870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709137.1"
                     /db_xref="GI:760026004"
                     /translation="MRLPLRLPGSVSARARRRAQRGQAIVLGALSFLVLALMVTLSFN
                     LAHALRQKMGLQQHSDALAYSMAVLEARSLNYYAVSNRGIAASYVAMNSLHAYMAAAS
                     VTGEMMRASEKNFKEFERIEYLRCACKGCYEHCLHAREAAQTAADFARAGRSYDKRLR
                     ALESSFNAAVRGVDVMVDNLHASQREAHTQTLQAIQDGRSQGLNHLAAETAPDVGALP
                     GAVGGLNANEFNCAVDGMSCRGSVENASPEALARVMTEISNATRSGWPAARKAGGLEG
                     GIRKPKYLHQDFLTELEKIAKREYRVTSHEGTSKSVQDKGQVNDGGKQGGNQGTTVAG
                     REEGTIQNTWRYHGLRSSNDYDAEVWSDANGGGHTPGGAHSGSHTFEGVNANALSGCA
                     RSGNCFMKFRANPSSDRDWGQPRVYSYLTRPLRVGDPRKAPWELNASARIQLTHGAQG
                     TGSLTLAAQEGVALSKALVYYHRFGANGWREAPNLFSPYWRAKLHPISPDEAVEVLEA
                     AGNTDASRLAQVPEVSL"
     gene            complement(686064..686861)
                     /locus_tag="LILAB_RS02810"
                     /old_locus_tag="LILAB_02875"
     CDS             complement(686064..686861)
                     /locus_tag="LILAB_RS02810"
                     /old_locus_tag="LILAB_02875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709140.1"
                     /db_xref="GI:760026007"
                     /translation="MGGLRERNQSGQAAVESAIVLPLFVFLILGILQLGLMHQARLLT
                     KYAAYKAVRAGALNSAKVDAMEKAALAVLLPMLSVSSKGSGDMKLAHIPPVGSAAEFR
                     AKWREASKNKILAEGSPLKHVEVTICGPTRSDVGGSGPELDFDDPRNTAPTGWRESHR
                     TKLRVQVTFNYRMIIPFADWVIYQAARGRELRKELRMYSKPRDPDQARYTPGPSESLL
                     EQAAAQKVYIAPIRATYTMRMQSNFFLNRAALPGSNECVFPFAYPAP"
     gene            complement(687029..688573)
                     /locus_tag="LILAB_RS02815"
                     /old_locus_tag="LILAB_02880"
     CDS             complement(687029..688573)
                     /locus_tag="LILAB_RS02815"
                     /old_locus_tag="LILAB_02880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_013935673.1"
                     /db_xref="GI:503701597"
                     /translation="MFPTPSQVLRQREGVLADTPFPLLLHALMAEERTCTLELKVRQR
                     EKRIVFEDGAPVACQSNLLHETLGKYLVEKGKLTETDYQKALAESISAEVPLSGLLVQ
                     KGLISPFDLYKQLQANLAHKLLDCFRWVDAKYRLIADVEPPDASVRTNTGQLILTGVA
                     NVMPFDAVATHFTFTDERRFGQMPGTEAGLKLSSKDARLFQALRLRPTFGELMERTGF
                     DTEVVLRRLYALCLLEVAGFVEDVDAKAARLSAERAAAPVATPVPEPVAPPVAAPAPQ
                     GTPFSDEDEAARNALVSAFMSHRSKDPFTLLDVPEDVQPVPLRKAFLALADRFAPLRF
                     HTPELREKAEVLLAAHAKAFGALSDAEQNLLWRKRRAAHREKDRGTRPTTAEQFRIRT
                     DLLDATTQFDEAKRRLAARNHAGAFEYFEYACDIDPKPLYQAWRAYARYLMKPEAHGR
                     LAQQELQEVLRQEPALEEGWAFLGEVAQGEGQWSQAEDAFRKAFKLNPKNRRYVELIQ
                     EIVRRR"
     gene            complement(688589..689419)
                     /locus_tag="LILAB_RS02820"
                     /old_locus_tag="LILAB_02885"
     CDS             complement(688589..689419)
                     /locus_tag="LILAB_RS02820"
                     /old_locus_tag="LILAB_02885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935674.1"
                     /db_xref="GI:503701598"
                     /translation="MSKWILWLFLTLLTGSPLLSLGLIIVIIFVADRFTWQVLPSPVR
                     LLKRFQRAGQLAGTILTNPHERRARHELADIRVAQRRYAEAVDILKPNLEAGDEDVDT
                     LYLLGVAYLGAGDAQRGELLLDEAAKLDPDHKLGAIDLERGRFRLKRGDVAGAVEALE
                     RYCQVRHGTVEGRYLLARALGGVGRAEDAKRMRERAWMEYVAAPRFQRRRERKWAWRA
                     RPSRPLMYAAAFALVMGLLASMLPRFGMTPEPGYGDRYRYDAYGEPHRASGMEEYQGE
                     "
     gene            complement(689453..690658)
                     /locus_tag="LILAB_RS02825"
                     /old_locus_tag="LILAB_02890"
     CDS             complement(689453..690658)
                     /locus_tag="LILAB_RS02825"
                     /old_locus_tag="LILAB_02890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_043709142.1"
                     /db_xref="GI:760026009"
                     /translation="MPFDAPVDALTGMPAARFGLYLHFPYCLAKCPYCDFAVAVARQV
                     PEERYAHAVLKELDTRLAAEPSLAGKVLDSIFLGGGTPSLWHPRYVAQVLDGIAARLK
                     VAPGVEVSLEGNPERADAERFAGYRAAGVNRLSLGVQSFQPETLKALGRAHDAAMVEG
                     AVDAARRAGFPVVAMDFIYGVHGQTVAQVEADARRAVALSPEHLSTYALTVERDVLAE
                     DTPLSKRLKRGELALPPDDTVVDMARVVREVYGAAGLHRYEVSNHARPGYSSRHNALY
                     WTGGEYLALGVGATGMLLSPEPHRYVNLRGAERYLVEAEAGRLPEDSREPLGPEELFA
                     ERLAMGLRLVSGVDWEAVCERYGQPVAPRRAEVARLVEHGFATLRDGRLALTEKGADV
                     HSAVCARLL"
     gene            complement(690672..692924)
                     /locus_tag="LILAB_RS02830"
                     /old_locus_tag="LILAB_02895"
     CDS             complement(690672..692924)
                     /locus_tag="LILAB_RS02830"
                     /old_locus_tag="LILAB_02895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935676.1"
                     /db_xref="GI:503701600"
                     /translation="MPSPPEEVDPLADLRESLDLEDTGASVAPAAVAPVASRPLPKPP
                     PSAPPPAAPPPLPPRRPAASLAAVPKGTGVPATPKAPAAPAVPPAAPAVRAARGSGND
                     PFGEPPEIRMPMGGSPEDKLEYFRAVVRQKTETLARARTLYAERDGELNGVKQSLTLA
                     RKELAESKASISAFQDELARAASESQARLAVLQEELTAVEADRKDLSRALAEVESDVP
                     RLTSELQEEREARGAVAEELIGAKEALSLAQDRVAELAAEKSEAQGALEAVQEQYQQA
                     IADVERLTSELEAASAEKDSLNLRAAQLEAALAEAQSGLSALESESDWSKSSLEEAQG
                     RASTLAAERDEARKRLSVVEDGLRTLQEQVAELERSLALKDAEIVGLRAALTARTTEA
                     AELPALRQALEARTAELAQLKAKRESEAAKAAERSEALEEGLAQASERAQVAEGEAAA
                     LKEALEAAEVEQVSLRDRMEADAAALGEAVQQAETKVSELTAAVEAAHAEHAAIKEQL
                     AAVELKAATKDAERVGLSARVSMLEAASGQREAELARLQAEVAKAHEALSLEQARREA
                     AEAERTDAEVAKAQAEAQVESLTVGQGGAEAQVASLTEELEAARAEADKVERLQGRLK
                     MMEGALEAAKAQAAGVGKADAARATAEAKLARTEASLKAAEEKLSHAEASLRAEQEAR
                     QGLEAKLAERPAAASAGAPGDWEAEREQLKADAANLKRKLMAAETALENAAGYKAKIA
                     RLEAQLKGKK"
     gene            692923..695727
                     /locus_tag="LILAB_RS02835"
                     /old_locus_tag="LILAB_02900"
     CDS             692923..695727
                     /locus_tag="LILAB_RS02835"
                     /old_locus_tag="LILAB_02900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_043709144.1"
                     /db_xref="GI:760026011"
                     /translation="MGGRRLPPGRAHHQRRVGRCASEVHPSGRTAAVQSPRRRGSRAL
                     ASEGKHHTSPCPLGGRVTASDVSMAIRYALPNGLTVVFEEQHAAKVAAFQVWVKAGSA
                     DERPDQAGLAHLHEHMLFKGTERRGPGEVARDVESHGGEINAWTSYDQTVYHIVIASQ
                     FARMGLDILGDAVRRSAFDAGELSREIEVVCEEIKRSQDTPSRRASRDLFSTAYQVHP
                     YRLPVIGTDASVRSFTREKVLEFYHRHYTPRNLVLSVAGDLREADLRAWVEDIFGGDW
                     GRPYEGWVARAAEPEATGRRILLRPDEVKEAYLHLAFGIPQADHADVPALDVLAMIAG
                     QGDASRLAREVKRRHNLVNDIHTFAYTPVDPGIFSASLTLQPANAVRALEETARGLAT
                     LRATPVTAEELATAKALVEAEAVYQRETVQGVARKMGFYQSGMGSLEAEARYYEAVRN
                     LTPEHLRAAAERYLRFDRAVVTGLLPEGTPLTEAQVHEVLDAAERGPAAPPPERKPRK
                     VPVSDSPVRILKGAGTGPSDIITEKLPSGATIVVRVEPAVPLFAVRAAFAGGLRYETP
                     EDNGISTLLTRTLTRGTPTHDAEEISDLIDAYAGSLGGQGGRNSVGLRGEFLSRHFEP
                     AFRLFADCLLNPSFPEAEVARERTLLLQDILTREDKPSSVAFDLFSKTIYQTHPYRLP
                     TSGEQASVEKLTPEKLRAWHAAYMDPSQLTLSVVGDVKVDEVMALAREYFGTSRGKAA
                     PPPKVPVEAPLTGPREAKKVLARAQAHLVLGFPGGRVSDPWQYALEVLSTVLSGQGGR
                     LFVELRDKRSMAYSVSSFAIEGVDPGYFATYMGTSPEKVDAALEGIRAELARVRDEPI
                     PAEELARAKQHLIGTHEIGLQRNGARAALLALDTCYGLGMGNFLHYADRVAAVTAEDV
                     REVARKVIDFDRSALAIVGP"
     gene            complement(695761..696792)
                     /locus_tag="LILAB_RS02840"
                     /old_locus_tag="LILAB_02905"
     CDS             complement(695761..696792)
                     /locus_tag="LILAB_RS02840"
                     /old_locus_tag="LILAB_02905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709146.1"
                     /db_xref="GI:760026013"
                     /translation="MPRAAAELGHVHGPPPGLRGRDAVSHRVPGRRGLLPGGPAMKRL
                     GAAVLVWAVGCTPLDVERRTERGPLLRTYAQEKALNERIPFATTQVQWPQLTLAFSSA
                     DICRTEQHGEYAEDVISTRYDTGAAAAVSTGGILAVLGGALLVGRTLFSDAPNRSAID
                     EKGRYGASSREVATGWGVGLLIVGVPAVVAGIVQLNRGGESRETRKTDELLSLREVPC
                     QPKPVDGVVELAGGPDPQPPPRLTLNGALVLTADEIRELSFSGLALDGTPVTLGEEDL
                     DRLETFRTCATLLAAPVDPQALAGEARSNPDRLRVKRELARGCTQLPGAPAQPLLDAI
                     EGALGSTAL"
     gene            697075..697941
                     /locus_tag="LILAB_RS02845"
                     /old_locus_tag="LILAB_02915"
     CDS             697075..697941
                     /locus_tag="LILAB_RS02845"
                     /old_locus_tag="LILAB_02915"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DD74.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="WP_013935680.1"
                     /db_xref="GI:503701604"
                     /translation="MSQTYLSLTVELPEEASEAVQDLLHESGALGLEVRDREGPIMPG
                     VRGPNPGEAIIIGYYDDRDTAEAARDEVVESFPSARLTLDEQPQQDWSNEWKSLIKSV
                     HVGRLWVGPPWDRANAPAGTVQLVIEPKMAFGTGDHPTTSLCLAAVDAYMAEHPGATV
                     LDVGTGTGVLAIAAKKLGAGRTVATDNDPVSVELAQENQAENGTPDIEVSGKELTQVE
                     GTFDLVLANILANTLIELAPLIVAKTKDRLVLAGVLAHQRADVEAAYRNLGLTVLPGA
                     TQGEWVRIDLKR"
     gene            complement(697993..699114)
                     /locus_tag="LILAB_RS02850"
                     /old_locus_tag="LILAB_02920"
     CDS             complement(697993..699114)
                     /locus_tag="LILAB_RS02850"
                     /old_locus_tag="LILAB_02920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013935681.1"
                     /db_xref="GI:503701605"
                     /translation="MDNLAHSLVGAWMAEAGLKRTTPLATATLVIGANLPDVDGLVAF
                     AGSDASLYWRRGWTHGVLALALWPFVLTGLMLLWDRYVRRRRHPDLPPARVGPLLVLS
                     TLSVLSHPALDWLNTYGVRLLMPFDGTWFYGDTLFIIDPWVWLLAGAAVIMADARTRK
                     SAAAWVVLGVASTALIMVPAFVPWPAKAMWAVGVAAIVWLRLRGTHVLSVQRVARVCG
                     VGLLLYLCAIFAGSQVAAPRALDWLRAQGLPVERAIAGPLPANPFVRDIIALGPDRYH
                     FVRADFLADDAGRFRISDASEPRVVQPGPVIQAALSAPQIRGLANWLRLPTYQVEEGT
                     DGWRVTIRDVRYSRTQSGGLGTAVVELDHALRPIRVEQR"
     gene            699201..700247
                     /locus_tag="LILAB_RS02855"
                     /old_locus_tag="LILAB_02925"
     CDS             699201..700247
                     /locus_tag="LILAB_RS02855"
                     /old_locus_tag="LILAB_02925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013935682.1"
                     /db_xref="GI:503701606"
                     /translation="METPPPSRPPTDVRSQLVGPLLAYLRATGHDPSGLVERFGLPGN
                     VGALPEVTLALPTLHAFLDAAEALSGDAFLGLHVAQRVPRGNYGLVEYIARASPTVRD
                     TFRALARYMALLEPAWRASFQDAPDGSGTFVYGIPGEPLAYGRHASEFGLALFVHVGR
                     QLTEHPWNPRRVSFAHPAPADLRPLEEHFGVTPSFDAGRNALTLDAATLALRVVGADP
                     VLLSVLERAAGTPAAEPPAAPPTPPFLQQVRDALRAALREGAPQMADVAKPLHVSPRT
                     LQRRLAEHATSFQDEVDAVRRELAFDYLRDAHLGVSEVAFLLGYSELSTFDRAFKRWT
                     GMTPRVWRERTEPT"
     gene            700369..700860
                     /locus_tag="LILAB_RS02860"
                     /old_locus_tag="LILAB_02930"
     CDS             700369..700860
                     /locus_tag="LILAB_RS02860"
                     /old_locus_tag="LILAB_02930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935683.1"
                     /db_xref="GI:503701607"
                     /translation="MLKSQVVALFDEYYASHQHPTNRLTHKIAIPLIVLHIVAMLDWV
                     HLVAVPAIPGGSLTLGMVTLALAAVWYLRADVKLGLIVVLFMAACFPVGRLMPTWSVV
                     AVAAFAWLVQLAGHSVWEKKSPSFLTNLVHALVGPLFFVAVLLGDYVLKPQQATAAAP
                     VRA"
     gene            700870..701385
                     /locus_tag="LILAB_RS02865"
                     /old_locus_tag="LILAB_02935"
     CDS             700870..701385
                     /locus_tag="LILAB_RS02865"
                     /old_locus_tag="LILAB_02935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935684.1"
                     /db_xref="GI:503701608"
                     /translation="MTSFADKLRVWLPLHENGVSRAAHFVGAYLFIFALLVPLGLVRL
                     PAGPVGLTAAHVLLLAVALYAVSLEWTAGLLMTLPLVPTLLAAEAVVARLPASTAVAV
                     AVAVMAVRFALVVGAHVVFEKKTHGLSLGGPLLFFIEPVYLLTVALFSLGLKQGLRAR
                     VEAGGGASLPA"
     gene            complement(701436..702737)
                     /locus_tag="LILAB_RS02870"
                     /old_locus_tag="LILAB_02940"
     CDS             complement(701436..702737)
                     /locus_tag="LILAB_RS02870"
                     /old_locus_tag="LILAB_02940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate cyclase"
                     /protein_id="WP_013935685.1"
                     /db_xref="GI:503701609"
                     /translation="MPVIMRRSDKATSHSNEEVVLATSSLQGERRVAIVRVVVVLLMA
                     LSQVVIAGFGGETYSAPVDGVRLQVMGAYVVFSVVAIVVLLLQKPHPDRARWLPVPTT
                     LADTSFFSFMAWHTWRISGVFDAGMLCASLGMVLAFSVVRYSWWHVLLSTVLSGGGYA
                     LLAWLTGHGSVARTSFVLICYAALGALIALTNSDVGGMFLNLRRRDGLSRFLPRQVVE
                     RVMQLGDDSLQPVQRDVTILFSDIRDFTALSETLDPGQVLELLDDYFGHMAHIVMARH
                     GIVNKFLGDGMLACWGVPDAREDHAELAMRAALDMRARLEDINAQRILRGQPALRIGI
                     GLHTGMVAAGMLGGAEQHEYTVIGDAVNLASRVEGLTKSHGVDILVSERTWQMAGEHF
                     VGERLGEAHVKGRREAVVVYSLQGPRSGEDAPPVLRAAAGT"
     gene            702883..703617
                     /locus_tag="LILAB_RS02875"
                     /old_locus_tag="LILAB_02945"
     CDS             702883..703617
                     /locus_tag="LILAB_RS02875"
                     /old_locus_tag="LILAB_02945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_013935686.1"
                     /db_xref="GI:503701610"
                     /translation="MVRLFAPLPEPAPAEVELTGERRHYLLHVLRLEEGDALEVFDGQ
                     GRAFEARVAHVAPESVRLTLGTARVAPPRREVSILQGLPKGDKLELVLQKGTELGATA
                     FHPVATARSVVKLEPRRAEERTTRWTKIVEEAARQCRRNDVPRVATPAPLVDAARSLP
                     AGTVLLVLDEEESAVPLGEAFRAAGAGTAVALVIGPEGGLAREEVDALKGLGARPVTL
                     GKRILRTETAALAALAVMMHLDGELG"
     gene            703727..703993
                     /locus_tag="LILAB_RS02880"
                     /old_locus_tag="LILAB_02950"
     CDS             703727..703993
                     /locus_tag="LILAB_RS02880"
                     /old_locus_tag="LILAB_02950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_013935687.1"
                     /db_xref="GI:503701611"
                     /translation="MGIIAFIVIGLIAGLIARAILPGKQSMGLIATTLLGMVGSLVGG
                     LVGSLFQRDGRLFDLRPSGIIMSVIGAIVVLLLVGAAGRRRAHA"
     gene            complement(704238..705629)
                     /locus_tag="LILAB_RS02885"
                     /old_locus_tag="LILAB_02955"
     CDS             complement(704238..705629)
                     /locus_tag="LILAB_RS02885"
                     /old_locus_tag="LILAB_02955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015456525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935688.1"
                     /db_xref="GI:503701612"
                     /translation="MGLRGPGRRLLLGRGGARLLGRGARLGGPRRGLLRRGARLGGAG
                     SLGSRLLGRGARLGGPRRGLLRRGGGTRLRRGARVGRGAWLGDARCGLLRRGGGTRLR
                     RGARVGRGAWLGDARCGLLRRGARLGGAGSLGSRLLGRGARVGRGAWLGDARCGLLRR
                     GARLGGAGSLGSRLLGRGARVGRGAWLGDARCGLLRRGARLGGAGSLGSRLLGRGARV
                     GRGAWLGDARCGLLRPGARLSGPRRGLLGHGGGPRLCGARRGLLRRGGGTRLRRGARV
                     GRGAWLGDARCGLLRRGARLGGAGSLGSRLLGRGARVGGPRRGLLGRGGARVGGGCAG
                     LCKPRCGLLRPGARLSGPRRGLLGHGGGPRLCGARRGLLRRGGPRRGGAEGGGPRLLR
                     GARRRGGLRGARRGGARQGRGQRGDGRRRRWRVLRQVGEGGRAWQRRQLLGALLRAAV
                     DADVPIEEAGHSG"
     gene            705750..706469
                     /locus_tag="LILAB_RS02890"
                     /old_locus_tag="LILAB_02960"
     CDS             705750..706469
                     /locus_tag="LILAB_RS02890"
                     /old_locus_tag="LILAB_02960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="WP_043712336.1"
                     /db_xref="GI:760029287"
                     /translation="MEQAAPSEGLPRPEHAAPPATAPAGLPRVENADELPSAQSPAAP
                     SGLPHMEPLLPGVSVGVARAEAIKAPPHKAQARSASGDTEVRARPASLWRRLLSFTID
                     TAAIAGVAALYITLASSVTGLKSPDAGLQGMDAFVAWLHAFHAILLPGFFLVLILALV
                     YCAVAAFLWNGRTLGRLALGLRLVDTHGLAPAPGRAIIRALLASLSFVFFLGGFWMAL
                     FDRRGQTLHDKLTSTFVVQPS"
     gene            706522..709362
                     /locus_tag="LILAB_RS02895"
                     /old_locus_tag="LILAB_02965"
     CDS             706522..709362
                     /locus_tag="LILAB_RS02895"
                     /old_locus_tag="LILAB_02965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FrgA protein"
                     /protein_id="WP_013935690.1"
                     /db_xref="GI:503701614"
                     /translation="MPARLAQLLVSRMLLTQEKAGEVLRQHQTLGGQVDSVLLEQGIA
                     SEADVLALLGEVSGFMPVNLMDFEPNPEVASFIPPKIAERLCVVPLSLDGNTLHVASG
                     YPVPKKELDEVGFLLGKPLELWVATEVRVREWVSTIYRQPLAPRFARLSAALDPEAQA
                     ATPPPPPPPAALEEESLTADVVERLARSVAQEPLPAEVSAAPQAAVPRPEAPPQRPPP
                     PPPEALTQAPENLPPPGPPAFVRAPLRLNMPQADAPARPAQRPNPPASQIPVLHPAGA
                     AASASTAPQAAPPSPGAAEPKPAAAATAPSAQQPVSSAAPRAPAQSGTPLPPAQGAPA
                     ATPGQSQVWPPAQPGATGTPQVWPPAPAQPAAPPTLHFTTPVAPPKPAAAQPRSEPAF
                     LVFPNPGAAPQSAPPPRPKPAAPATLETRPAPPPASQDVPDWTLAQARAALKDATKDR
                     DRLIDVALRFGRRTFDYVAAFAVLRGGATGLEARGEGMTGEQLTQVSIPLDASSVFRT
                     VAVTRGSYAGPLPPDALTRHYLELFGRQTPRTVFLYPVEVKGRLVAILYGDCGQRPIS
                     QRRLSDYILFCQDLPAAFQELILFRKQRVSELRAPDDEELTIDVDLPVAPTPAPAPAV
                     VAGLGWSPFFGRGATGNMGRAAALPPRAQSQEERPPPDFAPLLRRLTGPDAAQRANAM
                     AELARSPEASARVLAQHFPGPTAWSRLPVVELPEADELGPIPGALSRLGRPAAQAVSP
                     LLDSQDADTRYFALLTAGNLPYVELVDGVLRGLFDLEPDISSAARVAAAALKQLPRLD
                     AALRDLRHELNSRDPLRRSLAARALGTLHDRDAIEGLIRLTGGDDEMCAQAAAEALRE
                     VTRATLGLDPRPWSAWWAENRSRRRADWLVAALRHRELDVRLAAIEELSRALHDTLGY
                     YADAPEAEREQAVRRWEAAAVEPANARRLGML"
     gene            709387..710919
                     /locus_tag="LILAB_RS02900"
                     /old_locus_tag="LILAB_02970"
     CDS             709387..710919
                     /locus_tag="LILAB_RS02900"
                     /old_locus_tag="LILAB_02970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935691.1"
                     /db_xref="GI:503701615"
                     /translation="MTGGMWISLLACAGQLALAGLALARVGKSPLALPLSLLSIALST
                     WNFSGFALVRADEDGWRLVGFTAGLMTVPCALHFILSFVGRRRSLAWAMYGAYALFGV
                     LAVAMLVALGAPTLEAHLLTLRFGLVVTALAIPTLGAGFALLGLHVLRSRHPDERARA
                     GLVLLGLTLVVALLMTELAAELGLEVVRLGHVGTLLGLPVMATAALRFGLFGDDPGAP
                     RLALHAAGIAGLGVLAYLAVVRLFVAQAGTLIICTTAVTFALVAATRRGVTAYVSRSE
                     RLERLATLGRFSAQMAHDLKNPIAAMKGAAQYLKEEHARGRPWDGHGEFLDLLLEQVE
                     RLDRVVDTYQRLARVEPLPQPVDLRRLVEGVLSLQAFASPGRVAIVRELTPGLPPCAG
                     DQDLLANALENLVRNACEAMPEGGTLTVRALRDGAGVALEVEDTGQGMDARTRERAFD
                     DFFTTKASGSGLGLAFVRRVVEAHGGEVLLTSREGRGTVVRMRLPATDASLGGAGVGE
                     AA"
     gene            710940..712322
                     /locus_tag="LILAB_RS02905"
                     /old_locus_tag="LILAB_02975"
     CDS             710940..712322
                     /locus_tag="LILAB_RS02905"
                     /old_locus_tag="LILAB_02975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935692.1"
                     /note="DNA-binding response regulator in two-component
                     regulatory system with ZraS; response regulator/sigma54
                     interaction protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_043709148.1"
                     /db_xref="GI:760026015"
                     /translation="MLLVDDDPAVAKVLGALLTQAGLTTHAARDGQEALALLASKPVD
                     VVVSDVRMPGMDGLQVLAEVSRGWPDVPVILLTAHGTVPLAVEAMKAGAADFVLKPFD
                     REEILFTVRKALLRAQGEAGRQQPRATGDFIGQSRAMADVQAVLAKAAAGTATVLLRG
                     ESGTGKELAAKAVHDASPRRDGPFVKLHCAALPDTLLESELFGYEKGAFTGAATRKPG
                     RVELAHGGTLFLDEVGDISPAVQVKLLRVIQERELERLGGTQTVKVDVRFVAATHQPL
