GenomeNet

Database: RefSeq
Entry: NC_015723
LinkDB: NC_015723
Original site: NC_015723 
LOCUS       NC_015723            2684606 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Cupriavidus necator N-1 chromosome 2, complete sequence.
ACCESSION   NC_015723
VERSION     NC_015723.1  GI:339321330
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603269
            Assembly: GCF_000219215.1
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 2684606)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of the type strain Cupriavidus necator N-1
  JOURNAL   J. Bacteriol. 193 (18), 5017 (2011)
   PUBMED   21742890
REFERENCE   2  (bases 1 to 2684606)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/06/2014 23:21:33
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 7,719
            CDS                          :: 7,465
            Pseudo Genes                 :: 169
            rRNAs                        :: 15 ( 5S, 16S, 23S )
            tRNAs                        :: 69
            ncRNA                        :: 1
            Frameshifted Genes           :: 154
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2684606
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /chromosome="2"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1195
                     /locus_tag="CNE_RS18115"
                     /old_locus_tag="CNE_2c00010"
     CDS             101..1195
                     /locus_tag="CNE_RS18115"
                     /old_locus_tag="CNE_2c00010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepA"
                     /protein_id="WP_013951727.1"
                     /db_xref="GI:503717651"
                     /translation="MPIKRSPATTGDRRVLDLDAEPSRIIVPGNENNLVPSEKFQRLF
                     DEAQAMEREDAWQSGEVGFLSRASVQVTLPYRAPKGAPPVWTRTSGNISLMIQPGYFT
                     QQRSERAANGRQKLVSETVSLGYPYGSYPRLMLAWIGKEIMAKKKRGEFTGTVEDRRI
                     SLGNSLSEFMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSTPSQNQNPNH
                     EPLSIDRVGYLLADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALK
                     ALKQSPFALDVYSWLTYRFFTIQRRTEIPWEALQMQFGTETESERKFRALFRKALKDV
                     LVVYPGAKVDADSSKALILQPSRTSVRKLG"
     misc_feature    complement(1290..1729)
                     /note="cspA; Derived by automated computational analysis
                     using gene prediction method: cmsearch."
     gene            complement(1374..1577)
                     /locus_tag="CNE_RS18120"
                     /old_locus_tag="CNE_2c00020"
     CDS             complement(1374..1577)
                     /locus_tag="CNE_RS18120"
                     /old_locus_tag="CNE_2c00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004632415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_006159056.1"
                     /db_xref="GI:493144427"
                     /translation="MATGTVKWFNETKGFGFITPDDGGADLFAHFSEIQGSGFKTLKD
                     GQRVTFEVKQGPKGLQASAIKPA"
     gene            1955..2614
                     /locus_tag="CNE_RS18125"
                     /old_locus_tag="CNE_2c00030"
     CDS             1955..2614
                     /locus_tag="CNE_RS18125"
                     /old_locus_tag="CNE_2c00030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="WP_010811147.1"
                     /db_xref="GI:498510687"
                     /translation="MPAKIITVFNQKGGCGKTTVSMHLAGTLGLRGARSMLVDMDEQG
                     TATRWAAQASDERPFPASVIGLAPSGGAMHREVRKFVQDYDYIVVDCPPAVHSAAPSS
                     ALLISDLAIIPVVPSPPDLWAAVAAKTLAQHAQVQNESLLIRVMANMVQRRVSIARQA
                     IEILGDDGDVPLLNSMIGSRSAFRECQAIGCTVHGVAGAREAVQEVDMMVDEILSLIE
                     H"
     gene            2617..3630
                     /locus_tag="CNE_RS18130"
                     /old_locus_tag="CNE_2c00040"
     CDS             2617..3630
                     /locus_tag="CNE_RS18130"
                     /old_locus_tag="CNE_2c00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_013951728.1"
                     /db_xref="GI:503717652"
                     /translation="MATKLKSLKAGMLAGMAAEKNRNETLDRFARAEAAISQHPNGLL
                     QGRGADGTPVFSAESLGEAAKGRQLIRIPLAQLHDNPLNARRLYDPAVVQERAASIAT
                     HGQKTPGLAAPDPARSGHYILIDGHYRKRALASAGKLEMECFVEDDLSDLDFYRLSFM
                     LNEQRSDQSALDNAIAWRQLLDEGKVQKEEEICELTGISAGTVNKTLALLRLPESVLG
                     VMRERPSAIGIAAGYELTLYCKLAGEERTRDLAARIINDGLSSREVEAIRKHAQEGKA
                     RKVKEISRQYKIRTDSGQLLGTIKEWDSGRVMLDVQLSDRSAREALVEALKARFGLDK
                     TLL"
     gene            complement(3682..5265)
                     /locus_tag="CNE_RS18135"
                     /old_locus_tag="CNE_2c00050"
     CDS             complement(3682..5265)
                     /locus_tag="CNE_RS18135"
                     /old_locus_tag="CNE_2c00050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041228492.1"
                     /db_xref="GI:752557260"
                     /translation="MIPGMMTVSLTRSEFAAVRAYVQGMPAAMVVPRYLADETDDDED
                     GAESSLRILLALRDRMVQLAHLHGRGDLAELLLAGPGRSNRGMDRRVDALAELERLGT
                     AAPRPQHGVELWFAPALARRLRKAEIVTLNTLLALANQRGGAWWRAVPRIGALAGAAV
                     NRWLSENRAAFRDPDGKPLLGAHIGNRTLVEQGGLGPGMRQPLPLEWMTASPALDLDA
                     SCPYSQGLDVVQAWLRDAAGDSGSTFSAYRKEAERLLLWAALERRKGLSQLDLDDRRA
                     YLGFLAQPEPASRWCGPRAPRHLAAWRPFTGPLSPASVRHSMRVLAALFRWMHANGYP
                     GAALWPAQVSDGTEAMAATAAARPDATQVPAASLAPFLSWLERRGGDGDGQRYRTAHA
                     AILLLREHRLSLDRLTSVTRRSLAPKQPPVRSREDGMGSAAPDGTPGFGPATQHALAR
                     HWRDRNLQWDGAGTEDASLIAPPAAPPTRRAQRKLAALPQAGYSVRGLHALLSSMLER
                     YRKTCDPEFGARSPRDLLA"
     gene            5765..6622
                     /locus_tag="CNE_RS18140"
                     /old_locus_tag="CNE_2c00060"
     CDS             5765..6622
                     /locus_tag="CNE_RS18140"
                     /old_locus_tag="CNE_2c00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013951730.1"
                     /db_xref="GI:503717654"
                     /translation="MATILLIEPHPLLRLGLRHLLAQAHIPGDLIDIDPLAPVDSDLW
                     LYDADLLIYGLPADHAGGWTMLEDLCQRLRPQRVLVLSDQAAPSLPDAGLPDPVRGCV
                     AKSCSADALDAAVRLVLAGGECFPARAQGSHAWQPELEAGHAPVAGSAGQGEARVVAL
                     RAGIGEAVLDHAVPAPQRHFQAHATYHETPSAGAHLLNITERQYEVLALLARGYPIKT
                     VSRMLNISVATAKTHACTLYQRLHVRNKGEAVYVALQKGATLNWAGPATPANPVTRVP
                     APDHTCQAA"
     gene            6906..7364
                     /locus_tag="CNE_RS18145"
                     /old_locus_tag="CNE_2c00070"
     CDS             6906..7364
                     /locus_tag="CNE_RS18145"
                     /old_locus_tag="CNE_2c00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_013951731.1"
                     /db_xref="GI:503717655"
                     /translation="MPTYLIASNEMMCRVLARRLNALDVPQPITWRTPQWLHESMSAS
                     TQASSSEPSPDPADIALIDCSALEGDPRALLDQLQARLAPRRWLVLSDRLDATLMLHA
                     ALLGASGCLLLPAPLELVCAATALVWAGGQCFPRMALSLTGANGTTASLL"
     gene            7488..7802
                     /locus_tag="CNE_RS18150"
                     /old_locus_tag="CNE_2c00080"
     CDS             7488..7802
                     /locus_tag="CNE_RS18150"
                     /old_locus_tag="CNE_2c00080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951732.1"
                     /db_xref="GI:503717656"
                     /translation="MEAGLEFLVVRGFAVREGRGKWACCFEIRLAASLDDGCHAGANE
                     GSDEPLLYRGELHGRQFDCELAAADAARAAGEREARLRVESLRALIIAQHRHRVPPPL
                     VA"
     gene            8449..9432
                     /locus_tag="CNE_RS18155"
                     /old_locus_tag="CNE_2c00090"
     CDS             8449..9432
                     /locus_tag="CNE_RS18155"
                     /old_locus_tag="CNE_2c00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228493.1"
                     /db_xref="GI:752557261"
                     /translation="MHGDTRMRGRGGPGLRGGNPVWSHVNCHIDLWIELLHGLDLPPV
                     AALACAVRQDFEADHFTQCRFPDADLERLYGLTVHALAFYDSLESHVAAQTSRGHIVV
                     MELDSSQLPPPRGAGYLRHCTPTCIAIDVLIPEAGAVGYYHSDGYHTATGEDYAAIIR
                     LAPGVRSAEALPFMHADVVRRNGHPHAAETLLEASLALLRFHLSNRPRENPVTLFRAV
                     FPQHLERLMARGEPGFHHYASGVLRQLGANFELLARYLRWLVMHGQEVPEKAAQACYT
                     MASEAMVMQFRLMRAVISRKPDPCEDCLDQLEASYLASVPLLAAHFGEFTP"
     gene            9943..10665