                     EERVKEGRFREDLFYRLNVVPVWLPALRERPDDIEPLALHFLEVHAKTNGRPPFTLTP
                     DGLAALRAQPWPGNVRQLQNFLERLVVLSDTQVLGGQEVLHELARQPGLSPAPSLSVP
                     VSAASPTEFQAAPSADSARTLESQRKEMERQAMADALRRAGDNRTLAARLLGISRRTL
                     YNKLEEYGLL"
     gene            complement(712329..713198)
                     /locus_tag="LILAB_RS02910"
                     /old_locus_tag="LILAB_02980"
     CDS             complement(712329..713198)
                     /locus_tag="LILAB_RS02910"
                     /old_locus_tag="LILAB_02980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_043712337.1"
                     /db_xref="GI:760029288"
                     /translation="MRELLLVAEKRSFTAAAAELRVTPSAVSQAISALEERLHARLVQ
                     RTTRSVSLTEAGARFVAELRPAMEGIRGAFATLESARGRPTGTLRLNVPRLAFGPVIK
                     PMLARFLTAHPELRIDVTLDDGLRDIVAEGYDAGIRLGERVDRDMVAVPVTGDMRMAV
                     VGSPAYFDTHPHPRHPRDLAAHDCVNYRHATSRNIARWEFVVDGRELTVAVNGRVITN
                     DNEVMVLAALDGQGLAYVMEHTVTEHLAAKRLVRVLTRYCPSFPGLYLYHPNRKNQPL
                     KLRALIDFLRARP"
     gene            713321..714175
                     /locus_tag="LILAB_RS02915"
                     /old_locus_tag="LILAB_02985"
     CDS             713321..714175
                     /locus_tag="LILAB_RS02915"
                     /old_locus_tag="LILAB_02985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013935694.1"
                     /db_xref="GI:503701618"
                     /translation="MTLDAPSSLKVWFITGASSGFGHAIVREALSRGDAVVATARKPE
                     SLADLVALAPDRVLALALDVTHPTGAQAAVASALARFGRIDVLVNNAGFSIIGAVEET
                     SEEALRDTLELMFFGAVRLTREVVPHMRARGTGTLVQITSMAGIGTSPGFGAYCAAKH
                     ALEGHSECLAHELRPHGVRVLIVEPGTFRTSLFGDAFRRMPEHPAYAQTSGAVRAWVT
                     QTAGQQSGDPAKGARAIVDEVARPASPDAPLRLPLGGDAVDGIRQKLAFIAADVDRTE
                     RAARATSF"
     gene            complement(714206..715579)
                     /locus_tag="LILAB_RS02920"
                     /old_locus_tag="LILAB_02990"
     CDS             complement(714206..715579)
                     /locus_tag="LILAB_RS02920"
                     /old_locus_tag="LILAB_02990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935695.1"
                     /db_xref="GI:503701619"
                     /translation="MAAQERMSSVDALWFHMEEPANLMMITAVLWFEGRLDFERLKAV
                     VRERLVERYPRFRQRAVAGLVGLPHWEDVPALDLDAHLSRLDVPPPGDRAVLESLVGQ
                     WMSTPLERSRPLWQFHVMSAADGRDVLLARLHHSLADGMALARVLLTLTDGAEAELAA
                     EAPEPPSRPAPGGLVSWVRGARAVAGTARAVWRKGAELAAEPILAGDLLVKGARGAAA
                     MGKLLVTPPDPRTSLRGPLGTQKRAAWSDPVSLERVKAVGRALGGTVNDVLLAAVTGA
                     LRRYLESQGEPPEDLHALVPVNLRPLDVPVPRELGNHFGVVFLRLPVHLGAPTRRLRE
                     LTRRMERLKRSPEAVLTFGALEVLGYTPAALERWVVDTFGSKASLIATNVPGPRAAVS
                     LAGSRLEGLTFWVPQTGHLGLGVSLFSYAGQVTVGVAADAGRVPDPHALIQAFHEELD
                     ALASERD"
     gene            complement(715608..716414)
                     /locus_tag="LILAB_RS02925"
                     /old_locus_tag="LILAB_02995"
     CDS             complement(715608..716414)
                     /locus_tag="LILAB_RS02925"
                     /old_locus_tag="LILAB_02995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935696.1"
                     /db_xref="GI:503701620"
                     /translation="MSSSRLVVLFLALGAALPSAAQTSSPQRPRTVAGVCGATNWACV
                     AECIDAECVDTCMRQDCERALERLKACTQRAGCAPNDARCGPRACLPVCQRSFEPAPP
                     SPEKEVPAPCEGVTAQGAPPPRELVGTWTLVAASLPEEEEVREERIEAQPRSDYARSL
                     QVTPSGCFVLRTSLEAATLGQGNSLVVRAWGTLELSGEDRVRLRTRDGQAVGPVCGDK
                     RVIPLTGPKLKFKGGAYVWDLEEGVLTLMVDDKTKQTFQFERATPEAGKK"
     gene            complement(716511..717506)
                     /locus_tag="LILAB_RS02930"
                     /old_locus_tag="LILAB_03000"
     CDS             complement(716511..717506)
                     /locus_tag="LILAB_RS02930"
                     /old_locus_tag="LILAB_03000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_043709149.1"
                     /db_xref="GI:760026016"
                     /translation="MPNLLDMPRQALMDLRSRLSHSTLVSQLPRNVVPDSLSLSSPAP
                     QDYTLADPERVEAWRRACERYVRPGQVVMDACTGTGLRTFLAASRRPKKLYAVDGSRL
                     LDTAQWVARRNGMENIDFVRAQPWQFQLPEKVDVLLHELLGDALFDAGLVPRVLDLRN
                     RVLKPGGRILPNRFEVFVEPVQLRDEACIPFIWSQRFPSVDYSCLQTLREAMNPSYFT
                     RVIRSYEVDHLLCDPEPAFAFDLETMVADGLPHRVRYSRPVVEEGRVDGFCLFYRVAF
                     DAELAFNVSPLRGQNHAGMMLLRVDSREFERFDTLSFELELVEPADVRTWRWQFT"
     gene            complement(717653..718447)
                     /locus_tag="LILAB_RS02935"
                     /old_locus_tag="LILAB_03005"
     CDS             complement(717653..718447)
                     /locus_tag="LILAB_RS02935"
                     /old_locus_tag="LILAB_03005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_013935698.1"
                     /db_xref="GI:503701622"
                     /translation="MAEPAQRNAIELENVHKSFGAQHVLRGVDLVVPMGTTCVLLGVS
                     GSGKTVLMKHLDGLLRPDRGTVRVDGEDLAWLDAAGMERVRRKLGILFQGGALFDSLT
                     VEDNVAFPLRERLHLVEREVRERVRRVLALVELEDAAKLRPGELSGGMLKRAAFARAV
                     VLEPKILLYDDPTAGLDPLRTRSVVDVILTGKHRLQASALVITPDVASAFQVADSLAL
                     LHEGRIIEHAAPEAFRQSQHPAVQAFLHDWLSRRARASRHPPALPR"
     gene            complement(718571..721666)
                     /locus_tag="LILAB_RS02940"
                     /old_locus_tag="LILAB_03010"
     CDS             complement(718571..721666)
                     /locus_tag="LILAB_RS02940"
                     /old_locus_tag="LILAB_03010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine: L-methionine
                     S-methyltransferase"
                     /protein_id="WP_013935699.1"
                     /db_xref="GI:503701623"
                     /translation="MPTYPSTPREAFHLLRALSEDLSHVDRRPRALTELRELAELSRH
                     QPETAPLRLVSVTVSVGASQERLELFLLPSIFAPEAWAYTFLEGLLSVPLDEYSGKRL
                     VEVGAGSGWICIALAKFSRLAHVHGADLNPHSPVVARCNAWLNGDEALASRLSFGESD
                     LLRGVPSDAPWDFVVGCIPQVLRGEEDLPAELSQADEQALHDLSNYCTLQNVYEDHFG
                     LGLIARLLDEAPERLSPTGRLLLNLAGRPGRVIMERMFTRRGFDTHVRVARRVMQAAD
                     TDIRPLVALEQRTGREFEFFMEARSPEPLRAATALGWLQAGHPVWHEVAVWEARLALP
                     RETLALRAALRELGASALQEELDLGAASAEQLGFVADLAARLAKGPLMPYAHEAGDAS
                     FRQQVVRYLDRYFGLRLAEDEVFVAPEREQAVYSLLMATCDVGDEVLVSRNLHPLYAR
                     ALEKAGVRATVTHTSLAEIRRLLSAFNVKMVLLTVEKGERTNLSVLRDIVAEAARRGI
                     WVVLDESAFFNITGGVEPHTLFEFLAREAHAPNLVVLYGLIKNAVWPDLELTLLMPVP
                     PTLRGDLEAAAEVTYSRISTLAQAFYERTFADLLSFRISFAEPEAPAPRRPPVVALPR
                     SRRMERLMAFPAFAPKVFREDDAELVRLDYGENEGPLPPPLVEGLIAAGVAPREPAAQ
                     TGLAEAVSAFLLESRAVRYAPEEMAVAPGVWPLIHHLGVALRQRLGRTPRVYVTTPCY
                     GVLPPTFVSAGCDVEQGPLSGLLARRGQGGGAPDAIVVSQPSNPSGVYLAREELVALA
                     TYVVEQRCLLVSDEIFGLVNLTSPTAETVPSPVTLEGAVPGIGARTVVLGGLSKEFAA
                     GGLRVGWLATKDRALAAAVRDSGPGALHLMTARAAAYLYAAYARSPDGQLLYPARHRA
                     LRAFLVKMRRELAEKRELLAEALPGDGRSDAGDAGGLFLSPRVTAWLGQEVDGVRLTP
                     ENLPRVVYEHTHVVLNGGPWCGEPERVRAVFSIPRAALLRAREQLLRFGAKLREGPPK
                     A"
     gene            721860..722321
                     /locus_tag="LILAB_RS02945"
                     /old_locus_tag="LILAB_03015"
     CDS             721860..722321
                     /locus_tag="LILAB_RS02945"
                     /old_locus_tag="LILAB_03015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709150.1"
                     /db_xref="GI:760026018"
                     /translation="MSLMPVDGPRSGEGAVMEMNVSRPVLAGGFWKKKRTQPVKRARD
                     ASLVRWESQPWRRQLRDAAEYEHPVARAALVQALTAEGLTMDADAARFAGASEDQDCI
                     SIAQVLRFADSLVLRMALACTDDHVLQLAHLRRNAEDLAERMIEWANAGRL"
     gene            722348..723823
                     /locus_tag="LILAB_RS02950"
                     /old_locus_tag="LILAB_03020"
     CDS             722348..723823
                     /locus_tag="LILAB_RS02950"
                     /old_locus_tag="LILAB_03020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709151.1"
                     /db_xref="GI:760026019"
                     /translation="MQAGASHTQQPDTPCGAESFLTAWEPGCSHGDMLSSLVLAATLA
                     AAPAPRSAASAKTLVHVPKVDALTGLAAFLERAGQYAALLRPAAWRTELHPFLVIDPT
                     RPQSVSELGLDPAGPATVSMREDGRVSCMQVADAKLFQAKAAEAITAAGGAEPKPTTR
                     AGMTTVRVERDMGGSMGYALKGKEVCAFGATEGGGAALLKESVRLVGKAPAKDARMGK
                     LPGVAYVVSNNTVVGLDGTANALQVEALASKLPLPAFQARGTSPYAGTKPEGLLYSRA
                     SVSPTGMTQSVNTMRSTLQVVCPTCPKEQMVSMAKAVTKHLTGNLLVNMDHVQVRGSL
                     RSMATRFFAVRQAVAAELTDVAAVKAALAPLGKFPDAQVLEDGWKLPLKGGNVFVRIK
                     GKQLVLGNEESVTQATLAALSETGAKTEHAVDFSVDPKRVAGGLSQISLSDILSDELL
                     AGLFAASVELGPLLSRSERITGWVDPAPGGSQRGSLTWTLP"
     gene            723956..725935
                     /locus_tag="LILAB_RS02955"
                     /old_locus_tag="LILAB_03025"
     CDS             723956..725935
                     /locus_tag="LILAB_RS02955"
                     /old_locus_tag="LILAB_03025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_013935702.1"
                     /db_xref="GI:503701626"
                     /translation="MILFLPLGVDNTELERLPRVSITIAAICVVAFFISWVIPSEPMG
                     VGEEDLRSMLEQTLEHPDLQFPPACAERLLSDTGRRMVRNLRQNATPSDALESVENRQ
                     QALDEQCEELISRHESSLLSRFSLVPARGLVQPGWLTYMFLHFGWMHLLGNLLFFYAA
                     SLLLEDAWGRPLFAGLFVVGGLVAGIAHYAIDPASESVMVGASGAVAACMGAFCLRFA
                     RRHVRIGYFIWLLKIFRGTFPIPGWAWGGLWFGNEVLNYYLLGNNTGVAVMAHIGGFV
                     FGFASASLLRVTQLEERIVAPALAAKQGGWVADPRLAEAQSALDRGDRAAARAGFQRL
                     LKSQPDHTDALLALGHMDLEDGAAQAGMVRVERALHALAERASADALWFAMEPMVARL
                     PIDRLRPASAWKLAQALDTEDAPPAAVGTTEALYSVAGSGAGVIAVRALIRATELRLA
                     QHRQHKDLEQAAAYVARAKPLLTGEAAAEASRVEALDAEVTRKVNENAWRNRDVATTP
                     AVEAAPAPPRIFPCRIVGLTNMALTVEAANGQRRTLAMTEVLAIAVGMLPVAGPPGTP
                     PRQTVLTDLVLSWGSANEGPRVLRVNVAGLALNHFYPGVAPREAYARFLADMLERTSA
                     NALPDASSLKQGQYPRFNSEAELSQHFYGVSAAAA"
     gene            complement(725951..726319)
                     /locus_tag="LILAB_RS02960"
                     /old_locus_tag="LILAB_03030"
     CDS             complement(725951..726319)
                     /locus_tag="LILAB_RS02960"
                     /old_locus_tag="LILAB_03030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935703.1"
                     /db_xref="GI:503701627"
                     /translation="MAESIDWDPVRELARQVEAGEPLSLTSEVRDLLLRSAREVGIPE
                     EEAHASVSGVATATTLLLEVRRRIRDGSQRLMRALSGARRLRDMGDVAGARALLEEVL
                     AVEPVPLYREQAEFALEDLE"
     gene            complement(726324..726752)
                     /locus_tag="LILAB_RS02965"
     CDS             complement(726324..726752)
                     /locus_tag="LILAB_RS02965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043709153.1"
                     /db_xref="GI:760026021"
                     /translation="MENEPSLRGCSAWGPLAAVVLSALGCGGSAHSTAARQPVYLAQA
                     QCGPMDSTVSCCVKTHPATPERCGLTASEASRFLLPMKAVESASDATEEAVPEWKQVC
                     IDIYAQCKEQDWTGSCYDCFRYCEGQQEWPVDKCRRRKGE"
     gene            complement(726945..728102)
                     /locus_tag="LILAB_RS02970"
                     /old_locus_tag="LILAB_03040"
     CDS             complement(726945..728102)
                     /locus_tag="LILAB_RS02970"
                     /old_locus_tag="LILAB_03040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013935705.1"
                     /db_xref="GI:503701629"
                     /translation="MRAARGSFQIGSFRGIPVRVHFSLVLVLPLLAFLFGGAFRRAAE
                     VAEVAPERLSGSPALWGLAVAVGLFASVFVHELAHTVYALRRGGTVRSITLMMVGGVS
                     ELTEAPPRPRDEALMAAVGPLTSILLAVLLGGATWLLPREGSFNVQFALFYMASLNLF
                     LGVFNLLPAFPMDGGRIVRASLAGRLGLVRATQVASWLGRGFAVLFGVGAVLTLNPFL
                     AVIAFFIFMGAQGEAQQVRMKATLERVPVADLMTPRRVGVDAGASLEQALWDLRRERL
                     LLLPVTEDGRPVGQVALETVRAVPDAERMTRTAREVMVPAVAVRLDEDGWTALRRMAE
                     EEMPQLVVVEADGALAGTLDVNDVQRGMSLYQAREERAGQQERRWRQERPA"
     gene            728190..729041
                     /locus_tag="LILAB_RS02975"
                     /old_locus_tag="LILAB_03045"
     CDS             728190..729041
                     /locus_tag="LILAB_RS02975"
                     /old_locus_tag="LILAB_03045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709155.1"
                     /db_xref="GI:760026023"
                     /translation="MSAPRPSGCPPASTAADAPSRPGASRLRWARRPQRPPRLGGTMW
                     NPVAYAWTAWRMARAIRDPEELQDVLGLAPVLAPPTAMRRLVERLMRHASAAQAFIER
                     PRVGLLHLAALRALPEHTLGRAFADHLEANRVDPHALPSLEAHTDEEYVRAHLLESHD
                     VWHVLTGFPTSVAGELGLQAFSLAQVGSPFALGVLAGGLTNTLLYAFSQREERMRAIV
                     RGWLLGQRARLLFGAPWRQMWESPLTEVRQRYGLDLAAVDAVLDDPMRPAMEARNPGS
                     ASAPQSC"
     gene            729051..730613
                     /locus_tag="LILAB_RS02980"
                     /old_locus_tag="LILAB_03050"
     CDS             729051..730613
                     /locus_tag="LILAB_RS02980"
                     /old_locus_tag="LILAB_03050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA carboxyltransferase"
                     /protein_id="WP_013935707.1"
                     /db_xref="GI:503701631"
                     /translation="MDQTPENDPLRARLEKMEKQAELGGGADRIAKQHEAGKLTARER
                     IDLLLDAGSFCELDKFVTHRSNEFGMGDKKIPGDGVVTGYGTVEGRKVFVFAQDFTVF
                     GGSLSGAYAQKICKIMDLATRVGAPVIGLNDSGGARIQEGVESLAGYADIFVRNTLAS
                     GVVPQISLIMGPCAGGAVYSPAITDFIMMVKDTSYMFITGPDVIKTVTHEEVSKEALG
                     GAVTHNQKSGVAHFAAENEQAAIVMTRELLSFLPSNNQEEAPVQPCEDDPFRAEESLK
                     TIVPANPNKPYDIKEVIKAIVDDKHFFEVQEHFAKNIVIGFARMNGRSVGVVANQPAV
                     LAGVLDIDASIKAARFVRFCDCFNIPLVTLVDVPGFLPGTDQEWGGIITHGAKLLYAY
                     AEATVPKVTVITRKAYGGAYDVMASKHIRADMNFAWPTAEIAVMGPEGAVNIIFRNEL
                     LKAKDAAAERAKLTADYREKFATPFKAAELGYIDEIIRPEETRAKLIRALELLKDKRQ
                     ENLPRKHGNIPL"
     gene            730733..731347
                     /locus_tag="LILAB_RS02985"
                     /old_locus_tag="LILAB_03055"
     CDS             730733..731347
                     /locus_tag="LILAB_RS02985"
                     /old_locus_tag="LILAB_03055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935708.1"
                     /db_xref="GI:503701632"
                     /translation="MSHRRLILFLSDVEGNLTALRQTLKRVCEAVDLATPEVKWVEPP
                     PEGLADAGWHAVELELPPAPGRKARKSEQPFLEEQLDAMSQAVAQDFRDRALGLFVDR
                     EHSYARSCISGPGRPSKAVEGEVLDVIRQAARWLDVETGMLARLFGGGNAARNLLAAA
                     VDFGNEPGRSGPPAPPEPDEDDRFVEAKLTQARAYMEQYLNARK"
     gene            731386..732903
                     /locus_tag="LILAB_RS02990"
                     /old_locus_tag="LILAB_03060"
     CDS             731386..732903
                     /locus_tag="LILAB_RS02990"
                     /old_locus_tag="LILAB_03060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935709.1"
                     /note="catalyzes the ATP-dependent carboxylation of a
                     covalently attached biotin and the transfer of the
                     carboxyl group to pyruvate forming oxaloacetate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="WP_013935709.1"
                     /db_xref="GI:503701633"
                     /translation="MPKIRKVLVANRGEIAIRVMRTCKELGIATVAVYSEADRSALHV
                     RTADQAIFVGPPPSRESYLVQQRILDAAKQAGADAIHPGYGFLSENASFVRACESAGL
                     TFIGPPASAMDSMGEKTRARANMIKAGVPVVPGTTEPIATVEEARAYVEKIGFPVMLK
                     AAGGGGGKGMRKVERMEDFESSWRSAKSEALNAFGNDAVYIEKYLEKPHHVEIQVFAD
                     QYGNTIHLNERECSAQRRHQKVVEETPSPILTPELRAKMGEVAVKAAKAVNYVGAGTV
                     EFLVDVHRNFYFLEMNTRLQVEHPVTEWVTGLDLVAMQIRAAEGEKLGLTEAPQPNGH
                     SIEVRVYAEDPSRNFMPSPGKITYLRVPGGPNVRDDSGVFPGYTVPNVYDPMISKLSV
                     WAPTRREAIARAQRALSEYVVKGITTNIRYLKAILANPEFIEGDYDTSFLTRQHDALL
                     GKEDPKLSEMALLAGVVHAYQRDQKRAKTLPGAGGGQGGGNGGVSPWKLALRTRR"
     gene            732928..733437
                     /locus_tag="LILAB_RS02995"
                     /old_locus_tag="LILAB_03065"
     CDS             732928..733437
                     /locus_tag="LILAB_RS02995"
                     /old_locus_tag="LILAB_03065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_013935710.1"
                     /db_xref="GI:503701634"
                     /translation="MRYFTKQQGQKEAVPVDLEPLGNDQFKITVGATTYQVDALALEH
                     GTLSMLVDGQSYNVEFEENGDEIGVLLRGQVNRIDVADERRLRLRAANAAFSVEGKQL
                     VTAPMPGKVVKVLVKVGDEVKEGQGLVVVEAMKMENELKSPKAGKVTELFAKEGTAVE
                     NNARLVVVE"
     gene            733523..734038
                     /locus_tag="LILAB_RS03000"
                     /old_locus_tag="LILAB_03070"
     CDS             733523..734038
                     /locus_tag="LILAB_RS03000"
                     /old_locus_tag="LILAB_03070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935711.1"
                     /db_xref="GI:503701635"
                     /translation="MEMLCTLRSATEAQRAALLQAPEALEAFLDDEEDFGDPKGSAFV
                     ELDIGEAWHGLQYLLTGTPWEGAAPLDFLVRGGEDVGDIPSDEGTARVFSPADVQALS
                     AALQRVTEKTLRARFDAPAMQAQDIYPGTWDEPEAEVDPLEELVSYFEELQKFVASVA
                     KRGEALLVHIG"
     gene            complement(734059..734835)
                     /locus_tag="LILAB_RS03005"
                     /old_locus_tag="LILAB_03075"
     CDS             complement(734059..734835)
                     /locus_tag="LILAB_RS03005"
                     /old_locus_tag="LILAB_03075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_043712338.1"
                     /db_xref="GI:760029289"
                     /translation="MDVDVSTLHLILLCLAALIAGMVDAIAGGGGLISLPALLAAGLP
                     PHVALGTNKGQSVFGSFAALVRFSRAGLVDGKLASVTFPFGLGGAFAGAALVLLVKPE
                     VLKPLVLVLLIAVAAFLAFRKPPRPGDTPEPGPPARARAIGALIALAIGTYDGFFGPG
                     TGTFLIVAFSSLLGHGLARASADAKVVNFASNLASVALFALKGVVLWKVALPMAGAQF
                     TGAWLGAHLAVKGGDRLVRKVVLGVVLALVLKLGHDVVTG"
     gene            734969..735781
                     /locus_tag="LILAB_RS03010"
                     /old_locus_tag="LILAB_03080"
     CDS             734969..735781
                     /locus_tag="LILAB_RS03010"
                     /old_locus_tag="LILAB_03080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935713.1"
                     /db_xref="GI:503701637"
                     /translation="MLASFLTVLALTLGSVPMPQDPSKPTCRAIDGKVSCGYGCKSDG
                     QRVRCSQTPQGHCQVLDGQVVCYDPPAYVQKAYGDALPKPECKNIDGVVACGYNCATQ
                     PGQVKCAKSPAGVCLGRGGNVECFDPPAVVFAVYGKDTPRAECHTNAVEMTCGYGCIN
                     APEGVRCARTPAGVCRKVNSNITCFDPTPAALCAWKRELPAPQCKNTEAGPVCGYNCT
                     TAFSKAACASTPDGLCKVFDSEVYCFDPPAEQKADAACLSALGLAALDGAAP"
     gene            735881..736447
                     /locus_tag="LILAB_RS03015"
                     /old_locus_tag="LILAB_03085"
     CDS             735881..736447
                     /locus_tag="LILAB_RS03015"
                     /old_locus_tag="LILAB_03085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PT repeat/DnaJ domain-containing protein"
                     /protein_id="WP_013935714.1"
                     /db_xref="GI:503701638"
                     /translation="MAEGEVRQYWVRNDRGTMWGPLTLPTIELLIESGSIQGRLQMSE
                     DGLNFAFPWRFPEAREVVPRELWGPGAPAVSAAEQAAQGAPGMAGPGGVPAAGPGAAP
                     RAGPGVSAATTPSAASSIFVRPSGTVTPMEQEASISTLRAREARRCSSRISRDTGSSG
                     STGERRKPPSPKLLRPPVITSPPPASST"
     gene            736872..738947
                     /locus_tag="LILAB_RS03020"
                     /old_locus_tag="LILAB_03090"
     CDS             736872..738947
                     /locus_tag="LILAB_RS03020"
                     /old_locus_tag="LILAB_03090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_013935715.1"
                     /db_xref="GI:503701639"
                     /translation="MAVPAVEGDDAAPEIPARGQLEQTSPIRLYGRIAAREQTGLLSL
                     TLPDRVIQIHFRKGNPEFVDSSHPEEALGPSLVAARLLTPEQLQQAEPALERFGGDLL
                     TALFGLGLLQPATAFTILAQRAGGILSRGLRAETGTFTFELKDLPSHKAMPLGHRWAV
                     LSDTVRRIPSTDLKRRLGSVLQLPIMKSGGVVAASELRLTPHEVRAHTVIDGVRSVAQ
                     LLTDFAQDADHLLRLAFLLKELDGVSFAGQARTAPGTPPPAEPPQAGAGAQRPVGPGV
                     AAQGASPRAPVGPQQAAGAPAAAAQRPVGAAPGAGANVAGGPQPSGVAPAAGTAPQRP
                     VVGAAPNVAGGAQPSGVAPAAGTAPQRPVVGAAPNVAGGAQPSGVAPAAGTAPQRPVV
                     GAAPGAAPNVAGGHPPAGAAPTAGPGAARPAGPGAPAARPPVAGPGAQPRPPPSLSAQ
                     RPAAPAAATPANAPGTDEIPALRQLTTAMKQQNHFQRLGLTEQTNSSAVKIAYFRLAK
                     LYHPDTLPPGAPPELEKLKAEVFAYIGDAYRTLSDDNSRASYIEELKSGGDGDGVDVN
                     GILMAEELFQKSCILVKARKFADAVKMLDEAIKLNPEEAEFYAWRGYARFFTAADKKA
                     AQPEAFREIQNAIKRNERCAPAHYFLGVIAKLSGDAPGSLKHFKRTVELQPDHIDAQR
                     EIRMASQKK"
     gene            738989..739279
                     /locus_tag="LILAB_RS03025"
                     /old_locus_tag="LILAB_03095"
     CDS             738989..739279
                     /locus_tag="LILAB_RS03025"
                     /old_locus_tag="LILAB_03095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_013935716.1"
                     /db_xref="GI:503701640"
                     /translation="MPLTGKQRRHLRALGHHLEPVVIVGQAGVTEGVIAAVEQALQDH
                     ELIKVKINEGPETRQEAAARIAEGTQAELAQLLGRTALFFKKRKKDSKFEKF"
     gene            complement(739287..740093)
                     /locus_tag="LILAB_RS03030"
                     /old_locus_tag="LILAB_03100"
     CDS             complement(739287..740093)
                     /locus_tag="LILAB_RS03030"
                     /old_locus_tag="LILAB_03100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015353413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935717.1"
                     /db_xref="GI:503701641"
                     /translation="MIQLPDRPLSRRATQQLARWQAEVDALASHAERSAAAKRLFKQR
                     NTARNQTFVEIRRQLTTMCSGAQRCGYCEDSAADEVEHIWPKDLYPEWVFAWRNYLYA
                     CGPCNGPKSSKFAIFPHRSRSPVEVSRAHRGAPKAPPKGMPALIDPRTEDPMAFLILD
                     LQGTFFFEPLGRTGTRDFARADYTRSLLRLNRELLSLARAEAFSAYRARLREYITLRD
                     EGASSLALRLHVTAIQRAAHPTVWREMQRQQRRLPALRALFRKAPEAMGW"
     gene            complement(<740129..741379)
                     /locus_tag="LILAB_RS03035"
     CDS             complement(<740129..741379)
                     /locus_tag="LILAB_RS03035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935718.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712340.1"
                     /db_xref="GI:760029291"
                     /translation="MYLTRVNIENVRAIRKLAWEISPKQAPGWHVILGDNGAGKSSVL
                     RCIALALLGPYEATGLRQDWSGWKRGDSASEVDLELVADPKFDRVPGKSPGSRTRKLQ
                     VGAQLTAPMGPGWMSTGPARLLGSPVWECKPGWFSAAFGPFRRFTGGNEDYEKLFDAY
                     PRLARHLSVFDESVALTEGLKWLQRLQFKKLEKDPDGALLEPLTRFINQPEFLPHQAR
                     LEKITSRQVLFVDGNGYRVPIEELSDGYRSTLSMTFELIRQLADCYGAKKVFDPKDPT
                     CVNVPGVVLIDEVDAHLHPTWQRKVGHWFRKHFPKMQFIVTTHSPLVCQAADEGSVWR
                     LPRPGTNEEARQVTGVELDRLIFGNVLDAYGTGVFGEGVTRSERAKERLQRLSELNVK
                     ELRKGLSAAERKEQSALRASQPTAA"
     gene            complement(741527..742837)
                     /locus_tag="LILAB_RS03040"
                     /old_locus_tag="LILAB_03110"
     CDS             complement(741527..742837)
                     /locus_tag="LILAB_RS03040"
                     /old_locus_tag="LILAB_03110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709157.1"
                     /db_xref="GI:760026025"
                     /translation="MASSRLARWRSLFPLVLLTVGTAYALASWNWCGSWAERAPVLVS
                     QVHGEGPLRAGAAKVALAPPFPVVVAGYNPPRPDATEADVPLHARAVVLEAGGTRVGL
                     VSLDLLLVPDVLAARVRERARASGLEDVLVLATHTHSSLGGYDSRLVAQLSGTGRYRE
                     DVVDVITVAAGDALAQAAASLVPVSLEVGEARNQDFVISRSGGAKPEGVLTRAVLRGA
                     EGPVAELLLYAAHPAMVPRRRAFLDPDYPGRLSALREDAGSGVTLLLQGAGGNVSVAY
                     SEGKAMERVSGFARALSELASDASVSPVGETVRLSLARADAAMPRPDASRLVPALTRA
                     AGDNLLCESAPRLAEVGALALGPLKLVAVPGEPSVAAGAELLRRTGATGVLGLADGYV
                     GYVETAANVEGGLGESRRQYFGPALLERLSVAAEFVAGAAGFTP"
     gene            742982..744370
                     /locus_tag="LILAB_RS03045"
                     /old_locus_tag="LILAB_03115"
     CDS             742982..744370
                     /locus_tag="LILAB_RS03045"
                     /old_locus_tag="LILAB_03115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_013935720.1"
                     /db_xref="GI:503701644"
                     /translation="MCGIFGIVGHAEASNLTYLGLHALQHRGQESAGIVASDGLALRA
                     HRQMGLVADIFDAPVLAGLPGQAAIGHVRYSTAGGSALKNAQPLFVQYAGGQCAIAHN
                     GNLVNAAELKQQLEADGAIFQSDADTEVILHLLARSRQPTFEQKIVEALRKVTGAYSL
                     LVLTEDKLVAVRDPHGIRPLVLGRMKEGAYVLASESTALDLIEAEIVRELEAGELLVI
                     ENGLMRTSKPFAEPPRQARCIFEHVYFARPDSTLFGSNVYEVRKELGRQLAKEQPAPD
                     ADLVIAVPDSGVPAAIGFAQASGIPYDVGLIRSHYVGRTFIEPQQSIRHFGVKLKLSA
                     VRQVLKGKRVVVVDDSIVRGTTSRKIVKMIKAAGALEVHLRISSPPTKWPCYYGIDTP
                     SRQELIAATHSLEEIATYVTADSLGYISQEGLGRAVGDPERGSFCTACFSGKYLVGEF
                     GAERAEPSKLTA"
     gene            complement(744438..745430)
                     /locus_tag="LILAB_RS03050"
                     /old_locus_tag="LILAB_03120"
     CDS             complement(744438..745430)
                     /locus_tag="LILAB_RS03050"
                     /old_locus_tag="LILAB_03120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_013935721.1"
                     /db_xref="GI:503701645"
                     /translation="MHRTPQEEAPEGYVDIHYVVEPNYAGWRLDAYLEQKLRRMTRER
                     LQGVILRGVICDEKRLKPSTPVYPGLAFRLRRRASEEPETPTELPVVFQDDWLLVLDK
                     PAGLPIHPTARYHKGTLVTLLRERFGERFAEPAHRLDRETSGLVVCGRTTESCRVLGR
                     LFVSREVHKEYLALCEGHPPEDTFTVEAPIAEGTELIRIAVRIDPVEGKESRTRFQVL
                     QRFTRDGAPFALLRCFPETGRQHQIRIHLHHAGFPLVGDKMYGPDPGYFDRFSKRCLE
                     PEAWPRLRLPRQALHAARIAFPHPGSGEAVVFEAPLPADLTDFIEGRPVALPAA"
     gene            complement(745534..746664)
                     /locus_tag="LILAB_RS03055"
                     /old_locus_tag="LILAB_03125"
     CDS             complement(745534..746664)
                     /locus_tag="LILAB_RS03055"
                     /old_locus_tag="LILAB_03125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_013935722.1"
                     /db_xref="GI:503701646"
                     /translation="MKKVIHIVGARPNFMKVAPIYRAIAERTPLEQILVHTGQHYDAK
                     MSDVFFADLGLPAPDVHLGIGSGSHAQQTARMMVELEKVFLAHPPALVSVVGDVNSTV
                     AAALVTSKLSIPLAHVEAGLRSYSPHQPEEINRLVTDRLSDLLLTPSRDADANLLKEG
                     TDPTRIHFVGNVMIDSLFASREKADKLPVLKDLGLIPHGYAVCTLHRPSNVDDPKLLD
                     GLLSAVAHVATRLPVIFPVHPRTRKVISEQGLDSWFAQSPNLRPVDPMGYLEFLALTS
                     KARLVLTDSGGLQEETTAMGIPCLTLREQTERPITVEEGSNEVVGTDPVRIRMAADRV
                     LNGEGKQGRVPEFWDGRAAERIADLFASFLGVEDAPIQAASA"
     gene            746772..747512
                     /locus_tag="LILAB_RS03060"
                     /old_locus_tag="LILAB_03130"
     CDS             746772..747512
                     /locus_tag="LILAB_RS03060"
                     /old_locus_tag="LILAB_03130"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DDB3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="WP_043709159.1"
                     /db_xref="GI:760026027"
                     /translation="MQSCRTVAVIPARHASTRFPGKPLAIIAGRTMIEHVWRRCQEAH
                     AFDEVWVATDDDRIRAAVEGFGGKAVMTRPTCATGTDRVAEVALGRPDVDIWVNVQGD
                     EPLVAPAALQRLAGLFQDASVRMGTLVRPLEADEAASPHVVKAVLALNGDALYFSRGL
                     VPHLREPGAHVQRWGHIGLYGYRRDVLLSLAKLAPTPLEEAEKLEQLRALEHGIPIRC
                     AQVTSHTVAVDVPGDVEKVEALIRARGG"
     gene            747515..748420
                     /locus_tag="LILAB_RS03065"
                     /old_locus_tag="LILAB_03135"
     CDS             747515..748420
                     /locus_tag="LILAB_RS03065"
                     /old_locus_tag="LILAB_03135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935724.1"
                     /db_xref="GI:503701648"
                     /translation="MGFLKNVFGGGEAKADAESPAPPDGAPTAPAGAAPPVDARPDAP
                     VAPPRPEAVPKPSAPPKPRHAQETRRQQQEDEDMEGVQRLLSRKVERVLEQLGTLATR
                     ARSGEEVPTLTVTLHLSQGHSLTGEVVDYVARESVLLALGKEGLRRSESVAYVDVSTV
                     VAVAVGNAEKLLELAQLVRPNPTRQDLVALLEKLPHALTEQFWPGEASLGGKPLRFEV
                     DWVGLDDEPGRRALESAVNVTSHALRALAQEQGREVLRRITTVRFLRGKDTRAAVEGE
                     TGTVTVGPGEPTVSAFRKAFAAGLR"
     gene            complement(748413..749261)
                     /locus_tag="LILAB_RS03070"
                     /old_locus_tag="LILAB_03140"
     CDS             complement(748413..749261)
                     /locus_tag="LILAB_RS03070"
                     /old_locus_tag="LILAB_03140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935725.1"
                     /db_xref="GI:503701649"
                     /translation="MEQREFGSTRVSVPSLGQGTWQMEEDDRASAIRALRAGLDLGMT
                     HVDTAELYGHGKVEESIVSEAIAGRRDDVFLVSKVMPSNATYAGTLAACERSLKRLRT
                     DRLDCYLLHWPGSHPLEETVRAFEKLVADGKIRAWGVSNFGVEDLEEALAIAGPGRIA
                     CNQVLYHLEERAIEHGVLPWCEAHGVAVVGYSPFGNGRFPKPGSRGGKVLGAMAQAHG
                     VTPYQVALRFLVRRPSLFAIPKASREAHARDNAAAASLTLTPDELAHLDAAFPLGPEP
                     ASLPVI"
     gene            749371..751137
                     /locus_tag="LILAB_RS03075"
                     /old_locus_tag="LILAB_03145"
     CDS             749371..751137
                     /locus_tag="LILAB_RS03075"
                     /old_locus_tag="LILAB_03145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013935726.1"
                     /db_xref="GI:503701650"
                     /translation="MSSPANDSKSSAAAGVTFRRLLTLARPELLPLAAGTFFLLISSL
                     ATLAYPRAIGDLVDQALNARDRDVVDRVAILMLVVFVVQGIAMALRIYLFNTAGERVV
                     SRLRKDLFRALLSQEVGFFDTRRTGELTSRLSSDTTVLQNTVTTNVSMILRYGVTALG
                     GVGLLLYTSVQLTLVMLAVIPPVAIGGVFYGRRVRVISRQAQDALAASGEVAEEDLSG
                     IRTVRSFAAERHEVERYSVAVERSFTLAKKRALQSSIFMGVASIAGYGSIAAVLWFGG
                     RLVVDGGLSVGELTSFLIYTMLVAFSFSGIAELWADFMRASGAAERVFELLDRAPAIG
                     AGGEQLTDLRGHVRFRGVHFAYPTRPDVPVLQGLDLELRPGEVVAVVGPSGAGKSTLA
                     SLLSRFYDPRAGEVLLDGHPLTALEPEWLRRNIGMVAQEPQLFSCSIADNIRYGRPDA
                     TDAQVEEAARAANAHAYIERFPDGYNTQVGERGVQLSGGQKQRVAIARAVLKDPRLLI
                     LDEATSALDAESEHLVKDALERLMKGRTTLIIAHRLSTVANADRVLVLDGGAVIQSGT
                     HASLMSQEGLYRRLVERQFVAA"
     gene            751446..751679
                     /locus_tag="LILAB_RS03080"
                     /old_locus_tag="LILAB_03150"
     CDS             751446..751679
                     /locus_tag="LILAB_RS03080"
                     /old_locus_tag="LILAB_03150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935727.1"
                     /db_xref="GI:503701651"
                     /translation="MSITPCPSPLPTALRDEESVDSQRNLFCPNYDACLHLVVKRGWE
                     GWSCRNCDLRKFRVGQPTAQEFAVARPGGWDGN"
     gene            751765..753405
                     /gene="pyrG"
                     /locus_tag="LILAB_RS03085"
                     /old_locus_tag="LILAB_03155"
     CDS             751765..753405
                     /gene="pyrG"
                     /locus_tag="LILAB_RS03085"
                     /old_locus_tag="LILAB_03155"
                     /EC_number="6.3.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935728.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_013935728.1"
                     /db_xref="GI:503701652"
                     /translation="MRSKKTKFIFVTGGVVSSLGKGLASASIGALLENRGLAVTLIKL
                     DPYINVDPGTMSPFQHGEVFVTEDGGETDMDLGHYERFTNARMSRLNNFTSGRIYHAV
                     IMKERRGEYLGKTVQVIPHVTDEIKSSIRQAAQDADVVIVEVGGTVGDIESLPFLEAI
                     RQMRYDVGSENVVYVHLTLLPYIGAAGEVKTKPTQHSVMKLREIGIQPDFLVCRTDRE
                     VSREMKDKIAMFCNVDTRSVFTSPDVRSIYELPLELHRQGLDERLAEVLNIWSRAPHL
                     ERWENIIRKVYEPARGQVRVAIVGKYVNLTESYKSLNEALLHGGIANDVKVNLHFVDS
                     QEVEEQGAEKMLAGVDAILVPGGFGVRGTEGKIAAVRYAREKKVPFFGICLGLQMAVV
                     EFSRGVLGLANANSLEFNEHTPHPVVTLMESQVKVQDKGGTMRLGSYACALQPGTRAH
                     QLYGQDTIQERHRHRYEVNNAYRGKLQAAGLVISGANPELNLVEMIELADHPYFVGCQ
                     FHPEFKSKPFAPHPLFSGFIRAALAQRDANAAAGQVSA"
     gene            753402..754238
                     /locus_tag="LILAB_RS03090"
                     /old_locus_tag="LILAB_03160"
     CDS             753402..754238
                     /locus_tag="LILAB_RS03090"
                     /old_locus_tag="LILAB_03160"
                     /EC_number="2.5.1.55"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphooctonate aldolase"
                     /protein_id="WP_013935729.1"
                     /db_xref="GI:503701653"
                     /translation="MSAPNPIELCGFKVGQGQKLFVIAGPDSIESEDMALRHARLLKE
                     ITGRLGVPYAFKCSYDKANRTSGKSFRGPGLKEGLRILKRIRDEVGVPVLTDVHETSH
                     VGPASEVVDIIQIPAFLCRQTDLVEAVARTGKGVNLKKGQFVAPKDIVHSARKAFEAG
                     NPNVLVTERGSTFGYNNLVVDMRGFAQMRDAGLAVCFDATHSVQLPSAGNGETAGERR
                     FVSLLARSAAAAGIDALFTEVHEDPDRALCDGPCSLNPQMFEDVVRNVLSIRRVLGHE
                     PG"
     gene            754270..754845
                     /locus_tag="LILAB_RS03095"
                     /old_locus_tag="LILAB_03165"
     CDS             754270..754845
                     /locus_tag="LILAB_RS03095"
                     /old_locus_tag="LILAB_03165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="WP_013935730.1"
                     /db_xref="GI:503701654"
                     /translation="MVTDAPSRLGTEELTSRAARVRLLVFDVDGVLTDGGLYYGQDGE
                     LMKRFDVKDGHALVMARLSGLPAAILTARTSGIVEKRGRELGLAAVFQGRRDKSAALK
                     ELVTQLDVPLDACAYMGDDHNDLGPLSMVALSACPADAVPEVRREAHFVTQSPGGRGA
                     ARELVELCLKASGRWDDAVGLMKGSDRRGTQ"
     gene            754886..755506
                     /locus_tag="LILAB_RS03100"
                     /old_locus_tag="LILAB_03170"
     CDS             754886..755506
                     /locus_tag="LILAB_RS03100"
                     /old_locus_tag="LILAB_03170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_020478919.1"
                     /db_xref="GI:521967314"
                     /translation="MGSGIMQQEGSTAMTDQLYTTHDISRLLQVDPSTVSKWIDRGIL
                     MAFRTPGGHRRVRSADLRTFLITHQMPVPEELGSGTVRLLAVDDERPVLDAIKRAFKP
                     FAAQVELQTTTSGVEALLLVSEQKPHGMIIDLNMPDIDGLEVCRRIRARKQMEGVRLI
                     TMTSAHTPEVVEQSKQAGALACMAKPLDVQQVLELFRVPLALSAKR"
     gene            complement(755604..756047)
                     /locus_tag="LILAB_RS03105"
                     /old_locus_tag="LILAB_03175"
     CDS             complement(755604..756047)
                     /locus_tag="LILAB_RS03105"
                     /old_locus_tag="LILAB_03175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002635141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935732.1"
                     /db_xref="GI:503701656"
                     /translation="MQTRNPFNSAVVVNPLMRDVDALFRELTQPMWRQAPRERTPAAD
                     IFESESGLTLQLDMPGLDAKSIQVTVEKDILTVQAERKAEPRAEGVNVRRQERAFGTF
                     ARSFALPDTVDASRVEARYEQGVLTLTLPRREETRPRVIEVKVQG"
     gene            complement(756262..756456)
                     /locus_tag="LILAB_RS03110"
                     /old_locus_tag="LILAB_03180"
     CDS             complement(756262..756456)
                     /locus_tag="LILAB_RS03110"
                     /old_locus_tag="LILAB_03180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935733.1"
                     /db_xref="GI:503701657"
                     /translation="MQPFAEAAAQLCPYCGEEVEVAVDPIGVSSETYIEDCPVCCRPW
                     TVQVSRDGEGFTVNLGRDDD"
     gene            756517..757362
                     /locus_tag="LILAB_RS03115"
                     /old_locus_tag="LILAB_03185"
     CDS             756517..757362
                     /locus_tag="LILAB_RS03115"
                     /old_locus_tag="LILAB_03185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein E"
                     /protein_id="WP_013935734.1"
                     /db_xref="GI:503701658"
                     /translation="MAPPSRNRIGDILVKARVIDDLQLRSALATHDQWGGRLSRIIAD
                     LGLATDDVITEAICQGLGMQRIQLGNVTRDAGALSRVDVSLAEQKAVFPVSLKDNGKT
                     LVLAMADPTDLATLDQVAAKSRARVVVMVAGEREIEHAILRHYRGQEPVVSTRFGGNK
                     RPSSSDAPEDEDEFKVVDMSGNTVVKRIADITPPAPAAPPPAPRAPERAPAPAANASA
                     SDILDEILAGGTPASEWTDEDLKRLQTVQQNQEKSSKILRALLELLLEKGQLQQRELA
                     ARMRL"
     gene            complement(757371..758579)
                     /locus_tag="LILAB_RS03120"
                     /old_locus_tag="LILAB_03190"
     CDS             complement(757371..758579)
                     /locus_tag="LILAB_RS03120"
                     /old_locus_tag="LILAB_03190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_013935735.1"
                     /db_xref="GI:503701659"
                     /translation="MSVPPSENVLITVTGKDHPGIVSRLTGLLAEAGAGLLDVEQVVV
                     QGRLTLCLLVRLPPAGGVLEALLAAATSLGVALDFQAVEADAAPLAESPASRHVVTAV
                     GRTLGARELHALTQVLAGHGANVARITRLSEPHLGSVDLHIRLPPGQPPDALKHALLE
                     LSMQSGAFDVALQRESLFRRGKRMVVMDMDSTLIRIEVIDELARAHGVGAQVARITER
                     AMHGEMDYDESLRQRVGLLKGLDASAVHQLAANLPLTEGAQTLVRVLKRLGYRTAVIS
                     GGFSVAAEALKTRLGIDFAYSNVLEIQDGKLTGRTVGPIVNARRKAELLESLARAEGI
                     LLDQVVAVGDGANDLLMLERAGLGIAFRAKPRLRAAADTSISAGGLDSILYLLGLSGR
                     ELLEAGAGAG"
     gene            complement(758654..760243)
                     /locus_tag="LILAB_RS03125"
                     /old_locus_tag="LILAB_03195"
     CDS             complement(758654..760243)
                     /locus_tag="LILAB_RS03125"
                     /old_locus_tag="LILAB_03195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013935736.1"
                     /db_xref="GI:503701660"
                     /translation="MQKPALNRDTVSGEALFILRNLRENGRLGRSNKLADVKAALEPS
                     VSLEFDNYFFFLRKFHYIAMDREAQLKLTDQGEQVAGGELTERFSLEVGEFFADQLSA
                     VTADAPGDGAGGDEPLMVPPPPPELLLDEAEVDGAPPEPAGPPAPPPPMPPVRSSRSA
                     MPALDLGAPPAPIPMPPPSAPAPRAEAPAAEPRRESTVIVQGPFTASTPAAPSPTPPA
                     PAAAPMPPPSAPAPTAAAAPAAPAPKGAELDARYQKFDPIGTGPLGTVFKGRVTALGL
                     DICLKELKDIFGYFSFLQRSEVLKRLKKELCAQAQVRHPGVVQVVDQNVEAARPYFVL
                     ELMQGSLRERLDAGGGSGVPVPFALRAFLQMAYGLRAAHAAGLTHHNIKPENVLFDAY
                     GNARLADFGLGRVVEVDATKGMPQVFVGTGGMSYMAPELLNRGGKEPGASADVYALGI
                     LLYEMLTGQIPGRRSPLPSEVNPEAPSGLDQLFDRATQDKREQRYPDVDAMLEDFYTA
                     FPDKEFLAKGDLIVSSDAPKE"
     gene            complement(760312..761061)
                     /locus_tag="LILAB_RS03130"
                     /old_locus_tag="LILAB_03200"
     CDS             complement(760312..761061)
                     /locus_tag="LILAB_RS03130"
                     /old_locus_tag="LILAB_03200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_013935737.1"
                     /db_xref="GI:503701661"
                     /translation="MNPGPEDKRQHPRVPAVLRVDYTDGRQARDVTENLSHEGLFVQT
                     DQVFRLGDEVRLALSFPGLLDPVEVSGTVAWTRPAGPDQPGGVGVRVEREQDRRKLGD
                     ILSAAGADSHASHAEHEGYRVLIVEDNPHIIEMYSYVLKKLASGELHGKVPLEVHFAP
                     DGHHALLMLREDRFNLVMTDLYMPVMDGFALVERMREEEALRAIPIIAISAGGKEAQD
                     RAMQLGVDIYLRKPVRFVEVLETVKQLLRIK"
     gene            761167..761655
                     /locus_tag="LILAB_RS03135"
                     /old_locus_tag="LILAB_03205"
     CDS             761167..761655
                     /locus_tag="LILAB_RS03135"
                     /old_locus_tag="LILAB_03205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015346740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit E"
                     /protein_id="WP_013935738.1"
                     /db_xref="GI:503701662"
                     /translation="MAEPLFTSEEQKKFDAGIAEIISHYPPDRKSAGMLPALRLLQEI
                     KGWLPPEGLRLVAKHLEVTPERAMEVASFYVMYHLKKPGKYVIDVCTNLSCSLWGAEK
                     MLAYLEEKLGLKAGEANEKFTLRETECLASCGTAPCLQINEDHHESLTQAKLDAILAR
                     LS"
     gene            761693..763033
                     /locus_tag="LILAB_RS03140"
                     /old_locus_tag="LILAB_03210"
     CDS             761693..763033
                     /locus_tag="LILAB_RS03140"
                     /old_locus_tag="LILAB_03210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638446.1"