                     /locus_tag="CNE_RS18160"
                     /old_locus_tag="CNE_2c00100"
     CDS             9943..10665
                     /locus_tag="CNE_RS18160"
                     /old_locus_tag="CNE_2c00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_013951734.1"
                     /db_xref="GI:503717658"
                     /translation="MITHRSDLHVNHLLSALPRGEWETLAQHFELVRLRAGELLTDSG
                     QRIVHVYFPTTAVVSLLSLLEDGATVEIAAVGNEGLVGIPVVTGGDTMPSRVEVRSPG
                     MAYRIPARLLRGELPRLPTLQRVTLLYVQAMLTQIAQTAACNRHHSLNKQLCRWLLLA
                     IDRLSSNELVITQQVIANMLGVRREGVTEAAGKLEDLGLIHHSRGHITVLDRCGLEKH
                     SCECYKLVKREYDRLLPALASA"
     gene            10744..13179
                     /locus_tag="CNE_RS18165"
                     /old_locus_tag="CNE_2c00110"
     CDS             10744..13179
                     /locus_tag="CNE_RS18165"
                     /old_locus_tag="CNE_2c00110"
                     /EC_number="2.7.10.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein kinase"
                     /protein_id="WP_013951735.1"
                     /db_xref="GI:503717659"
                     /translation="MSRLSYAGGPAESATPRRDAQPGVTQARALMDHLGWIAAAGVAG
                     AAAGLLVALSAPPQYRAQALVQVEGRDGGMRSVAQMQGPAAFDAGLLKSRAVVGPVVE
                     RLRLDITAQPLRAPLVGALVQRFSTPGQPRGTWPASLGYAWGGERLVIASMTVPEALV
                     DQQLTLEVRGEGRYRLSQQDTVLLEGQAGETAMANGIVLRVDKIEAGPGTRFQLTRHD
                     LARTAESVRRGLTVESERSETVASLGGAADPLTAPGGTVRVSWEYPDRQLAAQLVNGV
                     TRAYIDGQTDKRRQDAAGTLAFLSGELPRVQSELTRAEEALTRYRARTGSLQPSRDAQ
                     SFLSNSMEYQRQIAALRLERTRLLQRFTPEANEVRTVDSQIQQMTRERAEIDARMQTL
                     SASERESVALTRDVKVAEDMYMSLRSKVEQLSLMLSDSSTQMRVVDAAIAPVTPVGLG
                     AWPFASAGALLGLCLGVAAVNLRQRMRPSVASAADAEERLGMAMLGDIAFSNEQTELE
                     RLVDAKRRLGIASGFVLPPNVRLGWPDSVTSVIDAATAAAPEDERARAERLLRQGLHD
                     QFLLARRAPHSLAVEGLRTLRAALHFALRDAPNCVVAVTSPAAAAGKTFAAVNLAVLF
                     AEAGQRVLLVDADLRRGRVADWFDLPAEPGLAEVLAGRSAIADAVKPSVVNGLFLLSR
                     GAVPANPSELLMLPALAESLRLCAGRFDLVLVDTPPVMAVADATLVANLAGSTLVVVR
                     ADVTATAQVDETLKRLAHANARLAGGILNGVMPRRSNRADFNTINPYLGMPLPPPQLR
                     HPALAKSEAPGQS"
     gene            complement(13300..14592)
                     /locus_tag="CNE_RS18170"
     CDS             complement(13300..14592)
                     /locus_tag="CNE_RS18170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228494.1"
                     /db_xref="GI:752557262"
                     /translation="MMAADISNQRFTRRQIVYFPKGTYYIDRYAVTRGPWTNHNQNIR
                     LLKASNFSLIGCTGSVVSFKGNFTITNDHFSGRSWYSARHQLGFEIRNASNFRISGLE
                     LNGNVDKLSRPPSANGKPLSETPSFGIQTHASSNYELSHLKIHHFACDGLFIGGDFTA
                     DLNGTIHAVDSYNNARQGMSIMQARSFRITNSSFRNTGLTDGAYPTHAPAAGVDIEPD
                     GTPADGVTARTGDMVFDACRFVNNKGSQFVGGDNGRNTENVTIRNSEFVGRAGNKHPY
                     VIILSAPGAVIENNQIDTIDGGVYPSFSEGIGDMKAVNTIVRGNTIRSSGVGLQAADA
                     GASVVIENNTFISTHGPDYRDDFPNIRAGVASFSGNKLSYPHKNFGSRSVVGIIKAAT
                     FMNNSITTDLSGGNYTIKVGAGADAANNVVGAHILLAP"
     gene            complement(15094..17325)
                     /locus_tag="CNE_RS18175"
                     /old_locus_tag="CNE_2c00130"
     CDS             complement(15094..17325)
                     /locus_tag="CNE_RS18175"
                     /old_locus_tag="CNE_2c00130"
                     /EC_number="2.7.10.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein kinase"
                     /protein_id="WP_013951737.1"
                     /db_xref="GI:503717661"
                     /translation="MRTITNRDDAIEEAADQDKSVDLTAYLDILVRYRWTFCGVAIFV
                     VTLGLLYAMVASPVYRTDIVVQVEESNGGGASKLATSISPVLDIKPAATAEMELLRSR
                     MVVGKAVASLHLDVEAQPRYFPLIGQTIAHFKRELSNPGLFGWGGYAWGSESIAVKEL
                     EVPESMEDRRIDLTATGNGGYSVSFNGGDARASGKVGAPLSIATPAGAVRLLVSQLDA
                     RPGARFELRRLPRSTAIARLQGKLVITERGRQSGVIGISLEGDDPAMVAATLNEIGNA
                     YVEQNVLRKAAEAEKSLAFLEQQMPQLKQQVETSENRYNAMRNQRGTVDLPEESKLML
                     NQSVQLQTKLQELRQKRQELDARFMPNHPVISLIDAQIASVNAQINGLAGRIQKLPDV