                     /note="part of NADH-ubiquinone oxidoreductase complex I;
                     shuttles electrons from NADH, via FMN and iron-sulfur
                     (Fe-S) centers, to quinones in the respiratory chain; NuoF
                     is part of the soluble NADH dehydrogenase fragment, which
                     represents the electron input part of NADH dehydrogenase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_013935739.1"
                     /db_xref="GI:503701663"
                     /translation="MASTAKAIEPIISAAWGKPQSWTLDSYRKRGGYEALKKALQMEP
                     AAIIDEVKKSNLRGRGGAGFPTGLKWSFVPKDSPKPKYLAVNGDESEPGTFKDRYILE
                     DDPHMMLEGIAIASYALGVHTCYVYLRGEFKFPAERTQAAIDEAYKAGIFGKKVLGKD
                     YELNCYLVRGAGAYICGEETALLESLEGKKGWPRLKPPFPAVVGLFGCPTVVNNVETL
                     ASVPAIFQQGAEAYAKLGTDKSGGTRLVCLSGTVNRPGVYEVSMFTTLSELIFDDKYG
                     RGMPAGRKVKAVIPGGSSAPVLGADELDVAMEFEALKVKQTMAGSGGVIVMDDATCMV
                     RSLWRVARFYAEESCGQCTPCREGTPWQTRLLRKIEEGRGEPGDIDMLSNVASSIAPY
                     PPIGLGNTICALGDAAALPTHSFLMRFRDEFEAHIREHRCPFGDKPWGSFGDWS"
     gene            763030..763536
                     /locus_tag="LILAB_RS03145"
                     /old_locus_tag="LILAB_03215"
     CDS             763030..763536
                     /locus_tag="LILAB_RS03145"
                     /old_locus_tag="LILAB_03215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone oxidoreductase subunit 6"
                     /protein_id="WP_013935740.1"
                     /db_xref="GI:503701664"
                     /translation="MNIELILFGAFALLTLLSAGTVIFARSPINSAMALVSTFFFLAG
                     IYVLLWAHTVAVMQVLVYAGAIMVLFLFVIMLLNLGESPTRGKPTLARIAGGAATVGL
                     FAVLAIILLKLPAAPATLSAGTQASFGTIATMGQVIFTQWLLPFEAVSLLLLVAMVGA
                     VVVAKSRI"
     gene            763610..763912
                     /locus_tag="LILAB_RS03150"
                     /old_locus_tag="LILAB_03220"
     CDS             763610..763912
                     /locus_tag="LILAB_RS03150"
                     /old_locus_tag="LILAB_03220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone oxidoreductase subunit K"
                     /protein_id="WP_002638444.1"
                     /db_xref="GI:488714568"
                     /translation="MVPITYYLLLAAALFCMGMFGVLVRRNALVIFMCVELMLNAANL
                     TFVAFARMRGDDLGHVSAFFVIAVAAAEAAIGLAIVIAVFRSRGSVLVEDIRTMKH"
     gene            763932..766160
                     /locus_tag="LILAB_RS03155"
                     /old_locus_tag="LILAB_03225"
     CDS             763932..766160
                     /locus_tag="LILAB_RS03155"
                     /old_locus_tag="LILAB_03225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit L"
                     /protein_id="WP_013935741.1"
                     /db_xref="GI:503701665"
                     /translation="MTLVEFFRAAPVAPDILAPSLWLIIALPLLGAFICGVFGKMLGR
                     ANVQLIACATVAGSFALSVLAFWATSHHNPETGRLAALFPNPFGIERDFVRYALAYDY
                     GTWFSVGDFRVNFGLMVDHLSGILLLIITGVGFLIHLYSTSYMEHDAAYWRFFAYLNL
                     FVAAMLTLVLADNLILLFVGWEGVGMASYLLIGFWYDDPAKAWAGRKAFVTNRIGDFA
                     FLIATFLLVLLVSAFTQQSNAADYNNAGTTSQHYKAALAKKGPVTFKGLEKMAEGLVG
                     TNADKVNLSTPIEAGPLEGYTFGGVMTAAMLLFLLGAAGKSAQLPLYVWLPDAMAGPT
                     PVSALIHAATMVTAGVYLFSRMSALLVLSPTAMATIAIIGALTSLLAALIAFAQDDIK
                     KVLAYSTVSQLGIMFMGVGMGIFWAAVFHLMTHAFFKACLFLGAGSVMHGNGDETDIK
                     KLGGLRKEMPWTWATFAVATLAITGIFPLSGFFSKDAILHGVHHNHLQGLEWVSSLVY
                     YLGLLIAASTAFYMTRCYLLTFEGPRSKEAKVAHAHESAWQMTLPLVVLAVLSVVAAR
                     YAFGINFFDMTAQPVLDNFLSPVFSATRRITDASTLVQLDTSRPQVVPDYLKAWAVAL
                     AGGGLAFYMYRVFFPARVGQPVPAYARAVRRAAQNKFYVDELYELIVIRPVKFASFLL
                     FRVVDALVIDTVAVRGTAWVTARMGSALRYVQSGDAQAYAAVMAIALLGGVVYALIQV
                     MQ"
     gene            766157..767884
                     /locus_tag="LILAB_RS03160"
                     /old_locus_tag="LILAB_03230"
     CDS             766157..767884
                     /locus_tag="LILAB_RS03160"
                     /old_locus_tag="LILAB_03230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone oxidoreductase subunit M"
                     /protein_id="WP_013935742.1"
                     /db_xref="GI:503701666"
                     /translation="MSFLDTHLLNIVVFLPLLFAALVALLPASENGQIRTVTFIAMAL
                     DLVFGVWAYMAYVPGGAEFQLEYRARWFDLFGTSYHIGVDGLAVSLLLLTVFLGPLVV
                     LASTTYIKFRIKEFHLALLVLQTTMLGALVSLDVLLFYIFFEAMLIPMYLLVGVWGAE
                     DRQMAAVKFFLYTLAGSLLMLVAIIAVYFISSPVGARSFDYASIYNGLLDANRQLSAC
                     TAAGSCDSLTGLAATLHTWGPWLFAAFAIAFAVKVPMWPLHTWLPDAHVQAPVAGSMI
                     LAGVTLKMGTFGFWRYAIPFFPVATQQARPFLATLAVIGIVYGALMCLAQRDIKKLIA
                     YSSVSHLGYCMLGILAITAEGATGSAYQMLNHGVSTGALFLLFGYLYERRHSRLMADY
                     GGIAKVMPVFTAAFVIITFSSIAVPGTNGFIGEFLVLLGTFKSDLGEAAGNPHLTAVF
                     GAFATLGVILGAAYMLWMVQKVFFGGLTHRENQHLTDMNLREGLTVLPFIVLVAVMGL
                     QPQPFLDRLAPSTDRFLARARVGTPGATVQEDQLRVEVMSLPSRQVVAAPSAPVPLAA
                     APAVPSPRQ"
     gene            767903..769462
                     /locus_tag="LILAB_RS03165"
                     /old_locus_tag="LILAB_03235"
     CDS             767903..769462
                     /locus_tag="LILAB_RS03165"
                     /old_locus_tag="LILAB_03235"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DDD3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase subunit N"
                     /protein_id="WP_013935743.1"
                     /db_xref="GI:503701667"
                     /translation="MNLPNLTLADFLPLLPTIIMVVGASILLLSEVFLSATASRAYQA
                     VLTVVTAVAAGAMALSTMFEPPQEVMLGFGVLDPFSSFLTFVVCVGLALATLSSVSFL
                     RKRGAERGEFYALMLFATAGMSLLAMSNELITLFINIEVLSIATYALTSYLRRGTRPS
                     EAGFKYFILGAFSSAVLLYGAALLYGATGTTHLTAMAGPLSTAMASQPGLVYAGLILV
                     GAGFAFKVAAVPFHMWTPDVYEGAPTPVTALMSAGVKAAAFAAMVRVFFMAGKGVDPQ
                     MLLGLFSVLAFLTMVAGNLLAIPQRNVKRMLAYSSIAHAGYLLVGVAALFVTGPGEQF
                     RLLGASALTGGTPLDLARAEALRGILYYLLAYTFSAVGAFAIVSVLERREDEEKGTAW
                     DLERFSGLAQRKPGWAFAMAAFMLSLGGIPPTIGFMSKLLIFQAAVDAGLIGLAIVGV
                     LSSAAGVYYYLRVVVYMFMRPVPEGAQALEKSWSTELALVLSTAAVVILGIIPGPVMA
                     WLEQASSIFGQ"
     gene            complement(769527..770369)
                     /locus_tag="LILAB_RS03170"
                     /old_locus_tag="LILAB_03240"
     CDS             complement(769527..770369)
                     /locus_tag="LILAB_RS03170"
                     /old_locus_tag="LILAB_03240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_043709163.1"
                     /db_xref="GI:760026031"
                     /translation="MGPQESQWVLRPGRPEDHAVFARLFLELGVDDPPPSAPVWAAEI
                     AGTSLFAEGPRGVGAYAVTKALGDFGFVLQLVVAPSVRGQGLGRRMMSHLASHLRAQG
                     CTRWGLNVKRDNVPALSLYTSMGMQPAREAATLRLTRAHLASLPAASPEGAVVPVLPE
                     DRGPLTEAFGMVPGKLESFAALDSHRLSGLVDAQAPARRWLGVMDLRASAGPLLFPFF
                     AVSAAHARTLLEAAFEQLGEGASSLNVVVTDDAPLVRLLREAGAQTRLETLELRGPLT
                     DAAR"
     gene            complement(770785..772176)
                     /locus_tag="LILAB_RS03175"
                     /old_locus_tag="LILAB_03245"
     CDS             complement(770785..772176)
                     /locus_tag="LILAB_RS03175"
                     /old_locus_tag="LILAB_03245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_013935745.1"
                     /db_xref="GI:503701669"
                     /translation="MDDQRNMRATTALLLRAENYTVFEAATGEEALAQLASGSIDLLL
                     TDLKMEPMDGLTLLRRALEVAPRLQVIMMTAFGSIESAVEAMRLGAYDYVTKPFKESE
                     LRYRVERARLLRDVDNLTTDFNQRHGLSALVGRSAAMRELTTRLMRVAQSDATVLIQG
                     ESGTGKELVARALHAHSRRKARSFVPVNCAAISESLLESELFGHAKGAFTGAVKARRG
                     LFEEADGGTLFIDEVTETSPTFQSKLLRALQEGEVRRVGESTALRVDVRIVAATNRDI
                     ELEVRDKRFRQDLYYRLNVVALRVPPLRERLEDVPALAEHFLERANARSPNPKRLSAA
                     AVAHLMSYGFPGNVRELENLVEQAAALAEGDELLPEDFPLRQGRMTPAHGTPSVAFLD
                     GQGGGAQRNASAGPTLAQVVEEAERHAITQALERHGVDLSRVADELGVSSTTLWRKMK
                     RLNLRPPSELARE"
     gene            complement(772218..774710)
                     /locus_tag="LILAB_RS03180"
                     /old_locus_tag="LILAB_03250"
     CDS             complement(772218..774710)
                     /locus_tag="LILAB_RS03180"
                     /old_locus_tag="LILAB_03250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935746.1"
                     /db_xref="GI:503701670"
                     /translation="MSTKRYSEADLRVLVDTFRNPMLAVVEGRVLVANDAYVALVGLQ
                     RVQVEGRPVMDFIQPEDRSRVVERYWRVESGAPLHDGSQLFQVPCADGVAREVAVTAS
                     RFALERGGGGLLLNCTPMENRPPEMSVAERLVETSAGLVSAHSENAVRRVALKGLEAA
                     GFRARLLRWEGEGLLARDGEPLPEDARLGLESLADGRPVFGGADQAAPSHVYLPVGGP
                     QAEVLWVEGHWVAPRHGSVLMLFAKVVGAALTDARVQAESARSRWEMEAVAQVARFVA
                     QPSPPTQEDFLARVAPLLQADAAALHLSSPPEGALTLAAHVGLHDGADAQRLAGVLSC
                     GAAGALSSAADEAALAAHSGGRLGAGAAVCLKRGGEVCGLLQVLRAPGRPFDERDLRL
                     LGTLSELLVTLLEQRRLRAESSRQLDETRLLLDLARTTSGVLETSSILDVAADFLVRL
                     LDVSNCYILLYDESARLLRGAAASIAHREFFRTVVLPLHGDGLTARVARERRPIAVED
                     VAAAEGGFNPELAHRFDEKALLALPLTSREELIGVVVVDDTRGPRAFGPELIELAEAT
                     CGQLALSIANARLYESLWASYAELAATRAEMVKRERLAALGELSAIVAHEVRNPLGVI
                     FNAVASLRRLLVPGGDAAMLLDILGEESDRLNRIVGDLLDYTRPRDPVLQQEDLGRVL
                     QDSLEAARMQGGGADRSIRIQSDVEPGLPPVPMDRRLIRQALVNVAVNAIQSMPQGGL
                     VQVRARREAHAGREQLRIDVVDQGPGIPAELLHRVFEPFFTTKAQGTGLGLAVVRRIL
                     EEHRGEIAVDSIPGRGTTFTFRLPLSQPPSFP"
     gene            complement(774707..776623)
                     /locus_tag="LILAB_RS03185"
                     /old_locus_tag="LILAB_03255"
     CDS             complement(774707..776623)
                     /locus_tag="LILAB_RS03185"
                     /old_locus_tag="LILAB_03255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor"
                     /protein_id="WP_013935747.1"
                     /db_xref="GI:503701671"
                     /translation="MIVGTAGHIDHGKTSLVKVLTGIDTDRLKEEKRRGITLELGFAH
                     LTLEDGAVVGVVDVPGHERFVKAMAAGAGGVDLVVLVVAADEGVMPQTREHLDICRLL
                     GVRAGVIALTKADTLAELGAEWRALVEADLAALTAGTFLEAAPVVACSSRTGEGLAAL
                     RAALTRASAALPERSSEGPAFLPVDRVFTLKGFGTVVTGTLLSGALAVEDAVSLLPGL
                     PGPLRVRGVQRHGAAVQTVEAGQRAAVNVTGVEPEALHRGMVLVRAGELPETRMLDVE
                     LTLLPAAPSPLARRSKLLLHLGTAQVEATVALLDGERLEPGATAVAQLRLGTPVGALV
                     GQRFILRGARALPGRGATVAGGRVLSITPPRRRKGGATAVAPLLEADPAGQVAWLLRQ
                     AGYRGLTQPELFGRSALGPRGLTRALELLGARGGALLVDRERRLYLSGDVFESLQARA
                     LALLAAFHERAPLRDGLSREALRQRLSATLDARVFQRVLQALVEGGRVELERDVVRLK
                     GRGRTLTLGDTAARTRLTAELSAAGLAPPSLAELEQKIQLPAPRLRELLGGLVAEGAA
                     VRVSEGLWFSPGALAGLRERLVAHLREKKEITTQDFKEMVGQSRKFVIPLSEYFDREK
                     VTLRVGEKRVLRRG"
     gene            complement(776643..777335)
                     /locus_tag="LILAB_RS03190"
                     /old_locus_tag="LILAB_03260"
     CDS             complement(776643..777335)
                     /locus_tag="LILAB_RS03190"
                     /old_locus_tag="LILAB_03260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl transferase"
                     /protein_id="WP_043712342.1"
                     /db_xref="GI:760029293"
                     /translation="MATKRQSKPTEKASSKKSPAPASSRLQAKKLVSIPDDLVLAPQV
                     EAPRQPTGKDQSRGRSASSGVKELTWKEFDRAVQQLAGSIQETFEPQVVVGVAHGGVF
                     VGGALAGALGCQFFPVRISRRSRDRGSAAPRTAKTPQLSGEMPAELKGRRVLIVDDVA
                     SSGDTLELATALAREVGAKKVATACLVTKPGGFSPDYSALSTAALIVFPWDYEPSTGD
                     ARFDEDPDKAGA"
     gene            complement(777463..778494)
                     /locus_tag="LILAB_RS03195"
                     /old_locus_tag="LILAB_03265"
     CDS             complement(777463..778494)
                     /locus_tag="LILAB_RS03195"
                     /old_locus_tag="LILAB_03265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine dehydrogenase"
                     /protein_id="WP_043712345.1"
                     /db_xref="GI:760029296"
                     /translation="MSYFTQLLEGGYEAVHLLSDSKTGLRAIVGMHNTRLGPGLGGTR
                     ALSTYTSEEEAVADALRLARGMTYKAALAGLPHGGGKAVIMLPRGDFDRERLFESFGR
                     AVESLGGRYITTEDSGTSPDDMEHVRRHTKYVVGLKERSGDPSPVTAYGVARAMEATA
                     KHLFGSPDLKGLRVTVLGVGHVGMYLVKELHQRGARVWVSDLNPASVQQAVTQYGATA
                     VDADALHRMEADIYAPCALGGAINDATLPLLNVKAVCGAANNQLLTSRHGEQLSRRGI
                     LYVPDYAANAGGLINVAQEWAGYDRDKAYARASHIYDTIDALLARSKESGLRPEQVAD
                     RMVEERLAG"
     gene            complement(778529..779413)
                     /locus_tag="LILAB_RS03200"
                     /old_locus_tag="LILAB_03270"
     CDS             complement(778529..779413)
                     /locus_tag="LILAB_RS03200"
                     /old_locus_tag="LILAB_03270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709165.1"
                     /db_xref="GI:760026033"
                     /translation="MSDELVSGMLKNTDLRVVLATTTELSRQARATHGTAPAAAALLS
                     QALTAAALMGALQKNDARINIQVECDGPLRGLFVDGDTSGLVRGYVKNAYVEYSGGDG
                     QYHWRPVLGNKGFLSILRDLGGGEYYRSAVELEAFDLAADLERYFKQSDQLPSHVLLA
                     QLPVGGEAEPLGHVAGLLVQPLPGADMTAFAELGERLRRDFAPALQARSAEGATAVLR
                     ALLPESDFEVMSRYPLRFGCSCSKDRVLRALLAMGREELTDLLEKEGQAEATCQFCTT
                     RYVIPGEEIRGMLERGGI"
     gene            779675..780358
                     /locus_tag="LILAB_RS03205"
                     /old_locus_tag="LILAB_03275"
     CDS             779675..780358
                     /locus_tag="LILAB_RS03205"
                     /old_locus_tag="LILAB_03275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_013935751.1"
                     /db_xref="GI:503701675"
                     /translation="MSTQAAAAVETTKTPLLKSRLGSFLAVVPLSFWVVNHLWDNLSA
                     FNGADAWQKSVTTYANPFSQVFTFIIVLLPLLLHTGWGLVRLFSFKPNNVRYNNYGNL
                     KYILQRLSAVGVLAFLGAHIWLAFLYPRLVLGHPEAFDDIAREMRYHVPTLVVYLLGT
                     LGTSYHLANGLQGFAMGWGLLSSERSMRKFEPVVIILFLVLTAMSWAVIYALYNAGAA
                     LSPVGATPP"
     gene            complement(780483..780977)
                     /locus_tag="LILAB_RS03210"
                     /old_locus_tag="LILAB_03280"
     CDS             complement(780483..780977)
                     /locus_tag="LILAB_RS03210"
                     /old_locus_tag="LILAB_03280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_013935752.1"
                     /db_xref="GI:503701676"
                     /translation="MAGGVNKVILIGNLGADPEVRFTPGGQAVANFRIATSESWVDKN
                     GQKQERTEWHRIVVWGKLAELCGEYLKKGRQCYVEGRLQTREWTDKENRKNYTTEVVA
                     NAVTFLGGGGRDAGDGMGGGGGGRRQFSQQRGGDNNDYGQPPPDDMGGGHGGHGGGDD
                     DIPF"
     gene            complement(781188..783437)
                     /locus_tag="LILAB_RS03215"
                     /old_locus_tag="LILAB_03285"
     CDS             complement(781188..783437)
                     /locus_tag="LILAB_RS03215"
                     /old_locus_tag="LILAB_03285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_013935753.1"
                     /db_xref="GI:503701677"
                     /translation="MQVHRASSILAASAILFLSLSHAAHAAPAVSAEKRADREALKSA
                     LLEVLQRAPLKASRMGVHMQSLDDGAVVFSHNADELLNPASNVKLVTSAAALAALGPE
                     FRYDTEFLVEPELGADGKVKTLYVRGKGDPSMTTERLWGIVAELWNAGIREVGEIVVD
                     DSWFDAERTPPGYDQEDTDRAYMAPTGAVSLNWNAVAIYLRPGSAPGAKGLVAVEPPS
                     DFFVVENQLTTGARRARRVFVKSDAAGLRQKIVVRGQLPVERTGAVSVWKKIDNPPMY
                     FGQSLKQMMVMRGVKMRGRVKLGKTSTKARMLHVSQSDTFDVLLKRLNKLSSNFVAEQ
                     LLKTMGAEMRGAPGSFAKGVDVVEQFLERDVGIPRGTYVMKNGSGLNDANRFSATQLN
                     KLLRHMVQRFPFAPEYLSSVPIAGKDGTLKYRFEGSDAVGRLRAKTGTLESVSALSGY
                     VTSAGGERFTFSIMANDFAGRAGPIVAGLDALGAAVAATGSSLGPSTAVAALADSGRP
                     AGAVDDVAARIKTYLDLGAQRDQRNIGFLRTAWRSERDPAVRAVLAESLYQSNPHDYL
                     GARTLLDSYAATAEVYGRLKDVARVLSVEVPGVSSMVELAAGGNAEALARVLELAGAA
                     GSDAQAQGEMAEALGEVARTAPEELVVALRAASAGDRDACTTLLARALVQAGQADHPF
                     WKSLRRTLGASDPRLATFAKGLDSTLSQKVAEARAPVKTPEGFTPVEVVAPAGNAPES
                     STADNRPGG"
     gene            783623..784084
                     /locus_tag="LILAB_RS03220"
                     /old_locus_tag="LILAB_03290"
     CDS             783623..784084
                     /locus_tag="LILAB_RS03220"
                     /old_locus_tag="LILAB_03290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="WP_013935754.1"
                     /db_xref="GI:503701678"
                     /translation="MKAVVQRVLEASVTVEGHRVSEMGPGLLVLLGVGKGDTEADVAW
                     MVEKLATLRIFEDAAGKMNLSLEDTSRQLIVVSQFTLYGDARKGRRPSFIDAMEPVGA
                     KALYERACELLRQRGLTVGTGVFAADMKVALVNDGPVTLLLESPGPAAPRG"
     gene            complement(784081..784926)
                     /locus_tag="LILAB_RS03225"
                     /old_locus_tag="LILAB_03295"
     CDS             complement(784081..784926)
                     /locus_tag="LILAB_RS03225"
                     /old_locus_tag="LILAB_03295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709168.1"
                     /db_xref="GI:760026036"
                     /translation="MDVVLRPISDRFFHEHLLPFFRRAMGDAPGALEALQEQLGDGQA
                     RMLCERMLSTALPGGVGSVDADPWADLVDRLVFLHWTEGPSGWEVGEADAGYADGWDE
                     ALHLALMVEEADYPYSDARASRDVRDRFRFRPREDVGLASLLAGQWEPFPEFPPDQVF
                     ATQGRGEYSPGMRYAFADWAWRPARKVAHWQVNLPRKLERLLAREQERMKLPSLPEKD
                     EVLAYWLGRQPQPPPLTVAFSGLGPRAANWIRELGALTAHLRGAALAKQGLAALVTKG
                     SGVRI"
     gene            complement(784960..785421)
                     /locus_tag="LILAB_RS03230"
                     /old_locus_tag="LILAB_03300"
     CDS             complement(784960..785421)
                     /locus_tag="LILAB_RS03230"
                     /old_locus_tag="LILAB_03300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="WP_013935756.1"
                     /db_xref="GI:503701680"
                     /translation="MRIAEFLSPQAVIADMQSRTKPEVLRELSATLVRAHPQLSSDRL
                     VEVLREREKLGSTGIGEGVAIPHGKLPGMSQLQAAFGVSRAGVDFEAIDGKPTQLFFA
                     LVAPENSAGVHLKALARISRLFKNPRFRAAILEAPTAADIHALIVQEDARP"
     gene            complement(785964..786632)
                     /locus_tag="LILAB_RS03235"
                     /old_locus_tag="LILAB_03305"
     CDS             complement(785964..786632)
                     /locus_tag="LILAB_RS03235"
                     /old_locus_tag="LILAB_03305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal biogenesis GTPase"
                     /protein_id="WP_013935757.1"
                     /db_xref="GI:503701681"
                     /translation="MQFNITFRQFGASDSLKEYAREKVERVNRLLDRAGEAHVVLSLE
                     RHLHHADITIHSGAWVLRGRDKSDDMYASIDLAMDKIERQLRRYRDKLKTHHGRERVH
                     HRQDLVEQLRVRHAVFELPDADDVTSLAEASTSEAAPKPAVVVAAPPPAPAQAAREVR
                     ATHLTVKPLTVDDAVMQMNLMNNDFYVFHNVESESLCIVYRRKDGQYGLIEPHAPAVA
                     ATGT"
     gene            complement(786833..787717)
                     /locus_tag="LILAB_RS03240"
                     /old_locus_tag="LILAB_03310"
     CDS             complement(786833..787717)
                     /locus_tag="LILAB_RS03240"
                     /old_locus_tag="LILAB_03310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013935758.1"
                     /db_xref="GI:503701682"
                     /translation="MAQKNPDPRDAGPKPPFPKQSQPHPGHEGRMSPEPDYGEQSYKG
                     LGRLEGRVALVTGGDSGIGRAVCLAFAREGADIAVSFLSEGDDAQHVKRVVEDAGRKA
                     LLLPGDLTVEAHCRKLVEDTVKRFGRIDILVNNAAYQGEAVERFEDLDPERLERAFRT
                     NILAMFHLVRHALPHMKEGSTIINTTSIQAYEPSPAILDYAVTKGAIANFTKGLGQEL
                     IKRGIRVNAVAPGPVWTPLIPQSFDAEKTSTFGKDSPMGRPAQPAELAPSYVFLASDE
                     SRYVNAEVLGVTGGRLLA"
     gene            complement(787829..788614)
                     /locus_tag="LILAB_RS03245"
                     /old_locus_tag="LILAB_03315"
     CDS             complement(787829..788614)
                     /locus_tag="LILAB_RS03245"
                     /old_locus_tag="LILAB_03315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935759.1"
                     /db_xref="GI:503701683"
                     /translation="MNLIFRRNLLRLPAGAFVAVGLLSGCGSSLTSETVSLAELAGRT
                     LTLAQSDVDVYEGVGEAGSHRVTVTFSPAAEEDRCTELNEGATATFNGQPMTLDRGGV
                     DGTAGRDVCVPTRAYYDFDPNVWVQQPTENARIVLQDGSHTITLVLKDGKAKRLFSFQ
                     GPGAEDRLTRGQEYSFRWLPEGEIPGPITATLLREGGSATATIPTAQEEAVVSFTLLQ
                     TTPVAAHLLTLSGTAPGEVLECTGVATCEATLFHSEERVVNVQ"
     gene            complement(788744..790261)
                     /locus_tag="LILAB_RS03250"
                     /old_locus_tag="LILAB_03320"
     CDS             complement(788744..790261)
                     /locus_tag="LILAB_RS03250"
                     /old_locus_tag="LILAB_03320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015346716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma54 factor"
                     /protein_id="WP_013935760.1"
                     /db_xref="GI:503701684"
                     /translation="MAMELKQSLKLAQQLVMTPQLQQAIKLLQLSRMELLEQVREEME
                     QNPLLEQPDEQAPGDVGDKEPGEASLEADNMELPRDGDMPAATSDTATEFKADGEGPP
                     EIDWEQYLNSYQFNEPTTASNKGNVATDDMPSFEANLVKKEDLVDHIQEQLGTLRLND
                     AERRIALLILGNLDDDGYLKLPEVDGDPLIRLANEADVPMHVAERTLRRIQMLEPRGC
                     GARDLQECLLIQLQGMKEPHAPLLGLIIKRHMKYLESKNLPAIAKDLKVTLEEVVEAV
                     RLLPKLDPKPGRNFSGDDAQYISPDVFVYKMGDEYTVVLNDDGLSKLRISGTYRNALK
                     TGAVGPGQTKDFIQDKLRSAMWLIRSIHQRQRTIYKVTESIVKFQRDFLDKGIAHLKP
                     LILRDVAEDIGMHESTVSRVTTSKYVHTPQGIFELKYFFNSSIARVSGEDTASEAVKH
                     HIKQLVSQEDARNPYSDQKIVELLRSQGTEIARRTVAKYREVLGILPSSKRKRYY"
     gene            complement(790509..791249)
                     /locus_tag="LILAB_RS03255"
                     /old_locus_tag="LILAB_03325"
     CDS             complement(790509..791249)
                     /locus_tag="LILAB_RS03255"
                     /old_locus_tag="LILAB_03325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_013935761.1"
                     /db_xref="GI:503701685"
                     /translation="MSAKLFAEGLEKTFRGRKVVNGVSFSVAPGEVVGLLGPNGAGKT
                     TSFNMVVGLVSPDKGRVRIGDEDLTHLPMHRRARRGVGYLPQEASVFRKLTVRDNFLA
                     VMELQKDLDAKTRAQRADTLMEEFGLTHVAESLGETLSGGERRRAEIARSLIPQPRFI
                     LFDEPFAGVDPINVGDLQRQIFLLRERGLGVLITDHNVQDTLGICDRAYIIAQGRILE
                     EGTPAEIAASPKARAVYLGERFRLQQAL"
     gene            complement(791246..791851)
                     /locus_tag="LILAB_RS03260"
                     /old_locus_tag="LILAB_03330"
     CDS             complement(791246..791851)
                     /locus_tag="LILAB_RS03260"
                     /old_locus_tag="LILAB_03330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935762.1"
                     /db_xref="GI:503701686"
                     /translation="MIEFLVMAFFVAQPAPAVAATPAQGTPPAAVGSAPAPGTGSRAP
                     GPLGGKALTEPVQIKGDNVTFQKSQATLTGNVKVKHRTMDLKCDRMTANYTPQREVTR
                     VVCTGGVEAVDGDRMARGERAEYDVPSGVLVVTGSPEARQGTTHMRGTKVRLTLGNER
                     LEVENAVIVFESLPANPAPAKRKGRSTPARPAPSAQGGSAR"
     gene            complement(791848..792399)
                     /locus_tag="LILAB_RS03265"
                     /old_locus_tag="LILAB_03335"
     CDS             complement(791848..792399)
                     /locus_tag="LILAB_RS03265"
                     /old_locus_tag="LILAB_03335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935763.1"
                     /db_xref="GI:503701687"
                     /translation="MLRLLAVSLFAWVFASGCKPGAGEGAASAQPPPEVVLHGARLES
                     FAGDRLIRSGTARQVSYQRTTGEVWATDATLRIPPGSAPQGAPAGTEGGVEVSAPNMA
                     GSLASKQVVASGGVIIRTGKGMEAHTPRLTYDATTERAHGNEGVTVKGPDYRLRADRF
                     ELLFPDETFNFAGSVETVVGAPE"
     gene            complement(792412..793365)
                     /locus_tag="LILAB_RS03270"
                     /old_locus_tag="LILAB_03340"
     CDS             complement(792412..793365)
                     /locus_tag="LILAB_RS03270"
                     /old_locus_tag="LILAB_03340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis acyltransferase"
                     /protein_id="WP_043709170.1"
                     /db_xref="GI:760026038"
                     /translation="MERPPLAKRLKRFLRYVLIRGVMLLLQPLPLGVARSLGARLGAL
                     AYTLAGGERRKALKSLSVAFPEKTEAERRTLARDAFRHLGAAALEVACTGALDEALER
                     LVAWPDTDRQVLEAALARGRGVVFVSGHVGNWELLARRVARAGYPSQSIAKETTDPRL
                     TELVGQFRARGGVRSIWRGQEGAARAMLRALRNGEILGILIDQDTKVQSLFVPFFGQL
                     AATPRAAADLALRTGAAVVTGFCHREGAGYRLSMEEVPVPQDADREAAALALTAALSS
                     RIEAAIRRTPEQWVWMHQRWKTRPPVSGEVPLPEAAPASAG"
     gene            793383..794705
                     /locus_tag="LILAB_RS03275"
                     /old_locus_tag="LILAB_03345"
     CDS             793383..794705
                     /locus_tag="LILAB_RS03275"
                     /old_locus_tag="LILAB_03345"
                     /EC_number="3.5.3.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DDF6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinylarginine dihydrolase"
                     /protein_id="WP_013935765.1"
                     /db_xref="GI:503701689"
                     /translation="MREYNFDGLVGPTHNYGGLSPGNLASQSHVGEPSHPRDAALQGL
                     EKMRFVSGLGVGQAVLPPQPRPSLHTLRALGFTGSDEEVITRAAREAEHLLRLTSSAS
                     SMWTANAATVAPSADTADGRVHLTPANLSQMYHRAIEAETTHAVLRAIFANEKYFAVH
                     APLPGSGHFADEGAANHTRLATPGHAGVHLLAWGRSAWQDVQGPGRFPARQTLEASQA
                     LARLHQLDAKSVLFPQQHPEGIDAGAFHTDVLAVGNERFLMLHELAFVDHAGLLAVLR
                     EKLGQDFRAVVATKAELPAKDAVKAYPFNSQVLTLPDGTMAIVAPVESRETPAARRFL
                     ERVVAEDTPVKAVHYLDVRQSMNNGGGPACLRQRVWLTDEERGAIKADVFYTPALHDS
                     LAGWVRRHYREVLRPKDLQDPQLARETMTALDELTRILNLGSVYDFQR"
     gene            complement(794715..795440)
                     /locus_tag="LILAB_RS03280"
     CDS             complement(794715..795440)
                     /locus_tag="LILAB_RS03280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709173.1"
                     /db_xref="GI:760026041"
                     /translation="MRFYRVEGDAASRFTGDLSRAAHKWGLPGVEPCAACGVGGGWAG
                     LQYPCVDLSGFSKAELKPYSDPWPVPFEVFARLRERIRTLAPEGAVLEPGTRLGPLTG
                     TAAGAFGPITLQDWTLVARDDALAALHGAGLQGLTGCRLDVTFRDKSPPVLRELQLAL
                     HGRIHPDCFTQPRASNCAKCGSEASERLPDTYWLAQETLPTQVDLFRLRDYPTLIIAT
                     ERTVDAADRLKLEGVTFQPVDAR"
     gene            796231..796773
                     /locus_tag="LILAB_RS03285"
                     /old_locus_tag="LILAB_03360"
     CDS             796231..796773
                     /locus_tag="LILAB_RS03285"
                     /old_locus_tag="LILAB_03360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709176.1"
                     /db_xref="GI:760026044"
                     /translation="MRFPMIPEAIQHYLRRNGVRFERYWHPRAVSAQEVAESLHVSGW
                     RVAKSVIVMADRQPWIVVVPAAGTVDLDQVRHTLGARHVRLATEQEFSGHFPDCEVGA
                     EPPFGELYGLPVAVDESLSLAERLLFRAGSHEETLELRFQDFATLEWPLVASFIEQEQ
                     QRQAASGAPTRMREEAHAHA"
     gene            complement(796799..799495)
                     /locus_tag="LILAB_RS03290"
                     /old_locus_tag="LILAB_03365"
     CDS             complement(796799..799495)
                     /locus_tag="LILAB_RS03290"
                     /old_locus_tag="LILAB_03365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polymerase"
                     /protein_id="WP_043709180.1"
                     /db_xref="GI:760026048"
                     /translation="MAARTGGGGAGEGAGCCDTHPASPHMPRASRSASRFTLFAEAAL
                     AALVVGCPLALGGAAGWLLGPLVLLSGAAAVLAAIGAKRQGQSLRVPLLAVPLAAGAA
                     LCAVQLVPLPEGLLRLLSPEAAALREFALVPLGLEGARPVSLDPSATWRELAKHLAYL
                     LAFLAAVQVCRSRSSRERLLAAVVLTGAGLTVVGLGHALLGVKSLFGLLSWTHARPPL
                     VTPFGNPNHLAGFLALASTVGVGLALTRRQQSRTWPYALAAGLSGLGVVLSLSRGGIA
                     FFAFGQVLLAVLLLRRRHAAGEGAPPVWARSTAALLGLLGVLMVGAYAAAEGLWAEAR
                     TADSVEKLRQSKVAQWPMLSGAARAFPMLGMGRGAFEVAFPRYQTEPNPNTFTHPENA
                     VLQVATELGALGLVLLAVAVWAFLRLLRREGLEMVDLAVLAGVAALGLHDLFDFSLEL
                     PACAVAALVALGAVARPRERASTVEQGWCAKPAGAALGMGLSLTVVALVALVPGRHRV
                     ADAEAELARLVTSGASARDVHARGLALVDRHPSDYLLYRLMASAHAARGREGAGEALA
                     LVNRALYLAPLDASSHRVAARALLALGRSAQGFLEYRLAHEAGDSTVLLGEALPQVES
                     LASLTVLTPEAPATAVRLLDSLANTPGRLELALAYSRWARERFEGGPEAAALWAREAR
                     LQLRKGALEVADAACARVERLAPDALETHLLRAEVLRAQGRRQDALQALERLLARFPG
                     NVALSFQLAAQQLDAGLTRRAKDTLQALAPFITDYAQRARLLSMEAACLEREGLLSHA
                     LERRQTAARLAPGAEAFFAVARTQEALRRYDAAARSVHEGMRHLPAGARTEARAWAAR
                     LEGAERERVDARRKALVDDPRAAELEYLLRNPDEDGEARDAQ"
     gene            complement(799523..800143)
                     /locus_tag="LILAB_RS03295"
                     /old_locus_tag="LILAB_03370"
     CDS             complement(799523..800143)
                     /locus_tag="LILAB_RS03295"
                     /old_locus_tag="LILAB_03370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935770.1"
                     /db_xref="GI:503701694"
                     /translation="MLSLAAAALLATAASPTSHSLLTRSPDRPVSVRLLLAQAPAEVS
                     PDASGAPTPPPLAEDLDARARELTQQIAMLQSEIRTVDTNWPAGSLVMAYSGYVLSPL
                     LLLGIPLIIVGMGSSDDDDAGSLLGLGVGMTVGGVAGVGLLIAGIITGSKEANLNRSR
                     REEMVRERIRLEDELRDVKARRDARGALQTRTWTPRPSLPLVAFAF"
     gene            800243..800533
                     /locus_tag="LILAB_RS03300"
                     /old_locus_tag="LILAB_03375"
     CDS             800243..800533
                     /locus_tag="LILAB_RS03300"
                     /old_locus_tag="LILAB_03375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935771.1"
                     /db_xref="GI:503701695"
                     /translation="MFAAAMRRFIVTAALLCSALSGLTGCKGACRELSEKLCDCSINS
                     VEKELCLRRASQEENRVEPTAEDEAVCEERLDGCDCRAIETEEGKRACGLSR"
     gene            complement(800631..801818)
                     /locus_tag="LILAB_RS03305"
                     /old_locus_tag="LILAB_03380"
     CDS             complement(800631..801818)
                     /locus_tag="LILAB_RS03305"
                     /old_locus_tag="LILAB_03380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_013935772.1"
                     /db_xref="GI:503701696"
                     /translation="MSGSRALDALTGLRFVAALHVVLFHFAAPCLGTAPEALRNWVGA
                     GYAAVGVFFVLSGFVLAWNYLDADGRMETPPRAFWAARVARVYPVYLLTFLLSAPTTI
                     APSVADNGWKVAAVKLAVGGAVTLALLQAWVPRLALYWNPPGWSVAVEACFYGLFPRL
                     AKGLPRLKPAWLPVALAGTWGLGLAPPLLYLVLLPDGPGPVDVHASGPWLMALKFNPL
                     ARLPEFLIGVLLGWCFVRERAAGGGKGSGAVLAALGTALLVAAGAAGERVPYPLMHNA
                     LLAPASGLLVYGLARGGGALGWLLSRPTLVRLGGASYALYLLQYPVSEAAKGVGAALS
                     PWVELRTPEGLLATVLVLGVPASLWVHRYVETPLRARVRAALAPWGEGPRREDAKSVV
                     SGA"
     gene            complement(801821..803119)
                     /locus_tag="LILAB_RS03310"
                     /old_locus_tag="LILAB_03385"
     CDS             complement(801821..803119)
                     /locus_tag="LILAB_RS03310"
                     /old_locus_tag="LILAB_03385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_013935773.1"
                     /db_xref="GI:503701697"
                     /translation="MRIAIIGTGYVGLVAGTCFADSGNDVTCVDIDERKIRMLQAGEV
                     PIYEPGLEELIKKNVREKRLFFTRDLAEAVVNAQVVFIAVGTPEGESGDADLQYVLAA
                     AEQIGKAMKQYTVVVDKSTVPVGTADKVREAIRGVTNVEFDVVSNPEFLKEGAALDDF
                     LKPDRVVIGVDSERARKVMGDLYSPFVRTENPILFMDTRSAELTKYAANAMLATRISF
                     MNDIAALCEKVGADVDFVRKGLGSDKRIGYPFLFPGVGYGGSCFPKDVKALVATAREY
                     GLELDLLRAVERTNERQKKLLVNKAAKHYGSLEGRKFGVWGLAFKPKTDDMREAPSIE
                     VIEGLIGKGAQVIAHDPVSPHTARRVFGERIRYASVPYEALEGVDGLFVVTEWNEFRH
                     PDFERMKSLMKSPVVFDGRNVYDPTRMRELGFTYYGIGRR"
     gene            complement(803224..804195)
                     /locus_tag="LILAB_RS03315"
                     /old_locus_tag="LILAB_03390"
     CDS             complement(803224..804195)
                     /locus_tag="LILAB_RS03315"
                     /old_locus_tag="LILAB_03390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935774.1"
                     /db_xref="GI:503701698"
                     /translation="MSAGLLDTFRVLSSFDPPRGALGGAPWEEYVDWAIMQGLAPLAA
                     YNLEYRLGAGNAPEWARDKLLAIYQGSVNDNVMKLVNFKRIVNALEGRKLVLMGAASF
                     ADSLYPHVGFRPVPELQLLMKRLDVEGFSGFLANHEFAPEPDTENSGATKVLSDGRTV
                     ILLYSDVLGPRRREQTAGILERARPMRVYGSSLYRPELEDAVLLVALEHARHGYAVPW
                     LSFIDLRELVTGAKWMGGVYSRPLDVPVLLARAREWRLERALYTSLSVVTRLFPEAAA
                     DATAALPPLRRATRELLDRTVVGPVCTPGQTSALKGMERVRRLLTGQ"
     gene            804398..807157
                     /locus_tag="LILAB_RS03320"
                     /old_locus_tag="LILAB_03395"
     CDS             804398..807157
                     /locus_tag="LILAB_RS03320"
                     /old_locus_tag="LILAB_03395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935775.1"
                     /db_xref="GI:503701699"
                     /translation="MSQQGWSDGRPGRWLTLGALGWVACTGTTPEEPPAFDDTTAVES
                     EARCEVRPPFEPHFEPEVEWAWTASPLMPTHTNAQATPVVVDVNQDGVPDVVFNSFEG
                     WNFKTNGVLRAISGADGSDLWAVTDLAYRTRGSASVAAGDLDGDGKVELCTVPESARG
                     VICFEHTGAFKFRADGPPLDWGGVSLADLDGDGSVELIAGNHVYDSSGKLRWTGSDGV
                     GSPANDTGPLAFALDLDGDGLQEVVNGRAIYRHDGTLKCKAAELGHGLSGVGNFDADP
                     RGEVVVVWDGHVSLMDADCEVKWTARHLGGGVGGPPNIADFDGDGQPEIGVAGASHYA
                     VFEADGTVKWLSPTQDHSSNRTGSSTFDFEGDGRAEVVYADETALRIYDGVTGEVRFE
                     APHSSCTAYENPVVADVDGDGNAEIVVAQNTACGYGGFNGIRVYRDRKDGWVNTRRIW
                     NQHAYSVTNVNDDGTLPSRPVSNWLAPGLNTFRTNSQGTGTVRPFAAPDLAIGQVTAT
                     CAGEGAVTLGARVLNQGDSATSAGVQVAFYQDAVGEGGTLLGVATVEHTLEAGAEATV
                     ALPITTSDSGWVLVYAVVDDDGTGAGRELECREDNNKTSAQLELACAPNAPPVALCQD
                     VVVEADAQCRAAANVDNGSHDPDGQPGPFTLTQSAPGPYGLGRHAVTLTAHDGEDSDV
                     CQATVKVVDMTLPTIVCPAPQVLECVAGGAEATYTAQAADNCGPVSVTCSPPDGSRFP
                     LGRSVVDCNAVDGSGNACGCAFSVTVRDTRAPVPGASLGKRLWPADHQYRTVTLAECA
                     APAKDACMGDLSLERYGRIIRVTSDESEDVAGSCDGATCDDIDVRVNAHSVQLRAERD
                     DAGDGRVYTVHYVVEDPSGNRADGRCTVEVPRDSAGEQVHDSGPEYCVGQGCAPGLGG
                     SPLCP"
     gene            complement(807207..807641)
                     /locus_tag="LILAB_RS03325"
                     /old_locus_tag="LILAB_03400"
     CDS             complement(807207..807641)
                     /locus_tag="LILAB_RS03325"
                     /old_locus_tag="LILAB_03400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002638406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013935776.1"
                     /db_xref="GI:503701700"
                     /translation="MKVMVLVKATKNSEAGVMPSEKEFADMGRFNEELVKAGVMLDGD
                     GLKPSSAGKRIRFSNGTRRVIDGPFAETKELVAGYWIWQVKSMEEAMEWARRCPDPMP
                     GEESDLEIRPFYELEDLGAGFTPELRAQEEKLRAELDQRRGS"
     gene            complement(807908..>808597)
                     /locus_tag="LILAB_RS03330"
     CDS             complement(807908..>808597)
                     /locus_tag="LILAB_RS03330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015348856.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712347.1"
                     /db_xref="GI:760029298"
                     /translation="SPDTCARRAVAFLDLLAACDPFLAHWNKIPKPRGRGRKTPLMPP
                     DLSILTEAYRRGVNREPGGPPIEDLGLTVSAYNDGIGEDFVSLMMRCGSYAKGMSNAC
                     VLSLPSEGENAERVLTSSVLMEVVRSMALAWAPDWAVAMSHAYRDMDDRQDTQDMWLG
                     WVTYLARHRGTVPPLPAPVRIEPVEDKGMLIVLTPERFTVSNPEHVALARRVRELLDR
                     AGLLRPLRGES"
     gene            complement(808771..809505)
                     /locus_tag="LILAB_RS03335"
                     /old_locus_tag="LILAB_03410"
     CDS             complement(808771..809505)
                     /locus_tag="LILAB_RS03335"
                     /old_locus_tag="LILAB_03410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013935318.1"
                     /db_xref="GI:503701242"
                     /translation="MSHDLVHARVREHLGRLRLGHLAERLDALLREEIGAKQKKRVSM
                     GITIAHFPAVKTLEDFDFKAQPSVDSKLVRELATGRFIAQAENVLLFGPPGVGKTHLA
                     IGLGRAAVEAGHSVLFTSATALLAALAKAESEGALKDKLNYFAKPKLLIIDELGYLPF
                     EKRSAHLFFQLVARRYEKGSLLITTNQLVGQWGGVFGDDVLAAAILDRLLHHSHTVLI
                     QGDSYRLRQKRKAGLLGRSAPPGNHG"
     gene            complement(809502..810950)
                     /locus_tag="LILAB_RS03340"
                     /old_locus_tag="LILAB_03415"
     CDS             complement(809502..810950)
                     /locus_tag="LILAB_RS03340"
                     /old_locus_tag="LILAB_03415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013935319.1"
                     /db_xref="GI:503701243"
                     /translation="MVEQEVVRQVRVLAKAGWGAKRIAREVGVARNTVRRYLRAGSAA
                     DTQVRPKARRLTESEQQRAVELWDSAAEGNAVVVKALLAQEGVEASVRTVQRAVELWD
                     SAAEGNAVVVKALLAQEGVEASVRTVQRAVELWDSAAEGNAVVVKALLAQEGVEASVR
                     TVQRAVEKRRRQVHAAQTATVRFETKPGQQMQVDFGEKKVRLGGQVVKVFLLVAVLSF
                     SRRLFVRAFLNQRGDDWREGVAAAFVHFGGVPLEVLSDNARPLVEENNRQAGTVRFHP
                     AWVQFCRDWDVMPKACGPYRARTKGKTESGVKYVKRNALAGRDFEAFGAMEAHLAQWM
                     GEADERVHGTTHEPPLERFEREEKAALRPLPLRVLPRRHQRLKRKVANDALVDVDTVR
                     YSVPHRLVRENVEVQVGDDEVRIFHAGALVATHARHRQPHARVVDPAHWEGLWRPRAE
                     KRSEKDSSLTGLGRSLEDYAAVVEQDSKRGAA"
     gene            complement(811628..812881)
                     /locus_tag="LILAB_RS03345"
                     /old_locus_tag="LILAB_03425"
     CDS             complement(811628..812881)
                     /locus_tag="LILAB_RS03345"
                     /old_locus_tag="LILAB_03425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_013935779.1"
                     /db_xref="GI:503701703"
                     /translation="MSNVDDLRTTGGAVLFQVGDTAYEFLQTLGTGRNGERVMLARRR
                     TPAGYQGKVVLKCVVLPERKFAEAYPRARARLEEEARLAQLLQHPNIARVHGLFEMRY
                     GLCAVLECVEGFSLDALLSIAQARGRYFSEPFVLYVFAEVAAALAHAHSRTDDAGAPL
                     GIVNRDINPSGIRLRPGGSVALTDFGVAFSRLAGRIATSLPRPRGEALYAPPEAFLGA
                     RVDARGDLFSLGLTMLEFATGRHLYDPADLRIPEAEPHLTLEEHRRVLDASILAMETG
                     LPSFMEDALWCAMAYRPRDLARATAGVSQPLRAILHTLLRRRPADRFASAAELESALR
                     ARLAELAPFGPADAVKEVQQALLEAGEALEELDLLDDEGGFVPAGWREHPDHVETHPG
                     GRGADEVTTAPGAGARRTGKAPPAA"
     gene            complement(813033..814844)
                     /locus_tag="LILAB_RS03350"
                     /old_locus_tag="LILAB_03430"
     CDS             complement(813033..814844)
                     /locus_tag="LILAB_RS03350"
                     /old_locus_tag="LILAB_03430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013935780.1"
                     /db_xref="GI:503701704"
                     /translation="MSHPALLQPGQVVDGWRVVRMLGAGTYGAVYQVEKDGRHFAMKL
                     AMHRASSGDAEQADARLKRELGCLVHLEHANIIASRAHGRWPDLVTGWLYVVLDLVEG
                     YTLAEWVERTHPTAREVVRVFGKLAGAVDYMHGRGVFHRDLKLGNIMVRAADGEPFIL
                     DFSAGDYTNAEDLTDAPLPPGTRRYRSPEAARFLRENGDDRDARYAFKVTDDVYALGV
                     CLFDVLTAPEPTSGAFKAPVEGRLMPPPAREVNPRVPQALSDTAMCFIARRPEQRPPT
                     AEVMRRMLESFAGEGGPEWTLPLHPPVTTPRLDPATGSDAVPAPRQSRRVRASVVGGV
                     LLLMGLLGALAYSGSRWASPSSVPAGDGSLPPVVMADAGAVARLAVAPLPSLPREDGG
                     APPLPPARSPAGVALPPQAPVQKESPAVKRAPSVANSSAPPAKKVVSSRARGAEFLAK
                     CAAASAAVALQLGCPGSVQMRPSSGACPADAQQAMRARGLRTMASVMVEIDVSRKPDA
                     TSLSLRTYGDGPVRSRVNGPTRGMPEGTMLYGQVWTGDGRFFARYTQAEYPDGTIIPV
                     CFVIGPDGSEEGYEGSKPGAVVFQFFHPAYIVYSRWP"
     gene            complement(814850..815767)
                     /locus_tag="LILAB_RS03355"
                     /old_locus_tag="LILAB_03435"
     CDS             complement(814850..815767)
                     /locus_tag="LILAB_RS03355"
                     /old_locus_tag="LILAB_03435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709183.1"
                     /db_xref="GI:760026051"
                     /translation="MRRLAVILIILRSIAAPAQSLPAARERQERRMALGGAATAPVPE