                     EQNVLRLMRDVKVSTEMLQSLLNDVQQLRLMKASKVGNSRLVDAAEVPLGPIRPNREV
                     IATLAVVLGLIAGLAAVVLRHAFNGGVADADEIERRTGLVVYTTIPFAPQEAQTRDAA
                     SGGGLLVREQPDDPAVETLRSFRTALQFALAGNKNRTVVITGPAPGVGKSFICANFSA
                     IAASGRRVLLIDADLRRGSLHRRFGAQRTPGLTELLLGAPFEQVVQREVAPGLDFIST
                     GSEPPHAADVLLSPAMENLLDTLTKRYDLVLIDTPPILAATDAGILAGKAAAVFLVAL
                     AEKTTVNELQASYRALKQSGADVKGVLLNGLRIEGRWYRAHYYFGKYRYLGEYSAKPP
                     KRA"
     gene            complement(17322..17795)
                     /locus_tag="CNE_RS18180"
                     /old_locus_tag="CNE_2c00140"
     CDS             complement(17322..17795)
                     /locus_tag="CNE_RS18180"
                     /old_locus_tag="CNE_2c00140"
                     /EC_number="3.1.3.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-tyrosine-phosphatase"
                     /protein_id="WP_013951738.1"
                     /db_xref="GI:503717662"
                     /translation="MPRTILVVCLGNICRSPMAAVLLNRALPGFDVTSAGLAPPVGAA
                     ADPRAVRLLAHEGCDLAGHRARAVDSVLVESADLVLVMESLQREALEQRFPQSRGKTF
                     RLCEGMDLDVPDPYGSSQQMFSIVLEMIKQGILSWSSQLEQEHAIASIDSHREAT"
     gene            complement(17807..18973)
                     /locus_tag="CNE_RS18185"
                     /old_locus_tag="CNE_2c00150"
     CDS             complement(17807..18973)
                     /locus_tag="CNE_RS18185"
                     /old_locus_tag="CNE_2c00150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_013951739.1"
                     /db_xref="GI:503717663"
                     /translation="MRSIYSCAIQRSNQPRRRGPAASLLPLLASALLTACAASPGMVF
                     DSNAPVKAVGPNATTTVTPITLDLVRQLRHKIKPANERVEELYAPAQPYRIGPGDIIS
                     VVVWDHPELVFPTQTYSPGASFEIPASTGGSNLPGYVVSAQGDIQFPYAGSLKVAGKT
                     ANQVRDETARILSRVVRNPQMTVRVLGFRSQRVYVDGEVRTPGMLAIDDAPMTLVEAL
                     NRAGGVLNLTGDNSRIRVTRGERSWYVNIPALLARGTDPARIMLRSGDIVRVEQREDN
                     KIFVTGEVGKPTSLLMRNGRMTLNEALGDAGGVNPGTANAEQIFVIRKAPNGEPSVFH
                     LDGTSPAALAIAEGFELEPKDVVYVDARDLVRWSRVMSLLLPSTSLIGTAAGIK"
     gene            19625..20878
                     /locus_tag="CNE_RS18190"
                     /old_locus_tag="CNE_2c00160"
     CDS             19625..20878
                     /locus_tag="CNE_RS18190"
                     /old_locus_tag="CNE_2c00160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_013951740.1"
                     /db_xref="GI:503717664"
                     /translation="MQMQIARNVFWLVFERGLQVVFGIVSVAMIARAVGPEGFAEFQY
                     AQSLVLIASAVALICGNEVVIPRLVADQAPAAQHRLLAHVFGLREIAAVVGYLLLVVV
                     VAMTEDDEVIVVIVFITGIPMLFREPFGAVRTWLQARTDSRPAVIFSMVGLAFRMIAV
                     SGLYLAGTDSAPVFAWVVAVESLLFAVLHARYYRKRSPRVAVELDWSLARKLLRDGTV
                     FWASMILMLCAKRIDQLLLKPHISLFELGGYAASMQVLDNFMMLSAIVASSVAPLMIY
                     AQPTLTLVRRNVLYVVAGMVFMGVAGGAVLAYCAPWIIALIYGDHYDAAASLLRLSAM
                     ASGLVFADAALSLLVIYLRKPNWLVEKWLLVLGTMILVDLIAIPIHGARGAVYGYIAG
                     NLVAVIAGIGFFIRSREPVAMEQAV"
     gene            20926..22107
                     /locus_tag="CNE_RS18195"
                     /old_locus_tag="CNE_2c00170"
     CDS             20926..22107
                     /locus_tag="CNE_RS18195"
                     /old_locus_tag="CNE_2c00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951741.1"
                     /db_xref="GI:503717665"
                     /translation="MEYASSAWHVISATLVLMLGAPVAVSMGRKFGTRPKWGLFLYVW
                     HTIFCIFYAKLVMESGGDAADYFEASLAPSPEFGIGTRGVSYFTHIFSIYLGFSYVGV
                     FFVFNIFGTIGLLAFDAVLRTVTQDRSRFLRRLAVVIVLLPSISFWSAAIGKDSVAFM
                     ATSLALWASMSMPRRSWLMIIAIACMFLMRPHIAAIMILSLAASMVFSAKVPWKWRAA
                     LVSVALAASAAIVPFTIQYAGLEMPADGDSIETYVEKRQGYNQHGGGGIDIGSMSLPM
                     QLFTYVFRPLPYEANGIFGLAASLDNVVLLVLAVLGVWGMIRRRGDRVVLRNAAFLWI
                     YSAGTWLILAPMTANLGISVRQKWMFVPMLVCLLICNVRERQVRRRASAAEYQPLGTS
                     R"
     gene            complement(22243..23406)
                     /locus_tag="CNE_RS18200"