                     LRIAAGLATLLIFDAPLDRGAMELEGRSRFRLVDVGERILALEPLEDLGRGERLMLRV
                     RYADGASPEQGVFALVTHASEVDARVEVFRRRDSVEALRAELADVRAQLAARTQELRA
                     LRAGGAANGPVGLVMAGLVDAVGVRGRRFKRFAVTSGTSGLNVYDGAAFQATTWTVVS
                     LIVQNHGTTPWSAATARFRSAASGARFDAAAVRMQEPSIAPGASGRVFIETRALSARD
                     GEVFQLEVGDGAERERVLSLQVTLDARVE"
     gene            816115..816408
                     /locus_tag="LILAB_RS03360"
     CDS             816115..816408
                     /locus_tag="LILAB_RS03360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712349.1"
                     /db_xref="GI:760029300"
                     /translation="MSCCVQRNPGIPEACGLTAAEAASHMAGVKMAVEAADDAPAEWD
                     DSHNAALPDWKRRCIRAYGDCKEDGWRGRCYACFRECEGQQRWPADKCYPKDK"
     gene            816412..816792
                     /locus_tag="LILAB_RS03365"
                     /old_locus_tag="LILAB_03445"
     CDS             816412..816792
                     /locus_tag="LILAB_RS03365"
                     /old_locus_tag="LILAB_03445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935783.1"
                     /db_xref="GI:503701707"
                     /translation="MSDELDWDSIRALARRVLHNGEPLTLTDDVKALLARTATEVGIG
                     GADAARALATEAGALDLLRESSRRIGEGSDRLMDALYRAKRYRLAGDFDSARQEMRNV
                     LAVEVVPHYRKIAESQLKGLDDEP"
     gene            complement(<817118..817477)
                     /locus_tag="LILAB_RS03370"
     CDS             complement(<817118..817477)
                     /locus_tag="LILAB_RS03370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935781.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712351.1"
                     /db_xref="GI:760029302"
                     /translation="MRRLAVILIILRSIAAPAQSLPAARERQERRMALGGAATAPVPE
                     LRIAAGLATLLIFDAPLDRGAMELEGRSRFRLVDVGERILALEPLEDLGRGERLMLRV
                     RYADGASPEQGVFALVTH"
     gene            817696..818115
                     /locus_tag="LILAB_RS03375"
                     /old_locus_tag="LILAB_03455"
     CDS             817696..818115
                     /locus_tag="LILAB_RS03375"
                     /old_locus_tag="LILAB_03455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935785.1"
                     /db_xref="GI:503701709"
                     /translation="MGHKDIAPGLLCLMVALSLACSGSATTAASRRDAYALASCTDTV
                     SCCVQRNPGIPEACGLTASEAAAYTATMDAAMRRAQDKANEEEDDGADDGWRQHCMEQ
                     YVRCRDQKKPRWIGDCYACFRYCEGQHEWPFRDCHPR"
     gene            818125..818502
                     /locus_tag="LILAB_RS03380"
                     /old_locus_tag="LILAB_03460"
     CDS             818125..818502
                     /locus_tag="LILAB_RS03380"
                     /old_locus_tag="LILAB_03460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935786.1"
                     /db_xref="GI:503701710"
                     /translation="MPTQREWDAVKDLSRRITDPVQPFLTPETRALIEATAHDVGIPQ
                     GETARALQDDESAASLVREIASRITNGSRRLSRTLVEVDRRRDAGDTDGARQLLQDAL
                     AVEVVPHYMNILNTYLRAVDGDS"
     gene            complement(818593..819297)
                     /locus_tag="LILAB_RS03385"
     CDS             complement(818593..819297)
                     /locus_tag="LILAB_RS03385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043712354.1"
                     /db_xref="GI:760029305"
                     /translation="MQRATTDVDLLVARADVGAAVQALALVGLSVRRDDGARHGEEDA
                     HHLELTGPAGLVELHYRALAGWGEALEGDALLARAEAGTVDGRAVRWLRPEDEAVYLA
                     LHASNHALQRLAWLFDLKLLALAGPLDWQAVVERARGTAFPHSAWYAWDAARRLLGAP
                     VPEAALAALAPPRWQQVLARRFFSGERLVGAALLGSRPAWMAVKVLLAPRMDSVARYG
                     LRRVRNAVRARLRGPG"
     gene            complement(819678..821165)
                     /locus_tag="LILAB_RS03390"
                     /old_locus_tag="LILAB_03470"
     CDS             complement(819678..821165)
                     /locus_tag="LILAB_RS03390"
                     /old_locus_tag="LILAB_03470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013935788.1"
                     /db_xref="GI:503701712"
                     /translation="MITLFVAFFVSLVVALALTLLVRDRALAWGWLDQANSSRKVHVR
                     PIPRLGGVGIVGGFFAPLCALFLVDSGVGHHFRSHTDLVVGLFLGGGVIAALGLYDDL
                     RGAGARLKFAVQFAVALGLYAMGFRIEVIANPFGPELVLGALGLPFTLLWVVGVVNAL
                     NLIDGLDGLAGGVAFFGVGTNFILALSRGDVLLSLLMAALAGAILGFLVFNFNPASIF
                     MGDTGSMFLGFVLAAVSIKTSTKSGTAVAMLVPVMALGLPIMDTLLAMVRRSLLGRPM
                     FSADREHIHHRLMSHLVLSHRATVLVLYGLCGLFMLVALALNFASSVESAMLLCGVGA
                     LIVLLMRRLGYLDLGRARGMQQVRQRNLWLRTMVKDITRAVRGATSLEGVWNGVRPLA
                     DALGLARQELRFQRARPTGLMDNIVFEAQRPEGPGMPFEVSIAIKAEGEVLGSMLLVW
                     RDGRAAINRDEELALEQVADAVAESAARLQPRTDAEPGRLVALRK"
     gene            complement(821293..822438)
                     /locus_tag="LILAB_RS03395"
                     /old_locus_tag="LILAB_03475"
     CDS             complement(821293..822438)
                     /locus_tag="LILAB_RS03395"
                     /old_locus_tag="LILAB_03475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935789.1"
                     /db_xref="GI:503701713"
                     /translation="MRVLLGIHHPLDPNMGAPGVTLALGQALAAQGCQVDFFSYDDAY
                     PGLRHHTTLHELRFPWKLTAHLLRAAERYDVLDITTGDAWPWMRLGRPGARARHALVT
                     RSHGLEHTFSERLRADARAGLLTLSWKYPLYHGGYRLWEVRQSLLRADHAVLLNTQDA
                     AYVTERLGVPAHQLSVIPHGLDAAFHDLPPPAPGAPGAPLRVACVGSWLALKGRAEMV
                     DAATRLQAEGVSFTLTLYGTGNPEAEVLAAFPAGARERVRVVPRYERAELPRLLRDEE
                     VLFFPSHSEGFGMALVESMASGLVPVSTPVGVAPQVVRDGQTGRLVPMGDVDAQVAAL
                     RSLAEDRARLLVLRGAAQAAVKDMTWRDIAARTLRLYEQLLRSPRTV"
     gene            822512..823642
                     /locus_tag="LILAB_RS03400"
                     /old_locus_tag="LILAB_03480"
     CDS             822512..823642
                     /locus_tag="LILAB_RS03400"
                     /old_locus_tag="LILAB_03480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_043709186.1"
                     /db_xref="GI:760026054"
                     /translation="MPPIPAPMPPASPHTLQACLDSRRNNLDFLRFAAAAGVLFSHAF
                     PLGEGKGTAEPLEAFTRGQFSLGRLGVAVFLIISGVLITRSWERTPEVARFVWARALR
                     IFPALGVMLLLTVGVLGPAFTRLPLGEYLTAPDTARYLLGNLALNWPQWHLPGVFESN
                     AYPTAVNGSLWTLKYEVGFYLLTLGLGLTGLLRKGMVVFGLAGAAVATLVTGRLGFWP
                     ELYLYFGGGVALYQWRERVRMSAWVALACAAGWLVTARLGDGCRIVTGLLGGYVVLYL
                     AFRPLGALADFGRRGDLSYGVYLYAFPVQQAVTALLGGRTAWWVNAAVALPCVLVLSA
                     LSWRWVEQPALRRKERLPRWARRPASPVTASPETPSRPPGPR"
     gene            complement(823596..825497)
                     /locus_tag="LILAB_RS03405"
                     /old_locus_tag="LILAB_03485"
     CDS             complement(823596..825497)
                     /locus_tag="LILAB_RS03405"
                     /old_locus_tag="LILAB_03485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="WP_013935791.1"
                     /db_xref="GI:503701715"
                     /translation="MARRTRIPQTLFFQRPPSNLWPLVGVLLVSAVLVGAMELTIAIF
                     SSVGLEGITQRNAYSMLLSVGVISAVTGLLWAVTNRVGISVALVMSAMLFTVTLHIRK
                     VQLIDRPLMPWDFLEWRQVTALAPTLLPGGGALAAIGSCLLLVAMLFVMARAVARGTP
                     RYPLPKAGRRNLALAAVAYLLVIIFQQHLPVRRVFNRFGIYDQVWDQRSNFQMNGLTL
                     MMLWNWEGLRLAPGGEYSQEKVHAALGVPPGVVPTAPQEPVDVVVFMAESLWDPLRLG
                     VPLSEDPLPFVRSLMGRHSSGNLISPAFGGGTANAEFELLTGMSSSFAPDGAFPYQHY
                     VLRPVDALPSLFRRAGYQTVAIHPFHSFYWSRDVVYPLLGFDSFQSLTDFPSPRLEGP
                     WVSDEEVVDHILHELSDERQPRFIMAVTMSTHGPYNLPLTGEEKIEVQGDTLSADNRL
                     LLKNYVHKLRQMDKAVERLVRRLEARERKTLLVLFGDHLPMLGSDYATYREAGYFQEP
                     WTDAQRERMAEVPVVLWTNFPAPREELHMSISMLTPRILETAGMRPPGFFAFVSELSK
                     VLPVVRGDLLRDASGEYLPTGDKIPQAPEPGSWADWMRRYRLLTYDRLAGDNFSAAQA
                     AGTVSQDSR"
     gene            complement(825660..826682)
                     /locus_tag="LILAB_RS03410"
                     /old_locus_tag="LILAB_03490"
     CDS             complement(825660..826682)
                     /locus_tag="LILAB_RS03410"
                     /old_locus_tag="LILAB_03490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="WP_013935792.1"
                     /db_xref="GI:503701716"
                     /translation="MREANAVGSRRKTAARDTPECWGGVDLGGTKIEAVVVDRAGTVL
                     GKLRQPTPADGEPGDVVRAIHDTLEGAAHAAGLTARQLLGVGVGAPGAVNANEGTLAH
                     VSNVGRGWTAPYPVAGELGARVGCPVALGNDVQVAVAAEYRLGAGRPYRSLLGVWWGT
                     GVGGGLVLDGVPWRGRGAAGEVGHMVVKPGGARCGCGRRGCLEAYAGRASMERRARTA
                     VRHGEATVLFDVMRKKGRTRLTSSVWARALAHEDALATWLIGRAVRMLGVGLASAINL
                     LDVEAVVLGGGLGTRLGPEFAGRIHEAMRPHIFVPERQPPVRVAELGELSGAIGAALL
                     AQPPLG"
     gene            826909..827463
                     /locus_tag="LILAB_RS03415"
                     /old_locus_tag="LILAB_03495"
     CDS             826909..827463
                     /locus_tag="LILAB_RS03415"
                     /old_locus_tag="LILAB_03495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935793.1"
                     /db_xref="GI:503701717"
                     /translation="MDLIGQLSQQLGVNGTQAQGLAGSLLKMVQGTVQEKLGPDAASQ
                     MGQAVPELETWRQAPSATSAPQTAPDAGGGLMGALGGLMSGQEGGSGGMLSALGGAAG
                     HAGDVAAVAALLGRFNIDASKASLVAPLLLNFLKSRLDPALMGRILSAVPLLAGAGGG
                     GDTPGGGGGGLGGLLGGLMGGGGR"
     gene            complement(827465..827731)
                     /locus_tag="LILAB_RS03420"
     CDS             complement(827465..827731)
                     /locus_tag="LILAB_RS03420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709189.1"
                     /db_xref="GI:760026057"
                     /translation="MKPPTRRSASVRTASTHAVRGVLSPALMLLYSLRHVSHWLLSQR
                     RVDLALDLYRRGLPLHLAVPRWRYMLGFPPWAVATTVRQRVTGR"
     gene            complement(<827889..>828542)
                     /locus_tag="LILAB_RS03425"
     CDS             complement(<827889..>828542)
                     /locus_tag="LILAB_RS03425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551158.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_043712358.1"
                     /db_xref="GI:760029309"
                     /translation="DFEVLVVDDGSTDDTLELLARYGGRVRVLGQPNAGPGAARNLGI
                     QEARGTYVAFLDSDDVWFPWTLATYRRVLEAEGGTSLVLGTSTLFSRVESLAGVAREP
                     LQVLRFTDYLASAGDRTPRTACVLAVRTEALRRVGGFTPLRISGEDYDLLYRLGTEPG
                     FAWVRAPVVVGYRQHEGSTSTSLESGYRGTRYLLEQERLGRYPGGAARRRERPLLLQQ
                     "
     gene            complement(828634..829584)
                     /locus_tag="LILAB_RS03430"
                     /old_locus_tag="LILAB_03505"
     CDS             complement(828634..829584)
                     /locus_tag="LILAB_RS03430"
                     /old_locus_tag="LILAB_03505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_013935795.1"
                     /db_xref="GI:503701719"
                     /translation="MKKPDLVISIVNHSNPELLHDCLRTLYATTRDCSFEVWIVDNAT
                     GGRGVDAMRRDFPQVRWLFNSERKGFSANHNQVLRQARGRHFCIFNDDTIVHEGAFDA
                     LVRFMDDNPRVGMAGARLLNADGTIQNCTFRPMSLAGQLFDLVFLPRPLHFLKAMAID
                     PAQYGHDEARVNWVLGACIVVREEALAEVGLLDEQLSPLGNTEDTDWCVRAWKAGWEV
                     AFCPEAVITHLTSRSFRPSDTGADKVRIELWRTRLAYFRKHHGRLHEAAMRAILVGTL
                     PYNSAVLTQTLLRGRMRLPEYRKQLATFLGISQMGLRARV"
     gene            complement(829581..831071)
                     /locus_tag="LILAB_RS03435"
                     /old_locus_tag="LILAB_03510"
     CDS             complement(829581..831071)
                     /locus_tag="LILAB_RS03435"
                     /old_locus_tag="LILAB_03510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_013935796.1"
                     /db_xref="GI:503701720"
                     /translation="MNATAAPEASAVEVKARALKGMFVLAARTVASQGLRVVSALFLS
                     RLLFPSDYGLFGIVSYAASLGVFLGDLGLSAALVRQPHEPTRDETFTIFWCHQALTAA
                     VVAVVCLLAPQLTRGYALGDGAVPMVWALALGLFLSSLRVIPLMALERQLAFPVIARA
                     ELIENVVQVITTISLAALGFGAWALALGGLVRGGVGLVLIWWASPWRPRGRFRVDVLR
                     RLLGFGLAFQLPPLVAAMVAGWVPLVVGHLLGKDAVGLVNWAWALASTPMMLSVVLNR
                     VAFPAYCRLQDDPAGFADYLRTSLRRLSAVLLLAIPVAVLAVPVAVPLFFGARWVPAV
                     VLVQWFSLECILTTLVGLLATAQNAGGRPWERLAVVVGVGAAKWGLGTWAIQRFGLEG
                     MGPAGVAVGLAEVWVTAWLVERLNPAMRGLARQVVEPFVTLGLLLLGACLAAMRLVEE
                     GVVAQALVGAGVFATLVYVRERLPGTLPVLGELRQILEFVRARRRQ"
     gene            831265..831933
                     /locus_tag="LILAB_RS03440"
                     /old_locus_tag="LILAB_03515"
     CDS             831265..831933
                     /locus_tag="LILAB_RS03440"
                     /old_locus_tag="LILAB_03515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013935797.1"
                     /db_xref="GI:503701721"
                     /translation="MLPGGNVLQFLKREVLVGEHEVLHRTLKEALVGTCDSVLDIGCG
                     SRSPLHSFSHLLPHTVGVDGHPTSIERSRAAGIHREYHCMDLLEAGRHFGPKRFDAVV
                     ALDVIEHFEKQDGFRLLEMMESLARKRVIIFTPNGFLPQDEWDDNVHQVHRSGWEVYD
                     FELRGYRVTGMSGWKPLRGDYALPRIRPFRLGSRLSILTEPFATRWPQHAFQLLAIRD
                     MEAS"
     gene            831943..833091
                     /locus_tag="LILAB_RS03445"
                     /old_locus_tag="LILAB_03520"
     CDS             831943..833091
                     /locus_tag="LILAB_RS03445"
                     /old_locus_tag="LILAB_03520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935798.1"
                     /db_xref="GI:503701722"
                     /translation="MPPPRTAPAWHVLTGEYPPRPGGVGDYTRQVGRALAGAGQEVHV
                     WAPGEGGVRDEDGVTVHRVPGLLTPAGLPGLSRGLDACPEPRRLLLQYVPHAFGMKAM
                     NVPFCAWFAARRKDARWVYVHEAVHPWSPRGPWRHHVLAGTTRLMVRMVASAADRVFM
                     SIPQWAAHLPARVRPHATWLPVPSNLPVEVPREAVDALRSALGAGPWLGHFGTFGRLT
                     AEPLEAALVPLLRKDGTRRALLLGRGSRAFVEGLETRHPALSGRLVARDSLTLDAIAV
                     HLAACDVMLQPYPDGVSTRRTTVMAGLALGLPVVTHTGHLTEPLWRELGAVALAEGTA
                     PAALVECAEALLSPSDARRELGQRASRIYREHFALERTVDALLRAAPT"
     gene            833088..834248
                     /locus_tag="LILAB_RS03450"
                     /old_locus_tag="LILAB_03525"
     CDS             833088..834248
                     /locus_tag="LILAB_RS03450"
                     /old_locus_tag="LILAB_03525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_043709192.1"
                     /db_xref="GI:760026060"
                     /translation="MRPHSAPRLALLMDPREEGWPSMDLVGEALLAGLAAQTSEVRAE
                     ALRPSMPEVARRLPRVGLRNAAFNADRVLTRFGLYPGRALLARGRYDVFHVVDHTYAQ
                     LVHALPASRTGVYCHDMDAFRSVLEPHREPRPAWFRAMARAQLAGLERAAIVFHSTQA
                     VRSELLAHGVVPESRLVWAPYGVSPEYRPEPAGALDDSEAVLAPLGGRPYLLHVGSAI
                     PRKRLDVLFAVFAALRSRHPELRLVQQGGVLNDAQRAQVEALGIGDALLQPARQERAT
                     LAGLYRNAAAVLVTSEAEGFGLPVIEALACGAPVVASDLPVLREVGAESCTYCPVGDV
                     PAWVGAVSSLLTGSGAQPSREARLSRAARFTWAAHARTVLDAYLRLLDTDSP"
     gene            834361..835620
                     /locus_tag="LILAB_RS03455"
                     /old_locus_tag="LILAB_03530"
     CDS             834361..835620
                     /locus_tag="LILAB_RS03455"
                     /old_locus_tag="LILAB_03530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935800.1"
                     /db_xref="GI:503701724"
                     /translation="MRLFFLNPVGILGGAERALLDLLACLKQQDATLSLHLRAGTAGP
                     LLDEARALGVDARLLPLPEQLSTLGDSALRGHGPLEALRFARRLAPAPGHLADHGRAL
                     RRDVAEVSPDLVHSNGIKTHLLSAATAGLPLKRVWHIHDFLGERPLVRSALRLISPLA
                     SAAIANSRAVGDDARQVLFRVPVHVVYNGVDTAHFSPGPMDGARLDLLSGLPTAPAGT
                     LRVGLVATYARWKGQDAFLEAAATLTRLYPALSVRYYLVGAPLYQTPGSQFTEEELRR
                     LITSRGLSERAGLVPFQSHPASVYRALDVFVHASTRREPFGLTIAEALACGRPAIVSS
                     ASGAAEALTDGVDALLVPPGNVHALVQAMRALLDDPALRARLGTAARLTAASRFSRER
                     YASEVLALYRTLARSSPPAEGRGVPVH"
     gene            835617..836768
                     /locus_tag="LILAB_RS03460"
                     /old_locus_tag="LILAB_03535"
     CDS             835617..836768
                     /locus_tag="LILAB_RS03460"
                     /old_locus_tag="LILAB_03535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935801.1"
                     /db_xref="GI:503701725"
                     /translation="MKRARRLVTLSHSYVVGLNRRLANEMALVGAGTWDVTTVAPRFF
                     HGDLSPLTLQLEAEEAARTEGVRAFFSRSLHAFLYGPEVRAHLASSADLVHAWEEPYV
                     LAGLELALLTPRRVPFVFCTAQNLSKRYPPPFAQAERVVVQRSAGWVAWGETVKDNLL
                     TRPGYAERPARAIPMGVDVDLFHPNRAQGESLRQELGWATSGPPVVGFLGRFVPEKGV
                     PLLMAALDALGTPWRALFVGGGPMEGALRDWAARHGDAARVLTGVPHHGVPRALNAMD
                     VLCAPSQTTPQWREQFGRMLAEGFACGVPVLGSDSGEVPRTMGDAGIVLPEASVAAWT
                     QALASLLESPERREALAARGRERAVTRFAWPVVAKAHLDFFTELLERRG"
     gene            complement(836770..837912)
                     /locus_tag="LILAB_RS03465"
                     /old_locus_tag="LILAB_03540"
     CDS             complement(836770..837912)
                     /locus_tag="LILAB_RS03465"
                     /old_locus_tag="LILAB_03540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_043709195.1"
                     /db_xref="GI:760026063"
                     /translation="MRRPYTLIAGDFVDTGGMDRANLALALWLAKQGHPVRLVAHRVA
                     DVLLGHANVRFVRVPKPANAYLLGEPLLSAAGRAWALRTRAEGGRVVANGGNCPVASA
                     NWVHYVHGAHASSPTGGVLRQLKGRVSHRYYVRSERRALRRARVIIANSERTRDDVVA
                     ATGVPASRVHVIYLGGDAERFRPASPEARRAARAALGWPESRPVALFVGALGDRRKGF
                     DTLFQAWARLCARADWDVDLKVVGSGAQREAWEREAAARGLGARIQFLGFREDVPLLL
                     SAADVLVSPTRYDAYGLNVHEALCAGLPALVSRSAGVAERYPAALAGLLLDSPDDVGL
                     LARRLEAWRENAAAWAPHVAALSESLRAQTWDTMAEAIVDVVEREG"
     gene            complement(837881..839332)
                     /locus_tag="LILAB_RS03470"
                     /old_locus_tag="LILAB_03545"
     CDS             complement(837881..839332)
                     /locus_tag="LILAB_RS03470"
                     /old_locus_tag="LILAB_03545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935803.1"
                     /db_xref="GI:503701727"
                     /translation="MTVPQLQGPGVLRRRYVRRAPGASLEAVPEGAPSAMRRATAGGG
                     LLASGRLVPLFVCLLIGCQLALLVEAIAPLRVAVRVLAFGVSLALLVLVRGRSLKHPA
                     LPFILAALGVTALQFFNPGTGAPLAAVAQVGIQLAIAAPLLWVTRLSIDPRTFRRTLA
                     LLFFFNAASAGVGVLQVYFPGRFQPALSSAVQGQGQGYVNSLQFETADGVRVFRPMGL
                     TDIPGGASTGGFYAVLLGGGFLLSARRGLTRVLSVGGILVGLFGIYLSQVRATAVMLL
                     VCLVALAGVLLVSGRVGRFLALLAVMGTAGVATFGWAVAVGGDTVMQRWSSLFESSPD
                     EVYHRNRGYFLTGTFTDVLPEYPLGAGLGRYGMMNAYFGDHGDRERPSLWAEIQWTAW
                     VYDSGILGVLLYPLGLLMSLAFAFRVARSRDGPRSEFWLWGSVLFAYNLGALAFTFSY
                     PFFMSQTGMEFWLLNAALFGALAHEKTVHAHRR"
     gene            complement(839329..840468)
                     /locus_tag="LILAB_RS03475"
                     /old_locus_tag="LILAB_03550"
     CDS             complement(839329..840468)
                     /locus_tag="LILAB_RS03475"
                     /old_locus_tag="LILAB_03550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935804.1"
                     /db_xref="GI:503701728"
                     /translation="MSRPLRVLHVSSGNLYGGIETLLHTVAREQGRHPALAHAFALCF
                     EGRLSQELRDAGAALHVLGPARTGRPWSVWRARNVLRELLRAGRFDGVICHAIWPQAL
                     FGPVVRAAGVPLVFFQHDALSGAHWLERWARVTPPDLVLANSRFTAGTLASVYPRAPC
                     RVSHCPVPAPPPALAPAERARLREELGAAEGDVVILQASRMQSWKGQRLLLEALGRLR
                     RVPGWCAWVAGGAQRPEERAYLDGLRAQAKQLGVEDRVRFLGQRSDVPSLLRAADLHC
                     QPNVKPEPFGLAFVEALQAGVPVVTTGMGGALEIVDASCGVVVPPEPGALARALAALI
                     ENPRTRAALGAAGPARALAVGDAGAFLRGMEEALRALSGPQEVSA"
     gene            complement(840465..841715)
                     /locus_tag="LILAB_RS03480"
                     /old_locus_tag="LILAB_03555"
     CDS             complement(840465..841715)
                     /locus_tag="LILAB_RS03480"
                     /old_locus_tag="LILAB_03555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013935805.1"
                     /db_xref="GI:503701729"
                     /translation="MNAPAAGAGLRVLHLGKFYPPASGGMEAHVQTLARAQAALGAQV
                     EVLCANHSAEGAGTSHEFQGRSPTRESWDGPVRVLRLGRLASVARMDVMPDLPRALGG