                     /old_locus_tag="CNE_2c00180"
     CDS             complement(22243..23406)
                     /locus_tag="CNE_RS18200"
                     /old_locus_tag="CNE_2c00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951742.1"
                     /db_xref="GI:503717666"
                     /translation="MQQFKPLTSLRLFLALWVLCRHYFHVYEQDAMLFNIGFTSTYFD
                     HGYLGVDGFFILSGFILAYNYDPAPGQQLQWKKFIVARIARIYPVYLFCLLAFALAVI
                     VRDLGLHTHTVGTGNYTLSSFVPEALMLGAWQYAGPSGWNDVGWSVSAEWFAYVFFPL
                     FLLAAPRLNKARIAMAGCLALAALAAVEATAPDHLSLSGGVARLVPEFLLGVLLCRLR
                     EAMPRHNGFAAGGMLSLAVCVLGVGLGLDVLFVAGAAGLVFFLSYEKDALTRVLSLRS
                     LVFLGEVSYCIYIVQRIPQYMFAFARGKMASLAALPGVAQAALLLALTVGIAILLHFV
                     VEKPMRIYINRRFGARAKPVEVSERPTDSRDREYAAASDQQGRRARSTGSRAG"
     gene            complement(<23597..24853)
                     /locus_tag="CNE_RS18205"
                     /old_locus_tag="CNE_2c00190"
     CDS             complement(<23597..24853)
                     /locus_tag="CNE_RS18205"
                     /old_locus_tag="CNE_2c00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951743.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylaniline monooxygenase"
                     /protein_id="WP_041228762.1"
                     /db_xref="GI:752557530"
                     /translation="MSTTDTAIIGAGPYGLSISAHLSDAGVPHQVLGEPMLAWRNFMP
                     PGMLMRSEAFASDLYAPHAGYRLEDYCRLMHLPYAPIGMRLPLERFVEYGLWFQSQLV
                     GHVRPVDVTELRRQDDGFLLSLSDGSALAARRVVVALGLKGFEQTPKVLQGLPRPHVL
                     HSGEIGNLAWARGKRIVIVGGGQSALGLAALFNELGAHVRVLVRGGIISWNEDPEVGR
                     SLLSRMLRPEGGLAQGWYPYVLSEFPYLFRGVGQRTRKRIAEASFGPSGAWWLRDRVA
                     GKIELRMNTTVRHVAIRNDEVVLEVSGENGPATITGDHVVAATGFKVDLARHAFLSPE
                     IVSALSLVDGWSDVSRNFESAMPGLYITGPASALSFGPVLRFVYGAKYAAPRIARHIS
                     RCHAAEGGSRAFDAPAVPQPLAESRTG"
     gene            complement(24853..26061)
                     /locus_tag="CNE_RS18210"
                     /old_locus_tag="CNE_2c00200"
     CDS             complement(24853..26061)
                     /locus_tag="CNE_RS18210"
                     /old_locus_tag="CNE_2c00200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate--amine ligase"
                     /protein_id="WP_041228495.1"
                     /db_xref="GI:752557263"
                     /translation="MKSTLDPAETTAAVVVGGELGGLGLVRSLAGKGIPVLLADTGHT
                     TPASWSRHARRHIIRSLVGREFTEDLIALARRLGQRPVLFLTDEDAVHSVSENRDELS
                     EWFRFCVPPAQGVRMLSSKSAFHCFAEENGFPVPRTVIMNGQLDVPLLSGLRYPAVIK
                     PDDKRQALTGDKERAIRVQSLAEGQAHARAMLRTPGGIVAQEWIEGPQSNIHFTLFYR
                     GMDGKAAAVFTGRKLACWPPEIGSTAVCVAAPEASEELEPITLAFAERASFYGMGSME
                     YKWDEIHRRFVMIEPTVGRIDWQEEIATLCGVNIPLAAYRHELGLPDLPAATPPPGGA
                     VWRATFLRSAPRSLMPHGARIFDGYFRWDDPLPAIQHYCLSMPLDRFLLHWSGWFPST
                     RRDQVQQEQQ"
     gene            26440..28080
                     /locus_tag="CNE_RS18215"
                     /old_locus_tag="CNE_2c00210"
     CDS             26440..28080
                     /locus_tag="CNE_RS18215"
                     /old_locus_tag="CNE_2c00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951745.1"
                     /db_xref="GI:503717669"
                     /translation="MRLRPKANVGALHPGAKYQEPLHPIAREEDMSCLLPETAARESL
                     VIMVTTTEPAGWERLVVQRLQASGTCRVVERALGAMNALEEASGTADRAKALQAGGPV
                     TAIVDLTGRLDTGWSRHAAEGVWRLCDARGLAPGDPHHGLETHASGAGIRLHLVAWTP
                     SHAVMVDTASGYAEPCEKVRPERLAVMGASLLDGALREIRALGGLSGRQAWTGCHGRV
                     PAWRRLLWRLRALGSHAIIQLKGFVLVEEWMVGIVEMAFADAVRAQRLPVRWLGTRMP
                     SYCWADPFGVPGSPDEIYCEEVDLRQNIGRIVRLKLDAHEAPSSAGQVDLGLPGHLSF
                     PYLFRHDGALYCVAESSQSRRCVLNRQEEGGRWQQVAVLLEDVAAVDPTIFAHEGRFW
                     LLYTDVAMGQFDNVCLCYADNLLGPWQPHPQNPVKFDHGSARAAGSVMREADGLLRVA
                     QVCKTAYGQAIAVNRIVHCTPEFYREETVGVISPAGDRVNPHGLHTLSAWGGRVVVDG
                     KRHGFNGGVLWHRIVSRAARALRLPLPTRNPSRAASRR"
     gene            complement(28043..29161)
                     /locus_tag="CNE_RS18220"
                     /old_locus_tag="CNE_2c00220"
     CDS             complement(28043..29161)
                     /locus_tag="CNE_RS18220"
                     /old_locus_tag="CNE_2c00220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013951746.1"
                     /db_xref="GI:503717670"
                     /translation="MRFLMIASYAESLIAFRGPLIAALQQKGLEVHIAAPDLPAGHQV
                     RAALESRGVVVHHVPLQRTGMNPLADARTLLALHRLMRRVRPACVMSYTIKPVIYGML
                     AGWLARVPRRFALITGLGYAFREDSGRSRLRAVVQRLYALALSRAHTTFFQNPDDEAL
                     FRRAEILPAGKRSCIVNGSGVDVASFEVAPLPDDGPRFLLIARLLGDKGVREYAEAAR
                     RIRARGAGARFSLVGWIDASPDAIAQDELDAWVADGTVDFLGRLSDVRPAIAGCNVYV
                     LPSYGEGTPRSVLEAMAMGRPIITTDAPGCRETVVDGDNGLLVPVKSVGALEQAMMQL
                     IEDWEQVVRMGQRSRQIAESKYDVRKVNAVMLREMGFE"
     gene            complement(29149..31143)
                     /locus_tag="CNE_RS18225"
                     /old_locus_tag="CNE_2c00230"
     CDS             complement(29149..31143)
                     /locus_tag="CNE_RS18225"
                     /old_locus_tag="CNE_2c00230"
                     /EC_number="6.3.5.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="WP_013951747.1"
                     /db_xref="GI:503717671"
                     /translation="MCGFAGFLGGLPATLADRADLLADMANQIRHRGPDHGDTWCDPD
                     QPFGLAHRRLAIVDLSAAGHQPMTAASGRHVIAFNGEIYNHLDIRAELERAGVAPRWR
                     GHSDTETLLAGIDAWGAEATVRRAVGMFAFALWDRRTCTLTLARDRLGEKPLYYGWQA
                     TGRGRAFLFGSELKALRPHPAFEGRINRDALCLYMRHNNVSGSHSIYHNVAKLPPAHL
                     LTVSLGAPEPVLRPYWSGAEAALDGVQHPFAGSPDEAVDQLEMLLRDAVSRQMMADVP
                     LGAFLSGGIDSSTVVALMQSQSSQPIRTFSIGFHNSDYSEAPHAKAVARHLGTSHTEL
                     YVTPEHAMAVIPGLPRIYDEPFADSSQIPTLLVSELARRHVTVSLSGDAGDELFGGYN
                     RYQITAELWPRLSRIPAPLRAAAAWSLTRCPPDRINRIAAAFPVASRWANVGEKIHKG
                     AGVMAARSSAELYRGMVSHWPHPEMLVVGGAEAATVLDGSAQAFSALTDVERMMALDM
                     LSYLPNDILAKVDRAAMHHSLETRIPFLDHRVVEFAWRLPLAYKLRREARGYTTKWVL
                     RQVLDRYVPRTLIERPKMGFGIPIDAWLRGPLRDWAEDLIDPRRLRREGYLNPEPIRK
                     RWAEHLSGRRNWQHQLWCVLMFQAWLAHQTAQERSPACVS"
     gene            complement(31163..32248)
                     /locus_tag="CNE_RS18230"
                     /old_locus_tag="CNE_2c00240"
     CDS             complement(31163..32248)
                     /locus_tag="CNE_RS18230"
                     /old_locus_tag="CNE_2c00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Vi polysaccharide biosynthesis protein
                     vipB/tviC"
                     /protein_id="WP_013951748.1"
                     /db_xref="GI:503717672"
                     /translation="MQENAYAHLKARLAATPRTWLVTGVAGFIGSNLLETLLRLDQRV
                     VGLDNFSTGHRRNLIEVEALVSPRQWANFRFIEGDIRNLEHCRSAMRFCAPGREGAAN
                     GLYPVDFVLHQAALGSVPRSLEDPIATHSVNISGFLNLLVAARDAQVSTFVYAASSST
                     YGDHPGLPKVEDRIGKPLSPYAVTKYANELYADVFHRCYGVHATGLRYFNVFGPRQDP
                     NGAYAAVIPKWIAALLRHEAVYINGDGETSRDFCYVANAVQANLLAAASDHCEGDSQV
                     YNVAVGDRTTLATLFELLRDGLRPYGVAAGTEPVYRGFRAGDVRHSQADIGKAQRLLG
                     YLPTHRVRDGLAEAMPWYVQMQQALNA"
     gene            complement(32309..33586)
                     /locus_tag="CNE_RS18235"
                     /old_locus_tag="CNE_2c00250"
     CDS             complement(32309..33586)
                     /locus_tag="CNE_RS18235"
                     /old_locus_tag="CNE_2c00250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Vi polysaccharide biosynthesis protein
                     VipA/TviB"
                     /protein_id="WP_041228496.1"
                     /db_xref="GI:752557264"
                     /translation="MELSHAQVAIIGLGYVGLPLAVEFGKQQPVLGFDVNAARIEALR
                     AGHDATLEVSPDELRSAHHLRYSNDPEALRDCQVFIVTVPTPVDRAKRPDLTPLILAS
                     ETVGRAMAPGAVVIYESTVYPGATEEICVPVLERHSGLKFNVDFFCGYSPERINPGDK
                     EHRLPDIRKVTSGSTPEASEAIDKLYGRIIVAGTHRASSIRVAEAAKVIENTQRDVNI
                     ALMNELSLLFHKLGIDTLEVLRAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQEVG
                     YHPQVILAGRRINDKMAIHVADEVVKLMLRRGIPVLDSRVLVLGLTFKENCPDVRNTK