                     ALARGVDVVHLHTPNPTWVLALDAVRRLPPVFVTHHSDVIRQKVAGALFKPFEALLYA
                     RARRVLATSAAYVPGSPLLRAFRGKVRALPLGLDLAPYLQPSAAAREAQARWREQAAG
                     APLWLMVGRLVYYKGLFTALEALARVPGRMVVVGQGPLEAETRRRARALGVADRVTWA
                     GYLPPDALVGALHAATALWFCGNARSEAYGLSQVEAMASGLPVLNTAIPHSGVAWVSL
                     HEQTGLTVPVGDAAALAAAARRLVEEPGLARRLGRGARERAVAEFRHDVMAWRSLSLY
                     AEALGRPTPSGAPEDLPRRLAGSA"
     gene            complement(841712..843904)
                     /locus_tag="LILAB_RS03485"
                     /old_locus_tag="LILAB_03560"
     CDS             complement(841712..843904)
                     /locus_tag="LILAB_RS03485"
                     /old_locus_tag="LILAB_03560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020478169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013935806.1"
                     /db_xref="GI:503701730"
                     /translation="MDGTGFDPAGGAGGLTPSGLMQHLRAVWRRKWVVLGVAVVVVAL
                     TAAHTLRQPKVYSASASLIIDVMAPRFLDGEVKEVMGEERSNYWFNKEYYATQSQIIT
                     SRAVAGRVVDKLGLSTDADFLGLAHVTDEKARLQAMQGADAVALLQSRIRVIPAKDSR
                     VMNIAVDDFDAKRAALLANEVAAAYMAENLALKLRTTDDARDWLEVRLAELESQSKTS
                     ELAVYDFKKDADMLSTSLESRMSIVSERINSFNLKLTEVRIQIAAQQARVEAIHRLRK
                     ASPEDETWAEALPGATDGPIQDLRRSYTELRVTCAELGERYLAEHPKLLECNRKLSVV
                     REDFLKSLNNVVRGAETALAEAVAQEKNLVRLLDAEKAEAFLVNKKAIEFDRLKRDSD
                     NNQRLYELVARRLKDIELSGMLRTSNVRVLDAARPILLPMKPHVRRNLAVGLVMGLLA
                     GLGVVVLLELLENSVATQADVEERLGLAFLGVMPRLEASKAPRERDLHVHREPKSTAA
                     ECCRAIRTNLLFMSPDNPFKTLVVTSSGPQEGKSTTSISLGVAMAQSGNRVLLLDTDM
                     RRPRLHRAFGVPNELGISSLVVGEGTLDAAVKSTEVPGLFVLPCGPLPPNPAELLHTQ
                     AFTDLLKAASERFDRIILDSPPINAVADAAVLATKSDGVVLVLKAAKTNRESARRALR
                     SLADVQARMYGAILNDVDLSAPRYGDSYLGYQGYGQYAEESKDGVAQS"
     gene            844110..845456
                     /locus_tag="LILAB_RS03490"
                     /old_locus_tag="LILAB_03565"
     CDS             844110..845456
                     /locus_tag="LILAB_RS03490"
                     /old_locus_tag="LILAB_03565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013935807.1"
                     /db_xref="GI:503701731"
                     /translation="MTPPLSFVLPFSPDTAAAASRFAHALPPGAEVVLAGEGSIDAAA
                     SPHVHVLSVPGGKGAAIRAALEKVTGPVTVLQDPDTSYPRDVYEALVRPIQADTADAV
                     FGLRTSQGLAPELLAERALGHVTRFVADVALTDPLTGLRAFRTEALRSVTLTSDDDAV
                     DAELVVKLAAQLFRLTEVTLPPGAVPRRTPAAHLSRLKTLVRYATVRDDADNQHEGYT
                     TLERMDGAVHYNQWLGRRFREHLGRRVLEIGAGIGTITRELESGLELLIALEVDRFYV
                     DRLKNLFRGKPHIRPYLSDVALADWEALKTERLDTIVLSNVLEHIPDDAAAVRRFKQI
                     LAPGGRVVILVPALQQLFGAIDEAVGHYRRYTPSTLRAVLEENGFQVETLEWMNLAGL
                     PGWFVNSRLLRRRSVPKLQLKLYDTLAPLIARAESHVKLPVGMSLFAVARATGADA"
     gene            845670..847379
                     /locus_tag="LILAB_RS03495"
                     /old_locus_tag="LILAB_03570"
     CDS             845670..847379
                     /locus_tag="LILAB_RS03495"
                     /old_locus_tag="LILAB_03570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935808.1"
                     /db_xref="GI:503701732"
                     /translation="MNTSPVPSDASPTPAVAPVSEPGRASRPGASPAGAPRAVWAALA
                     ALYVLLFPYHPGLRSPNELCRLWQTRALVEYGTLHINQALHDYGKVGDLSVKDGKYYP
                     SKAPLLSFAAVPIYATLRAVGGGHRHAVPEVPLVFFSRLLLTVLPTLGLLWLVRRYLR
                     AALEPLVADALTVTYGLGSLAFSYSLLFMSHQTTAVLLFASFYALWRCARGEWRERGY
                     LVAGACAGATVAAEYTGALGVLGLVLYAVLTFAFQPVPARERWVRLGRAAGLATLGAL
                     PFLLALMAYHQVTFGHPLTSGYKYLNDAGYQPWHLGGFLGIRTPDPRAFTLSFFSPLR
                     GLFTLAPFLLLALPGLVLVWRRRSQSPEARALAWLGLALLAGYTYFTSSFSYDSWGWT
                     TGPRHLTGLVPFLLLPAGLLLERLRAAGRSTWALGAAALLCAVSITVTGAATFINYIP
                     DDVSNAVGALALPLLRAGYFPPGVLTFVGLPPALTGTVLVALLLGTAGWVYVSLSRAP
                     GQQWPAPPALGAALALLLLIGASHVFTTRHDTADRNAVRFLQSVWLNAPERAVTFWPR
                     GRG"
     gene            847643..848362
                     /locus_tag="LILAB_RS03500"
                     /old_locus_tag="LILAB_03575"
     CDS             847643..848362
                     /locus_tag="LILAB_RS03500"
                     /old_locus_tag="LILAB_03575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935809.1"
                     /db_xref="GI:503701733"
                     /translation="MRCHPTRKPASALRAARGFTLLLALGLIALVTAGVLVSLRAVNA
                     ESTLQAHERRSREALFAAEAGLAEGRAVVLAMLNAPVSGSTGNYNQDVLPRLQVVAEA
                     GLPDVASGGVPWRELIPQTPYTLARGTALDETVTAPSTEINDVEGTPIRAYPEARGVS
                     YRVFVVEDDDDADRDADANGRIWLVSVGEVQPAGTGLPYRTIIRSLLEHTSTQGGLAC
                     SYGTKMGCRGTGTSGSGLPTF"
     gene            848439..852806
                     /locus_tag="LILAB_RS03505"
                     /old_locus_tag="LILAB_03580"
     CDS             848439..852806
                     /locus_tag="LILAB_RS03505"
                     /old_locus_tag="LILAB_03580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilY"
                     /protein_id="WP_043709199.1"
                     /db_xref="GI:760026067"
                     /translation="MRWTRTWMAALAVAAAGAVLAQGPSGDTGGGGSDGGVSSLALCI
                     DTADQDKQPDFSRDAGIPSAIIVTDDDPPKLRLNTNLNALDPEKIILPFEQDLTALIV
                     DDRAGSGASSTLGWFYYDELIDAGYVDDNGTQDTSDDDRLLDTNHNGVPDFHEDLYNL
                     NPSHYIGSEGPRCNRTFTHQRWGDAGTVTLREPDLLMGPCNAGGNYTANTGPRRWQGG
                     AGYPAQPTTGGVVGRRVRDFASTLLAYDSYHGRDNLRPSAVTSGAIDTYFSDRGLFPH
                     IPNLLEPRHALNGNRGIGNLIFLSTDDDETWCHESESAECFAPRQGWTLDNNGQFTRT
                     GTAWDKSDDGDGIPDYKASAFDSAGRLITGRNPAAAITKAEDQVVPLGRLAGNREIVF
                     FLVTYVEQIYGPATDSCFITRPTTDGRQVQCDLWMHGDINVFFTKTPLNLDLHQSTDP
                     LVVDRKNLRSEWLDGRAYGRLENDPAYGGVVFPNDQTQNVHSVNRRAAHTLVGAPRDN
                     PLVWILGWEDQNAGGDRTYSDIVILINKQNNGSFRSDVVSDISPDISLDFTITEVTFT
                     VEDQPYYAADGGSLAPCSRAVPLPDGGMGQRHPDITYEVALDCKVCQEPCDTAHPTYV
                     QNDSPNWLRVPIPDSDGGVRNETAVLQEFLEQGRVGTQLCWRAVMESPGEACQPTIHN
                     INVSYKAQRSGEYGRASLIPMANAVVHGVYETPGRTWVADGGVDQVSIRTYDNRPDTI
                     DRGHLYLKKLYEPATLAPHDPAEEVWDSGKWLRDLMRDLEPQPQDPLNARKLVTLNPA
                     TRQAVAVKDLMARNATSSPVFPDSLCTRRNGSVYLYDLDGRNGCTADDRLALRDWLYG
                     WEDRHASTLRNRMRTWPLGGVNLSTAAVIGTPNVPAWLLEGRNLDAERQKFVENFRAP
                     NADRRTVTYVGTTQGYLHALGTGHFRTGDDPCTPGRIEYQGYFGRSGGCGSDNDYGLG
                     SELFAYLPYKMLPYYVENYRRANDDYATERATLDASPSVADVDLRGTDYRADTGHDPR
                     DTDEAWRPRSAWNEGAKTVLASATGPRQSIFFALDITNPADPNYPAPLWEFDMKRDRF
                     TPAGAPCTTTGNGCAPLASYFTGATPKPDTRGSRHAPSLVRMDFGADGGKKWVSMFGT
                     DYATDAGAVGTVYLMDLKTGLPARVRGSGARAQLAGVVTLGTTADVGEGIGGEPIPLD
                     VNGDGSVDVIYVPSTSGKIYRINPTWSNTGSSTQLGKVLASCVVADAQAVPGIRNPSS
                     QRIYSSISASVATDGSRRVRLYFGTANNPDIANEPEDTADPRPRYHLMAFEDRHPVPS
                     QRPGAQCPAHFEWARELGEGQVVWGGVSTTQDGVFTTSAVGRAASACDLDSTTSGRVY
                     AYSTAGAPLAGNDTPIDGHGTHAPVLYDNHLLIVKNGQVRALGSGPYNNPTSESPRSS
                     SRVLIWDVRSGSRVQEVVP"
     gene            852803..853339
                     /locus_tag="LILAB_RS03510"
                     /old_locus_tag="LILAB_03585"
     CDS             852803..853339
                     /locus_tag="LILAB_RS03510"
                     /old_locus_tag="LILAB_03585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935811.1"
                     /db_xref="GI:503701735"
                     /translation="MSRRRRHAHPRGLSILETLVTAAVLMLGILGILLTLGTASRHNR
                     RNNNLGQASLIAEQELERVVNLRCVGEPLSDPCVNIKQLDNTGRDVWWSANGRMSETP
                     PVPGAPPRMAYALRLDVDPPFEGAETGEPALSRAIPLPHASNLAPHQVINVRVTVSWQ
                     EAPGAPRRAVALQTRMAP"
     gene            853336..854538
                     /locus_tag="LILAB_RS03515"
                     /old_locus_tag="LILAB_03590"
     CDS             853336..854538
                     /locus_tag="LILAB_RS03515"
                     /old_locus_tag="LILAB_03590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin cleavage protein"
                     /protein_id="WP_013935812.1"
                     /db_xref="GI:503701736"
                     /translation="MKRLRSTPRRGFTLIELMVAAAMSMVVLAAAIGVSAHLQRRGLL
                     EERIMETQNKGRAARDLMAFGVQRAGAGIGSVSLTGGRLPSGEADLFHAVWARPRATF
                     ADDPGFAPPDDPSLLSDALEVWETDPARMVFLEQCPLPAVAAWNEDTLCLGGPPPAFL
                     DDAVIAVVFPGTDDARGWACVGQVTNLVAEGVEWAPGIPGRAAPAEGDCTLAAATAGS
                     PWAGTQRPDEGGMYLLPLGSRSYRVNWASGPPVLEMDADGPAGPAGYTAVSQDIEQLQ
                     VRLGVMAPDAPPDTPVRFFPDTETGRPSLATCTQATCATHVSWAWDPGVPVPPDRGPG
                     SAGDELMRHVRVVELSITARSERVERLGNEAPGARDDEGNLRDGYKRRHSVIRLAPRN
                     FAFDRTGG"
     gene            854540..855184
                     /locus_tag="LILAB_RS03520"
                     /old_locus_tag="LILAB_03595"
     CDS             854540..855184
                     /locus_tag="LILAB_RS03520"
                     /old_locus_tag="LILAB_03595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin cleavage protein"
                     /protein_id="WP_013935813.1"
                     /db_xref="GI:503701737"
                     /translation="MERRSKGLTLLEVMVVVALVGLFATVSVASFQGMTERQRVSGAQ
                     RELVMMLQEARQKARATHQPVRLGLRVAEEHGVQVTRLRWEALACEDTWGTVCPTAAC
                     QDNACGVSGCVCPEVGPELVIPPRLDVSLLVGLCWMEATDGNSPIVAPAAPGGRACEP
                     AADAPSTERLVLLRDHGTPEAPDWKPELVFQADRLTAAVRPVDCDKHASTPGCQ"
     gene            855291..855620
                     /locus_tag="LILAB_RS03525"
                     /old_locus_tag="LILAB_03600"
     CDS             855291..855620
                     /locus_tag="LILAB_RS03525"
                     /old_locus_tag="LILAB_03600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_013935814.1"
                     /db_xref="GI:503701738"
                     /translation="MMKRFVLVLSLTLATGAHAETVADVWKAKCAMCHGADGKAQTKM
                     GQKASIGDMSRPDWQKARADAELREVIAEGAPRNRMMKPFKDKLTPAQIDALVGYIRT
                     FKAPSGP"
     gene            855672..855989
                     /locus_tag="LILAB_RS03530"
                     /old_locus_tag="LILAB_03605"
     CDS             855672..855989
                     /locus_tag="LILAB_RS03530"
                     /old_locus_tag="LILAB_03605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935815.1"
                     /db_xref="GI:503701739"
                     /translation="MKNLTVAVVFCLSMASLFTSLRADALSSVHIEQGLSAAQPLSLR
                     PQGDDKGSGDDKGGKGGEEDEEDYRKRRYAGLSQQAALELVDPGALTDVIRLQAAVKF
                     GQR"
     gene            complement(856009..857448)
                     /locus_tag="LILAB_RS03535"
                     /old_locus_tag="LILAB_03610"
     CDS             complement(856009..857448)
                     /locus_tag="LILAB_RS03535"
                     /old_locus_tag="LILAB_03610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935816.1"
                     /db_xref="GI:503701740"
                     /translation="MVVLRSVRSAAGGIVDFECVSANVQAERWLGGEEGSLVNNRLLE
                     EAPWVWDGGLFSACVRAVTRRAPEVARVSRQSPLGTMWLLARVSPCDDGVVLFLEDLT
                     ERMAAEEALRRDHDLLHAVIESATDAIYVKDVAGRYILINPATASAFHRAPRDILGRT
                     DAELLGADRAAPTLAHDREVMDSGQTATYEGAEGGPGTDRIWHTTKGVLRRGDGTVYG
                     LFAICRDVTARRRQELEREEEARFQERFIGVLGHDLGNPLAAVRLSSAALLARDTLPP
                     EVRRVVARIDGSAERMARLVKQLLDFTRARMAGGIPLRPHEVCMEDVCRRIISELEPA
                     HPECSVRLEVDGESRGVWDEERLGQVLSNLLGNALQHSPEGSPVQVRLAAKDPLFQRV
                     EVHNGGPPIPEALRTRLFSPFHGMPPEPGKPKPKHQGLGLGLYIVSQIVTAHGGWLDV
                     ASSVETGTCFSVTLPRVTRPLGGPPGKSA"
     gene            857719..861285
                     /locus_tag="LILAB_RS03540"
                     /old_locus_tag="LILAB_03615"
     CDS             857719..861285
                     /locus_tag="LILAB_RS03540"
                     /old_locus_tag="LILAB_03615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_013935817.1"
                     /db_xref="GI:503701741"
                     /translation="MDTPFTQTQDGGAAGDPFAQVVDGLRAGQRVRTQGLKGAARGHV
                     LARLHGALKAPLVCVAVDEEAADALAADLSFFLGGQGSLLAPRVLRLPADEVLPYDEV
                     SPDAAAITERLGALYHLGQGTRFPALVLSVRALHRKVLPLEVMRALAARVTVGQDFDR
                     DSLARRLVRMGYQNSPLVEDVGTFSVRGDLLDVFSPLYDKPVRLEFFGDTIESIRAFD
                     PQSQRTVDALKEVDLVPAREVLLTDETRPRAEAAARAVADRINLPTIKLREHLDALRE
                     GLPGFGLEGLLPGFFEGGLATLFDFLRDWSPEAPVLYLDDPLGQERAADTLWEELERS
                     HSAAEARQELICPPLEHFLSREEVSQRLRSFRVLEGGGLSLAQTERPPVHFSFGGTQD
                     LREAILAHHGEEGALSPLVERLERWRELRVACVVACGTLSQADRLKRLLMDRNVVVKV
                     HTEPLEDATSLYEPSIRAHLFTGEVSHGFVDGPGGLAVLADEEIFGVRARRRPRRSKK
                     LDAFGSGFGDLKEGDLIVHTDFGIGRYAGLTKMEVNGVPGDFLILEYAGRDKIYLPVG
                     RMRLIQKFSGGDPSQVQLDKLGTTSWEKTKKRVKEQLLKMAAELLQIAAARKAHPGHA
                     FSAPDRYFAQFEADFEFEETPDQAKAIEDVLADMQKAEPMDRLVCGDVGYGKTEVAMR
                     AAFKAALDRKQVAVLVPTTVLAQQHFLSFKKRFKDYPVTVEVISGLKKAPEVREVLKR
                     AKEGKVDILIGTHKLLGGEVAFKDLGLMIVDEEQRFGVKQKESLKKWRSQIDVLTLTA
                     TPIPRTLHMSMSGVRDMSIIATPPQDRRAIRTFVMKYEDQVVKEAIEREVARGGQVFF
                     VHNRVESLPSIETQLRALVPQVTIGVAHGQMGEGQLEKVMLAFTEKKYQVLLCTSIIE
                     SGIDISSANTMIVNRADQFGLAQLYQLRGRVGRSKERAYAYLLVPSRRAVTKDAQRRL
                     EVLQNFTELGAGFSIASHDLEIRGAGNLLGDKQSGAIAEIGFDMYAQLLEEAVAEMQG
                     QPPKVQIEPDVTLPMPALIPDDYVSDVHQRLVFYKRFSQASHPDEVTDLRAELVDRYG
                     EAPDEVDHLSELTLLKIDMRDLRLRGLEVGTTRLVVTLGADALLDGPKVAGLVQRSKG
                     VYRLTPDMKLIARAPQGASGHDLIAEAKKVLRDLSHCALPQA"
     gene            complement(861501..862643)
                     /locus_tag="LILAB_RS03545"
                     /old_locus_tag="LILAB_03620"
     CDS             complement(861501..862643)
                     /locus_tag="LILAB_RS03545"
                     /old_locus_tag="LILAB_03620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_013935818.1"
                     /db_xref="GI:503701742"
                     /translation="MSDTLPALRATLTELVAMDTTSFRPNAPLIDYAQARLEAAGFSA
                     ERQKFTDDAGVEKVNLIAVKGGTGSGRAALALVGHSDCVPYDAAWTDALRLTEKDGRL
                     YARGACDTKGFIACALHAALNARDLKAPLMVVLTADEEVGLTGAKKLVEAGLGRARHA
                     IVGEPTRLIPVRANKGYCLAEVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTV
                     LREDLDEGFQPPFTTVNVGVIQGGKAKNVIPGACRFVVEWRPIPGQPPERVSQLLETI
                     RQELVRDEPAFEAHIQVVRTDRGVNTRADAEVVRFLAEASGNAPETVSFGTEAPQMTE
                     LGAEAVVFGPGDIRVAHQTGEYVPVEDLVRCEAVLARAVAHFCGGR"
     gene            complement(862717..862953)
                     /locus_tag="LILAB_RS03550"
                     /old_locus_tag="LILAB_03625"
     CDS             complement(862717..862953)
                     /locus_tag="LILAB_RS03550"
                     /old_locus_tag="LILAB_03625"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935819.1"
                     /db_xref="GI:503701743"
                     /translation="MKDTLDCGIRETKGRDNGDRFFVHTWGGTNGDGYHGVFYVGAVN
                     AAAPAVHKGLGRPGAGDKSLSPMEAPVPRLAVVR"
     gene            complement(<862953..863396)
                     /locus_tag="LILAB_RS03555"
                     /old_locus_tag="LILAB_03630"
     CDS             complement(<862953..863396)
                     /locus_tag="LILAB_RS03555"
                     /old_locus_tag="LILAB_03630"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1DG16.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_013935820.1"
                     /db_xref="GI:503701744"
                     /translation="MEFPNCTVVDHPLVKHKLTQMRRVETSTASFRALLQETSLLLAY
                     EALRDLKVREEDIQTPMARTTAPVLDGKKLVLVAIMRAGQGILDGMLQLVPSARVGHI
                     GLYRDPETLSPVEYYYRVPGQLADRDVVVCDPMLATGNSAVAALQP"
     gene            complement(<863520..864365)
                     /locus_tag="LILAB_RS03560"
                     /old_locus_tag="LILAB_03635"
     CDS             complement(<863520..864365)
                     /locus_tag="LILAB_RS03560"
                     /old_locus_tag="LILAB_03635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935823.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_043712360.1"
                     /db_xref="GI:760029311"
                     /translation="MRATWFAVVTLMCFQVGCAARQGSTYSDLFIPDGEAIYERPLEE
                     VWPEVRRFFTENKLPYKEDKGSLVLETDWRQEFGGSKIASFWHRYMVLGKRETPTTSK
                     LWIIRITKSSSTALSPPGREVDWGVTRAVGLGPGSQNQIDVNAGTGSVAAEPGLSVED
                     FEDRFDAPQGENSFFAGAGQGSRDLVMEWRVFRSISPKLMKEENAPKPVQVAAAPNAK
                     GDTSAMDFECGLPILGLGKQVKPGGVLLLGEMHGTQEVPRFVAQTSCQTAVAGTPVTV
                     GLELPL"
     gene            complement(864442..865830)
                     /locus_tag="LILAB_RS03565"
                     /old_locus_tag="LILAB_03640"
     CDS             complement(864442..865830)
                     /locus_tag="LILAB_RS03565"
                     /old_locus_tag="LILAB_03640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formimino-L-glutamate deiminase"
                     /protein_id="WP_013935822.1"
                     /db_xref="GI:503701746"
                     /translation="MSDITVYQPEYLYTGGRFHEGRGLAVSADGHILAPDAVPEGART
                     VPLPGRALLPGLVNGHSHAFQRLIRGRTEYVAFGREADDFWSWREAMYRAAESLSPED
                     LYVASRQAFLEMALAGITTVGEFHYIHHQVDGAPYADRNTLAHAVIRAARDVGLRICL
                     LRVGYARAGFGVAANPRQRRFIDPDVETFLGSAEALVREVRSDTAVSVGLAPHSVRAV
                     TREWLAALAGSSVRSLPVHMHVAEQPKEIEACLAEHGRRPVELLSDLGLLGPGFTAVH
                     GVHLTDEEVALLGRAQATVCACPSTERNLGDGIVPADALVKAGARISLGSDSQATVDL
                     LDEARQVEGHLRLARLRRAVLDPGTGAMDGLAARLLGMATVDGARSLGLPTGVLEAGA
                     PADFFTVDLHHPSLVGALPASLLPAIVLGAEKAAVRDVVVGGREVVREGRHALAEESG
                     RAFQALSRALYA"
     gene            complement(865898..867427)
                     /locus_tag="LILAB_RS03570"
                     /old_locus_tag="LILAB_03645"
     CDS             complement(865898..867427)
                     /locus_tag="LILAB_RS03570"
                     /old_locus_tag="LILAB_03645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935823.1"
                     /db_xref="GI:503701747"
                     /translation="MRAAWFAVVTLMCFQVGCAARQGSTYSDLFIPDGEAIYERPLEE
                     VWPEVRRFFTENKLPYKEDKGSLVLETDWRQEFGGSKIASFWHRYMVLGKRETPTTSK
                     LWIIRITKSSSTALSPPGREIDWGTSRIVGTSRADRAASSRLDTGSGSVATNPILSVE
                     DWEDRMDAPQGENSFFAGSGQGSRDLVMEWRVFRSISPKLMKEENAPKPVQVAAAPNA
                     KGDTSAMDFECGLPILGLGKQVKPGGVLLLGEMHGTQEVPRFVAQTSCQTAVAGTAVT
                     VGLELPLESQTRVSAFLDSAGTEADWLKLMEAPFWRSPYPDGRSSEAVANLLEQLRQL
                     RARGLDVDLFVFDYPTMQGQAREDAMAATVRHQVESGPKRFHVILSGNIHSRTTKGLP
                     WDESFKPMGLSLKDSLDSVVSLDMAYNSGSAWICAVDSKGVKDKLDCGIREAKGRDNG
                     DRFFVHTWGGTNGDGYHGVFYVGAVNAAAPAVHKGLGRPGAGDNSGAPKEDPTPMLAS
                     H"
     gene            complement(867608..869098)
                     /locus_tag="LILAB_RS03575"
                     /old_locus_tag="LILAB_03650"
     CDS             complement(867608..869098)
                     /locus_tag="LILAB_RS03575"
                     /old_locus_tag="LILAB_03650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935824.1"
                     /db_xref="GI:503701748"
                     /translation="MRSALYAAVVLASLMTGCAAHQGNTYSDLFIPDGEAIYERPLEE
                     MWPEVRKYFTEANLPYREDRGSMVLETDWRQEFGGSKVSGFFHRYMVMGKRETPTTSK
                     LWIIRITKSRNKALAPPGRELDWGVARVVGNGGGGEAAVPGLSPEDYEDYLDAPIGEN
                     SFFAESGQGSRDLVMEWRVFRSISPKLMKEENAPRPVQVAMAPNAKGSVAATDFECGL
                     PILGLGKQVKPGGVLLLGEMHGTQEVPRFVAQTSCQTAVAGTAVTVGLELPLESQTRI
                     DAFLDSAGAEDDWLKLMEAPFWRSPYPDGRSSEAVANLLEQLRQLRSRGLDVDLFVFD
                     HPKSQGQAREDAMAATVRHQVESGPRRFHVILSGNIHSRTTKGLPWDESFKPMGLSLK
                     DSLDSVVSLDMAYNSGSAWICAVDSKGVKDKLGCGIREAKGRDNGDRFFVHTWGGTND
                     DGYHGVFYVGPVSAAVPAVHKGLGRPGAGDSSGAPKEGPTPMLASH"
     gene            complement(869177..869662)
                     /locus_tag="LILAB_RS03580"
                     /old_locus_tag="LILAB_03655"
     CDS             complement(869177..869662)
                     /locus_tag="LILAB_RS03580"
                     /old_locus_tag="LILAB_03655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_013935825.1"