                     AVDIVTTLRSYNAQVDVYDPWINIEDAEHEYGLSCLREAPRNDQYDAIVLAVAHHQFV
                     TMGVRAIKALGKAHAVLFDVKGILPRSEIDARL"
     gene            complement(33736..34899)
                     /locus_tag="CNE_RS18240"
                     /old_locus_tag="CNE_2c00260"
     CDS             complement(33736..34899)
                     /locus_tag="CNE_RS18240"
                     /old_locus_tag="CNE_2c00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041228497.1"
                     /db_xref="GI:752557265"
                     /translation="MRPRATSSPGRHQDADATEAPAICFLTGTLNVFGGAERMAATVA
                     NELARRGHDIHILSLCDPRSCFRLDPAVRHDALFDRRPSFRSQFLPTIARLRRYLRQH
                     KIAVLVEVDPLLTLFTLPACLGLGMRRIAWEHCNFDQDLGLPLRSIARRLAARTCERI
                     VVLTELDREKWVRSLHCTNIDVIPNILTFPIPAEPAARTSRTAVAVGRLADVKGFDVL
                     LQAWVPIATTFPDWRLRIVGNGELLESLTQLRDRLCLQDCVHIEPARSDIESVYRDAS
                     LLCLSSRFEGFSLVLLEAMAYGLPVVATNCETGVKAMLTHGENAQLSPVDDPAALARG
                     IAAVITSPELAARLSEAGRRHAQRFTPGEIGTHWERLLSGTSGETTTSEIGMA"
     gene            complement(34877..36052)
                     /locus_tag="CNE_RS18245"
                     /old_locus_tag="CNE_2c00270"
     CDS             complement(34877..36052)
                     /locus_tag="CNE_RS18245"
                     /old_locus_tag="CNE_2c00270"
                     /EC_number="2.4.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013951751.1"
                     /db_xref="GI:503717675"
                     /translation="MDQSQSGKPAGPMRITLLITCLQMGGAEQQVAALARQYLSLGHA
                     VSVISLMPGCEVKLPEGVETLMLAIRKTPLALLATLMQVRRFVLRWRPDVIHAHLVHA
                     NLVARLLTRVCPVPATICTAHNYMEGGTWRMLAYRLTDRWADLTTQVSNEGRQRMIEV
                     RAAPETRIIYMPNGFDTTRYRPSAEQRAATRAGLGLGPGDRFVLNVGRLVPDKAQADL
                     IDAFAQACPGPGTVLMIAGDGPLRDALAQRIAQHGLSGRVRLLGQRADVPALLNAADL
                     FVLSSLIEGMPLVVGEALACGCPVVATDASGVPAMLGTIGTLVPRGDTAALARAIRDA
                     VAHGRGEPVDEAARHQHIAAAFNIEVIAREWLRLYARLASAGAAPHVEATDAAARYQ"
     gene            36271..36870
                     /locus_tag="CNE_RS18250"
                     /old_locus_tag="CNE_2c00280"
     CDS             36271..36870
                     /locus_tag="CNE_RS18250"
                     /old_locus_tag="CNE_2c00280"
                     /EC_number="2.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transferase"
                     /protein_id="WP_013951752.1"
                     /db_xref="GI:503717676"
                     /translation="MKRVLDVVLTSVALVVLALPLLVVMGLVRWKLGGPVFFRQTRAG
                     LDGKPFEVIKFRTMTDERGPDGELLPDAQRITPFGWMIRRTSIDELPELWCVLKGEMS
                     LVGPRPLPTFYLPLYSPEQARRLLVLPGITGWAQVNGRNSLSWEEKFRLDVWYVDHQS
                     FWLDLRILWRTIGTVLAKEDISAAGEVSATRFCGSKEAP"
     gene            36918..38102
                     /locus_tag="CNE_RS18255"
                     /old_locus_tag="CNE_2c00290"
     CDS             36918..38102
                     /locus_tag="CNE_RS18255"
                     /old_locus_tag="CNE_2c00290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_013951753.1"
                     /db_xref="GI:503717677"
                     /translation="MLDTGFSPWPSFSREEAQAVQRVLLSNRVNYWTGTECRDFEKEF
                     AAWCGAEYAVTLANGTLALDVALHALDIGPGDEVVVAPRTFLASVSCVVNAGAKPVFA
                     DVDPDSGNLSAHTIAAALTPRTRAVICVHLAGMPCDMDPIMALAREHGFKVIEDCAQA
                     HGAVYKGRMVGTIGHIGAWSFCQDKIMTTGGEGGMVTTDDRELWSHMWSYKDHGKSWE
                     AMHGRAHPPGFRWVHDAFGTNWRMTEMQAAIGRIQLRRMADWHERRTANAMALADALG
                     ACDALHVPLPPAGIEHAWYKFYAFVQPRGLAEGWSRDSIMAAINAAGVPCYAGICAEV
                     YLEKAFDGTGLRPPARLPAARALGETSLMFLVHPTLTDDEVRMTGQVVRSVMQQATRV
                     AA"
     gene            38102..38854
                     /locus_tag="CNE_RS18260"
                     /old_locus_tag="CNE_2c00300"
     CDS             38102..38854
                     /locus_tag="CNE_RS18260"
                     /old_locus_tag="CNE_2c00300"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 superfamily"
                     /protein_id="WP_013951754.1"
                     /db_xref="GI:503717678"