                     /db_xref="GI:503701749"
                     /translation="MADKSEVARLRSLAQLDADAVGAYDAALARIPEPLVRERLNGFR
                     IDHVRHVQDLNALIHEAGGTPLELRLDLKGTAMVGLTAMSSMMGTEAALVAMLGNEEF
                     SNRAYDVALRFHWRPDVRALIEKHREDERRHMTWIREAVRTRPWEQARAAAAEGSEAP
                     A"
     gene            complement(869782..870093)
                     /locus_tag="LILAB_RS03585"
                     /old_locus_tag="LILAB_03660"
     CDS             complement(869782..870093)
                     /locus_tag="LILAB_RS03585"
                     /old_locus_tag="LILAB_03660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013935826.1"
                     /db_xref="GI:503701750"
                     /translation="MGAEALGWFSSFVLLLTIATQVYKQWKSGSSEGVSKWLFVGQMT
                     ASVGFTLYSWQVGNWVFVVTNALMLLSAVLGAVIVLKHRRAARHKRASRPRAPSGAAH
                     A"
     gene            complement(870175..870585)
                     /locus_tag="LILAB_RS03590"
                     /old_locus_tag="LILAB_03665"
     CDS             complement(870175..870585)
                     /locus_tag="LILAB_RS03590"
                     /old_locus_tag="LILAB_03665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935827.1"
                     /db_xref="GI:503701751"
                     /translation="MSLKREWRHGEQQAWFEAPDIVWARFRGAVSLETSVWSCGVYRE
                     MADTQRFYLAADITGSHLSPESRRYLVEHAKAGWFLGVVYIGAAMEQKATTKSLMVGA
                     MLSGGTRLDTAYVDSAEEARAWIAQHREAAARTG"
     gene            complement(870664..874398)
                     /locus_tag="LILAB_RS03595"
                     /old_locus_tag="LILAB_03670"
     CDS             complement(870664..874398)
                     /locus_tag="LILAB_RS03595"
                     /old_locus_tag="LILAB_03670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935828.1"
                     /db_xref="GI:503701752"
                     /translation="MTRLSRAAPLLALLAAACSDEPEPARVAEPPQTDPCTGLAALTL
                     TAQPSRVRVASPVALVATGGSGHYTYRLEPGGSSGELVGSRFLTGRTPGTDTLVVEDA
                     RCPGVSATAQVSVAATFNVAPARAELRPGTSFQVATDGVLGSASYLLTADGSGATLTP
                     AGRYTAGTREGLDVITVRDTQSGDEAVLQYEVRESARLTGAPAFLAVPSGASVPLATR
                     GGSDRVTWTKESGPGTLAGGRLTFEPGATGVAVLNAADPFTGDTARVSVRVLDELTRP
                     VLAHGRLSDVATLVTADFDGDGQLDLAVGQRESDLNQPTGGAVFIFKGGSGGLPAEPT
                     WVLTGATETAQFGDALAAGDLDGDGRAELLVSSPGADVALTNAGAVYLYTFRSGAPAP
                     LRQQLTGLLRNAAFGSGMAIADFEGDGDLDVVVGSPLGDLAPTNAIRNRGTVDIYAST
                     RSSPVPDVPTVRLGGWDLTPDGALVSRSNSELGRALVTGDVNGDGLVDLAALSKVSRY
                     NASGAVSGSQVAISVFLARAEGARFRASPDVYVLPANTADSNEGTWRLGVIPAEGTRP
                     ALLLAVADRADSPDLRSSGGLQSGNDAGGALLFDLSGYAATGEPSQRPPQVKREDAFA
                     RLYGEAGGINAGRSWAVMDVDGEPGLELLLGAPYSSAPSGVGNGTLRLSGKILVHSLA
                     TLQPGAVLNRPLTAINGTAAADTLGAGLATWGPAASPSLVAFAGRASSEQGAFTGSVE
                     LYQRQGASVAEWTRTSVRVPAKPSVERFGEAVAIAQGPQGRPLVLTGAPGWSGPGASN
                     DGNALSIGRAYVHDVMAPTQATVVAEGMPSPHHAGRNVGVDVAFSDFNGDGRPDMVVG
                     ASNFYVPGTGSTSSNNELNNTYTSVPAACVTSGTQSVGGALVSLGQTDGSFKPAYRLF
                     ATYQIKDCEPETDAKCRRTGIGRGVVGGFDLNGDGREDVGLLRNDGMEVFLGRAPEDA
                     SLAKLSMVCDSVYTMPSMDLQTSMPVSLGDLDSDGCDELAWRYAEGSRSGVAILPGFD
                     AGGSRCGGRRTATLWRIAGDSEAQLTNMGLGLGMTRAGRFLGDSRDFVAISATSVPFN
                     GVTQPVVLLFDKAVLVNRMRSLPAGSPLVVGALGDGLNPVVLVHRHRAVNFGARLVGG
                     TDLTGDNVPDLLVSAPGASEASDGGGAVFLYAGGVGQEGALSPFLMVVGDGSERSALG
                     QALSLMPGSGGSPPMLVIGAPRSYRTGTQNGTAFLLPLGF"
     gene            complement(874431..875960)
                     /locus_tag="LILAB_RS03600"
                     /old_locus_tag="LILAB_03675"
     CDS             complement(874431..875960)
                     /locus_tag="LILAB_RS03600"
                     /old_locus_tag="LILAB_03675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935829.1"
                     /db_xref="GI:503701753"
                     /translation="MRIHSRASASAVLSLLSLVVLGACGEDGSLPLDKPEPTPFQPAQ
                     VPAITALAPVSGFADQAGGGVFATASRELVRLRLDGTLGALEPHPGNAVAAGGILGVF
                     RLGPHSALVETQTGLFLAESGWLIAPPWRDALGQGVIATAQSADGAVWLAHTRGLFRL
                     QEGTLAELKVDGASVTGITSLAAAPSPENLPGVWFLHEGGLSVAAALSTTNYRVLTPS
                     APLAEGETLQALAGIGPAVGTAGELWVLTSQALLRAGRNGWRRVELPQQPRQLMGAGR
                     FLWARADGALLQFDADADLWRVATDAGAGDFHFLAADESGTVWAQQGGASVALSHVLV
                     PRLQGLYQGMQLVNDGLVVRAVMPPGPAPTSVVFKLGSSEIPTEGPDYSLGGLEADGT
                     HRAYSFAALEAGRYALSVVARYEDGSEARRSVPFDYAPLVSGPLSWDKDIRPIHEARC
                     RNCHNTSSAARSLDSYELWRANAPIITAAVRDQRMPADGPMDPELISRIQRWAASGAR
                     P"
     gene            complement(875980..877410)
                     /locus_tag="LILAB_RS03605"
                     /old_locus_tag="LILAB_03680"
     CDS             complement(875980..877410)
                     /locus_tag="LILAB_RS03605"
                     /old_locus_tag="LILAB_03680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional initiation protein Tat"
                     /protein_id="WP_013935830.1"
                     /db_xref="GI:503701754"
                     /translation="MKKNRHDENCSQGCAHGRRTFLKATAGFMGSTLLGGLPFRAFAQ
                     ATDLAPADRCFVFVYFNGGWDQLLAFDPRDPTEFTAERASETKILPGYDQINNASFEA
                     RPLIPAELPGVGRSNIDFGPAVGNELAKHYDLMTVVRGINMNTLGHEVGYRYFLTGKM
                     PIGSAARGSSTATEIVGQMKPRVPIASISYNVESYNDRYGGYANALRVSRRDDLILTL
                     KGSADALDSEIEKQLLDFRGQPVNCEQAAYGARGVGTTYANSQEQMRLIQSQGLDKSF
                     DFLAAENQPHGPEMKVIRTKYNLNNLNDVNGERGRAATVATALKKGIAQCVTINLTGG
                     LDTHFGSQLTQASNQRRGFDALAMLVKDLRESDHPAGGKFMDHTTIMVFSEFSRTPLI
                     NSSGGRDHHLSNSALLMGAGIKHNFVFGRSGDIGMAPGTFDLRTGASDPNGENILPEH
                     VIATVLASAGLDYSITRVEPLRPILA"
     gene            complement(877428..878087)
                     /locus_tag="LILAB_RS03610"
                     /old_locus_tag="LILAB_03685"
     CDS             complement(877428..878087)
                     /locus_tag="LILAB_RS03610"
                     /old_locus_tag="LILAB_03685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935831.1"
                     /db_xref="GI:503701755"
                     /translation="MRRLVLTAALLALATGCTQDEAKSSDGIIEPIANPHQPGDFTPL
                     PDPEAQEGSVGRAPRRLTVSQLDAAIVGAVGQRWSDLDSRATSMGRADYALVVSENIE
                     PNLVFAKFLEDGARKVCINQASAEMRMTDPAARTMGRMLPEKWDDLTKLTDAQVRAQL
                     VYMSTRFWGSPLSGEELTKWTSFFTQAAARVQTLSSSKRHETLAVVCIAMLTDPRFIT
                     Y"
     gene            complement(878087..880111)
                     /locus_tag="LILAB_RS03615"
                     /old_locus_tag="LILAB_03690"
     CDS             complement(878087..880111)
                     /locus_tag="LILAB_RS03615"
                     /old_locus_tag="LILAB_03690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043709203.1"
                     /db_xref="GI:760026071"
                     /translation="MLRVRYLACLAGAAFLLALPASAQEEAVCSPVVAKVPLERHLRQ
                     LSLDLLGRPPTYEEYQAAQAKGRIDVEDIRAMMTKEEFNARIRGYHRSLLRSNLSSSL
                     NNNQNSRVTGNGITTAYGVAGNPATTLRGANGATCNSDIAQDECLTAAQPDAHAAPLT
                     AQPRTKCHDDQGVPLAVSYDYDTNYYQCTALQPVSANTPAKCSDLASTSHPEHRYLYF
                     CDERGSGASAGAFICKPDPRKTTTSALTVEEMDGTRVRAFKHPNPDSKPALTELKRCT
                     LDLELRNGLRGNYGVQRGCVLREGFVNKPAPYWGTDKTPETVKVCAIDAQERTHNPWN
                     MQSCETARFSSDRSCGCGVGMRRCETPAIAAQDIENVHSLRVAAFNDEPLRIAESVVQ
                     RDEPYFNILTTRRSFVNGTLSAYFRGAQGVGVFNVTAPTAPGAVPAIAYTDADTWREY
                     TRDEGHSGVLTTPSYLYRFPTHRARVNHFYEAFLCKTFSPPTGAASPAPEDACNRENN
                     LAVRCGCNYCHATIEPTGAHWGRYAERSAQFLAPDQFPRFDPKCRDCALNGDTNCGGE
                     CSQYIMQAYDGDGASSLGMLKTYLYRTPDEEQNIEAGPALLVQKMLQSGDLERCTVRR
                     IWSEFLGRPMTAEEQRMYLAPLAQDFARNGHRLKALIERVVTSDAYRRID"
     gene            880282..880845
                     /locus_tag="LILAB_RS03620"
                     /old_locus_tag="LILAB_03695"
     CDS             880282..880845
                     /locus_tag="LILAB_RS03620"
                     /old_locus_tag="LILAB_03695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935833.1"
                     /db_xref="GI:503701757"
                     /translation="MSNAAPATVPPRVSDRAFFIFTAVVSAVALAFIGWILMVRSGGP
                     VDGVNLRFMPAVNAGLNATAAALLIAGWVAIRRGARQVHQYLMVSAFTASAVFLVGYL
                     AYHFVHGDTRYVGAWRGLYLSILASHVLLSMPVVPMALVAFYFTWRQDYTRHRKVTRW
                     LAPIWVYVSVTGVVVYFMLRGGVPAVP"
     gene            complement(880855..882069)
                     /locus_tag="LILAB_RS03625"
                     /old_locus_tag="LILAB_03700"
     CDS             complement(880855..882069)
                     /locus_tag="LILAB_RS03625"
                     /old_locus_tag="LILAB_03700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935834.1"
                     /db_xref="GI:503701758"
                     /translation="MSPALRVLLVDDNPADRFAARRALEHDEEQAWVLEAASSAEDAL
                     ARILAEPRLDVALVDFHLPGMTGLDLLRELHARGGGPLPALVMLTGSGNERIAVEAMK
                     AGAQDYLVKGSYSAERLRRSLRAAVDTVRMTRELEERRAQIERAERAAREALAVRDEL
                     FALATHDLKGPLQIMALNAQMLQRQLAKTELGASQAPRLEHIIRATQRMGELIDGFLG
                     ATRSDETPLNREPLDLLAMVRSKVHALEASGQHRFVLHSEGEDFTGEWDSRALERVLE
                     NLLGNAVKYSAADTTVTVTLSTEADGPEARVRLQVADEGMGIPAEDLPYVFERFRRGR
                     NVSPDVTGSGVGLASARRMVRLHGGTIHVASQEGRGATFTVTLPRVAVRSGSLDAGAP
                     PDALAEPASSTS"
     gene            complement(882066..882512)
                     /locus_tag="LILAB_RS03630"
                     /old_locus_tag="LILAB_03705"
     CDS             complement(882066..882512)
                     /locus_tag="LILAB_RS03630"
                     /old_locus_tag="LILAB_03705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_013935835.1"
                     /db_xref="GI:503701759"
                     /translation="MTAPRSLLLVEDSDADAVALERIASRLPSPMTVVRMRDGESALD
                     YLYRRGAYASAARPALVLLDLHMPGMGGREVLAQLKADPELRRIPVIIFSSSEDPGDV
                     EGAYADGANSYLFKPEPGAQLEAAAQALQAFWLTAARLPEEPGAAP"
     gene            complement(882509..884785)
                     /locus_tag="LILAB_RS03635"
                     /old_locus_tag="LILAB_03710"
     CDS             complement(882509..884785)
                     /locus_tag="LILAB_RS03635"
                     /old_locus_tag="LILAB_03710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935836.1"
                     /db_xref="GI:503701760"
                     /translation="MPPSPPEIDLSQCEREPIHLLGGVQPHGVLVAFHAASSRITVVS
                     ANTEPLLGAAPPALLGQPITAVLDAESLARVRAGSGTGPVRVRAGGRACSALLHASGD
                     ASVLELEPLTDADTRVEEDALEAIHALVAPLGQVRGTSALLQVAAEGVRALTGFDRVM
                     VYRFHADWHGEVVAESRAEGVDGFMGLHFPASDIPAQARALYRRSPLRLIADVHARPV
                     GLVPPTLPDTGQPLDLSGAALRSVSEVHLEYLRSMGVGASFSVSLLKDGELWGLIACH
                     HLSPRHVSAQRRQACEVLARLLSLQLGAEERGADAATRVHRAELLSRLVAGLGGEGVS
                     LPSALETHGALLMDLTGATGVALVLGERLDAEQGETPLLVGQTPTPKEVLALATRLAS
                     TPGGSGTLHTERLGALHPPLAGRADVAAGLLAVRLDPQAPRFVFWFRPEVARTVTWAG
                     NPHKPAQPEPGHARLHPRASFEAWREDVRGASTPWTQADVEAAESFRGALVGVVLRHA
                     AELARLSRALARSNAELESFSGTVGHDLREPLRGIQQYTTFFLEDHGASLTPDGREQL
                     QSVTWLARRAQALLEDLFEYSRLGRIELAWREVDMHGLVEEALAVVASRLQAGKVDVR
                     LPRRLPRVACDAVRIRQVWENLLTNAAKYQAAEPRWVEVGYHGPGEPRPEAAARHDAP
                     YVFFVKDPGIGIASRFHEAIFDMFRRLHPVQAYGGGTGAGLAIARRLVRLHGGELWVD
                     SSPGQGATFYFTLGRGPA"
     gene            complement(884766..885365)
                     /locus_tag="LILAB_RS03640"
                     /old_locus_tag="LILAB_03715"
     CDS             complement(884766..885365)
                     /locus_tag="LILAB_RS03640"
                     /old_locus_tag="LILAB_03715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme oxygenase"
                     /protein_id="WP_013935837.1"
                     /db_xref="GI:503701761"
                     /translation="MQRLKSETRPHHERTEAQVRLMDPDLTPTAYRRHLEALHGFYAP
                     LETRLAGLGLDAVAGLSVHARWKVPLLVEDLRALGHDDASLARLPRCGELPSLAGVPE
                     ALGCLYVLEGSTLGGQLILRHLRRHFDGTPLGPFAFFRAYGDDVGPRWRAFGEAVNQA
                     SVAAADDAFDSRAVKGAQDTFDAFAAWLRREQAHASVSA"
     gene            complement(885479..888049)
                     /locus_tag="LILAB_RS03645"
                     /old_locus_tag="LILAB_03720"
     CDS             complement(885479..888049)
                     /locus_tag="LILAB_RS03645"
                     /old_locus_tag="LILAB_03720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_013935838.1"
                     /db_xref="GI:503701762"
                     /translation="MRRLLSLGLLLLTATACSGDDDEDPREQPPSRTGRIQGTLTPFQ
                     SSERSTGDGVSRTVRSPFRAGELATLKETLRGLSAGRSRGERVAPKRVPGLSIVPWAP
                     GHAPLERASREDPTIPGDVILRFEEAGLSPERVLAAVQRPGFRAVHKGYASEYVHLVG
                     YEPLDGEAVTAAKTQAWAARLAQVPGVTYAVRNERMRAAAAPDDRGYSLQWHYPTLNL
                     PAAWDLAPDASSVVVAVIDSGVVPHPDLTNVLPGYDMISDPENAGDGDGRDSDPRDEG
                     GDTPSGGSTWHGSHVAGTIGANTNNQEGVAGVAWNARLLPVRVLGKKGGTSFDIAAAL
                     TWATGGSVPGVPDNPTPAKVVNMSLGGRAPPQALYQDAIDAALGRGAIIVVAAGNEDV
                     DARNSTPCNQQNVICVGSTSLAGQRSSFSNFGVDVDVVASGGEMREDLNGDGYPDGVL
                     STVLDENGQPAYAFSQGTSMASPHVAGVVALMAASRPDLDAATAEGILKETATPLTNA
                     QCPEGCGAGLVNALAALARISNEDPGSLDPRLNVTTSTLFFRGSGTQQLILSNVGGNR
                     GGDLMVTATKSGPNEAAVSFPQGNTVRVPAFGSAPLAVAVDASGLPVGDTVVTLSLVG
                     SGTSGAATVAVKIGVAGAASDLDAFVAFVWQDARGEWQTSEDAIAIAPASANYAYSIS
                     LTPRTYYALATIDDDQDGNFFEDGERTGYWRNVDAFEPLFVEEGERITDVSFDLIPLA
                     PIDDDPALVVGSACGSNGDCPGGVCVTDYPGGYCSMDCTTSACPAGSRCYIVDSASGL
                     KACLATCSRQVGTGQGDCRSGYVCYSDGTGSGACQPNCRTSGLSCGGGRTCLATGFCQ
                     "
     gene            complement(888115..892485)
                     /locus_tag="LILAB_RS03650"
                     /old_locus_tag="LILAB_03725"
     CDS             complement(888115..892485)
                     /locus_tag="LILAB_RS03650"
                     /old_locus_tag="LILAB_03725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_013935839.1"
                     /db_xref="GI:503701763"
                     /translation="MFRLVLEVPMAPQISLDFASEYAAHPALAPFHPVVRRWFAERLG
                     EPSRPQVEGWPLIQAGEDVLIAAPTGSGKTLTAFLAALDALFRLALEGTLPDCTQVLY
                     VSPLKALGNDVQKNLLQPLEELLTRARAEGFRPQELRVQVRSGDTPASERAQMVRRPP
                     HILITTPESFYLYLTAEKARATLRAVRTVIVDEIHALARDKRGSHFALSLERLKALTD
                     ARPQLIGLSATQKPLEAIAGFLTGASHRECKRVEVGHLRPWDLTLEIPDAELSSLASH
                     EMWGQVYDRLVALTATHRTTLVFVNTRKMAERVAHDLGERLGEGTVAAHHGSMSREIR
                     LAAEEKLKSGQLRAMVATASLELGIDVGNVDLVVQLGSTRAISVLLQRVGRAGHHKAG
                     ISKGILFAMTRDELMECTALLNAVREGELDTVLIPQKPLDVLAQQIVAACACEEWDER
                     ALFNLFQRAYPYRNLTWEEYQGVLALLSEGVAARRGRAGIHLHRDRVNQRLKGRRGVR
                     ITALTNGGAIPDTFTFNVSAEPEGKVVGTLDEDFAVESSPGDIFLLGSTAWRIQRVSG
                     STVQVEDARGAPPNVPFWRGEAPGRTDELSLQVGRLREELTTREDAPAFLQQELRMSP
                     PAVDALMGYLRTGQKMLDAVPSHTTVVAERFFDEAGGMQLIIHAPFGSRINRAWGLAL
                     RKRFCRSFDFELQAAATEDGILLSLGEQHSFPLAEIFDFLHPDHVEEVLVQAVLQAPI
                     FGTRFRWVATRALALSRMMGGKRVAPNLQRARSEDLLAAVFPEQVGCQDNHGGGDVEV
                     PDHPLVKQTMDDCLREAMDVDGLREVLRGMREGRIRLLARDVPEPSLFAHAMIHSQPY
                     TFLDDAPAEERRVRNVALRRAMPVEDVTAFGALDAAAIATVVADAAPPMRDEDELHDA
                     LLQLLLLPAAQVPRGLATPLFEQGRVAWMDLPAGRFLVSAERGSALRVLFPDAPMQPP
                     LPVLAYDRPVERDAAVLQVVRGRMEMLGPTTVAELARLVVLDEDSVNVAMHQLESQGN
                     VLRGRFRPLDAPLADGASPPLEWCDRRLLQRIHRLTVGRLRKEIEPLSAQDFMRFLFR
                     WHHLEELDALRGSTGLLKAVRLLQGHEAPASAWERFLLPARMRGYTPDLLERACYAGE
                     VAWGRLTTKEAKPTPGPRRGAPVTPPEPAPPRSRASPSRNASLTFTLREDLEWMLTAA
                     RPHAVLADGDVWTPPDLSAPARDVVAVLERRGACFFQDLVSRARRLPAEIEDALWELV
                     ARGLVTADAVQNLRVLQSPAHRKRQKLLQRGGPGRWSLLTPAEPKSQDEVLDSLARLF
                     LQRYGIVWRDLVMREALAPTWRELLFVYRRMEARGEVRGGRFVSGFVGEQFALPEAVD
                     MARSVRRQPPSGVRVQLSGVDPLNLTGVVTPGPRVPAMPGNVVTYVDGVPRDVGALDD
                     GDDGNVGEDTEGGGGEAMAS"
     gene            892850..894022
                     /locus_tag="LILAB_RS03655"
                     /old_locus_tag="LILAB_03730"
     CDS             892850..894022
                     /locus_tag="LILAB_RS03655"
                     /old_locus_tag="LILAB_03730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan halogenase"
                     /protein_id="WP_043709204.1"
                     /db_xref="GI:760026072"
                     /translation="MSEAACDVAIIGGGPAGSAMAVALRDLAPFLSVVMLERTGYDTH
                     RPGEALSPDIRTPLSRLGVWSSFLRDGHLASRGTSSCWSRAEPRVQDMRMSPWGSAWN
                     LDRARFDERLSLEAARQGARVLRLTTLLDAEPLAAEGYRLHLSQRKAGALTLRARFVV
                     DATGWKATFAMSQGARRRIRDRCFTVHGAFQLRPGESFPTDALVEACPEGWWHSARLP
                     ADRVAVTLVGDGDSLHGLRWATPERWMALLEQAPVTLARVAVCDFAGEPLVAAPVLVG
                     ELDRMHGARWLAVGDAAHTHDPLSAQGIFSALDSALLAAEALEQYMRGEEAALRAYEE
                     TLHLRFDAHLRKRSETYREEQRWPDAPFWKNRHAAFPSLTPVAGQHSAPTPAGLAT"
     gene            complement(894044..895099)
                     /locus_tag="LILAB_RS03660"
                     /old_locus_tag="LILAB_03735"
     CDS             complement(894044..895099)
                     /locus_tag="LILAB_RS03660"
                     /old_locus_tag="LILAB_03735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002630279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_013935841.1"
                     /db_xref="GI:503701765"
                     /translation="MARLLVEDVHVRLGTNDILKGITADFRDGEVVALLGRSGSGKST
                     LLRSVAGLETPVRGRIHIGERTVFDAAAKVNLPPERRDLGLVFQSYALWPHKTVFDNV
                     AYGLRLRRQPREQVDRAVREVLQGVGLDGHGDRFPSQLSGGQQQRVALARALVYGPPL
                     VLLDEPLSNLDAKLREEARVWIRALIKRLGLTALFVTHDQVEAMAIADRIMLLEGGRM
                     VQDGTPEQLYTEPRSLFAADFMGVNNTLPGRVVERRGGEARLQVGGQSLWGQQRGEGA
                     GGDTATGVIRVEALQLASGPGENRLPAALASSLYVGGRWEHQFQLEGQTLRATTRERL
                     SPGAYMLAFPKERLWIF"
     gene            complement(895216..895818)
                     /locus_tag="LILAB_RS03665"
                     /old_locus_tag="LILAB_03740"
     CDS             complement(895216..895818)
                     /locus_tag="LILAB_RS03665"
                     /old_locus_tag="LILAB_03740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013935842.1"
                     /db_xref="GI:503701766"
                     /translation="MASEKLIFAQSVEALFVRALGPYLTRDGRQRLKAVGLDLSEPLR
                     PQYTLEQWRAFLRVAAQDVFPHLPPSEASFALGARFLQGFRQTSVGRASLSLVTQLGP
                     RRTLERVPYNVRAGNNFNEVRVEESTQDSATLWMKDVTADTPDFAAGFLAETLRSAGA
                     GHVDVRPIAFDGTAATFRVTWTKGVSKAPVANAAGPRRVH"
     gene            complement(895885..897345)
                     /locus_tag="LILAB_RS03670"
                     /old_locus_tag="LILAB_03745"
     CDS             complement(895885..897345)
                     /locus_tag="LILAB_RS03670"
                     /old_locus_tag="LILAB_03745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013935843.1"
                     /db_xref="GI:503701767"
                     /translation="MTPTPALILNVNDDAASRYVTSRVLGLAGFRVVDAASGAEALAL
                     ANEETDLVILDVRLPDISGLEVCRRLKEAPRTYGVLVLHLSAQAVGPGDRALGLEHGA
                     DGYLVAPVDPEELVAQVHALLRLRQAEREVKVLSREVAHQRQLLELAISCAADPIALY
                     DETGRVLSANQSLYASRGSRAVHAPGRTLDELQAADAALTPYLDQVRVALRTGQVLRG
                     TIALDSDRGPRYFDYVLSPALESGGQVLAVMSSLRDVTEARSAEEFREQFIGMLGHDL
                     RNPLNALSMSAQQLRRKGGLDERQGMLTERILTSAERMDRMIRQLLDFARARLGGGIP
                     VMRSPCDVFEVVRRTVDELRASHPGRVVLLESKGDGQGKWDADRLEQAVGNLVANALK
                     YSPAESTVWVGAEGSEREVVLRIHNQGTPIPAEDLPHVFGAWRRGRRTASDTGAPSGL
                     GLGLYITRQIVRAHDGDAHVASSATDGTTFLIRLPR"
     gene            897516..898481
                     /locus_tag="LILAB_RS03675"
                     /old_locus_tag="LILAB_03750"
     CDS             897516..898481
                     /locus_tag="LILAB_RS03675"
                     /old_locus_tag="LILAB_03750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011551113.1"
                     /note="Derived by automated computat