                     /translation="MATFLWNHYLYFGESRVALPLVAWVAVCFVVAGQGWRALRWAVS
                     FGVGGALLIAAKSAFSYAGWSLPTIGVYSVSGHAMLTAAVYPVLLMLLGSVLGRQMAW
                     LGLATGVGLALFMPVVLVTDFHHTIGESLIGLGVGFAVAGVTLWRWRPVGFLHVGAAV
                     ALLVPVALLFDPRDAVEDLQGALRSRVMLWTGATGEYWRSIDPDPATGRRVISVGFWS
                     ERDTSGQVPHRRRHHSAWPSYEVLIERAGRHP"
     gene            38851..39918
                     /locus_tag="CNE_RS18265"
                     /old_locus_tag="CNE_2c00310"
     CDS             38851..39918
                     /locus_tag="CNE_RS18265"
                     /old_locus_tag="CNE_2c00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951755.1"
                     /db_xref="GI:503717679"
                     /translation="MKSATEFGSFFPLDPAVPLGGEAWLRPGDLLTGTGRDALRAMVA
                     HGRSHGWRRLYAPSYYCHAVLDDIARDIDVRMYLHAPFGGPAQLALGDDEAAIVPEYF
                     GLQAEVEVQGGSVLLDRSHDLLATWSYARAPDYVFASLRKTLPVPDGGLVRPPPGQPF
                     ARSLAPTPAHVRAAASMAAAMAMKAAYLAGAQVAKAAYLALAAEAEGNLRSDAEISGP
                     SALTRVLAPAVDLGWMRQRRQENLALLARCFAGPHAALPAGMQWRETPAFGILLCADA
                     PQRERVRQRLIGADVYPAVLWPMTWPGVPEDNHRLCGRILVLHADYRYGLHDIGRLGE
                     IILQIAASIAANPDTSDEDRR"
     gene            39915..40940
                     /locus_tag="CNE_RS18270"
                     /old_locus_tag="CNE_2c00320"
     CDS             39915..40940
                     /locus_tag="CNE_RS18270"
                     /old_locus_tag="CNE_2c00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_013951756.1"
                     /db_xref="GI:503717680"
                     /translation="MMKINLLETSSAEWLDVLQRCRHDSHHMPGWLRAAQHEGSGKAF
                     AIHVMDDGHELFVPLLNRDINGKDWDASSPYGFAGPLVSDDAPDAFIDTALSEALELL
                     RGRGCVSCFIRLNPIVNAPWRSAVGTLIDHGMTISIDLSKSEAEHWHDTSHGHRLEIS
                     KAMRAGVTVRLDETLETLPHFIRLYNASMDRLRASDYYFFDDAYHYTLARELGDRLRL
                     FVAEEDGVIIGGATVTVSDGTGILQGHLMGIDARYRHRQPSKIMLHAIRQWGREQGHR
                     YYHLGGGLGGSAEDSLFRFKRGFSPDTHVFRTQRVVVDPGKYLALCDGTPSVLEDLSG
                     YFPAYRR"
     gene            complement(41031..43100)
                     /locus_tag="CNE_RS18275"
                     /old_locus_tag="CNE_2c00330"
     CDS             complement(41031..43100)
                     /locus_tag="CNE_RS18275"
                     /old_locus_tag="CNE_2c00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="WP_013951757.1"
                     /db_xref="GI:503717681"
                     /translation="MTAPRSLRLLSLSRRQKIVLMMTVDLLALPLCFALALLLRSGNQ
                     ELIVQYGLLPPLFIAACTIPVFSFSGLYRTVLRYIDLKVLWAAGISMAAMVGLTYAVS
                     FLMNDSRLPRAGLLIYWFIAFAYVVISRFLIRAMLRRTELWRSARGRPTRRVGIFGAG
                     EAGFQLANAMRASVDHEAVCFFDDDLSLDNHTFTDLPVFHTSRMREQLQRLGIDEVVL
                     AVPSLSPDRRKRILDKLHRYAVSVRTLPTLLELVDRKITMQSIREVKVEDLLGRPAVP
                     PREALFAKCTHRKVVMVTGAGGSIGSELCRQVATQQPRKLILFDHSEWALYMVEQDLR
                     RNFPGVPLLARIGSVCDANAVAAAMQGQQVDTIYHAAAYKHVPLVESNMPEGIRNNVL
                     GSLTIANMADRFGVQTCVLISTDKAVRPTNVMGASKRIAELIFQAAAARPGTRTVFAM
                     VRFGNVLGSSGSVVPLFRSQIEAGGPITITHPDVIRFFMLIPEASQLVIQAGAMARGG
                     EVFVLDMGQPVRIVDLARTMIEMAGLVERTPKNPNGDIEVKFVGLRPGEKLYEELLIG
                     GNVTPSDHERIMCSQEPSLEEAELREMLTRLYAACDARDELKIQTMVQAIVPEYAPYT
                     SLDDASRKPVPAAVPAESGQAIQDTPDDARVPRQVVLRRVASHALGQPELASEAKPVS
                     LSSPGKL"
     gene            complement(43097..43288)
                     /locus_tag="CNE_RS18280"
     CDS             complement(43097..43288)
                     /locus_tag="CNE_RS18280"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228498.1"
                     /db_xref="GI:752557266"
                     /translation="MREPTATHGITASRRLTPAPSGQKSRAMDTPIWMHRAVPASQSL
                     WAMRVAVTMAAVVLQEFRA"
     gene            complement(43596..44525)
                     /locus_tag="CNE_RS18285"
                     /old_locus_tag="CNE_2c00340"
     CDS             complement(43596..44525)
                     /locus_tag="CNE_RS18285"
                     /old_locus_tag="CNE_2c00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013951758.1"
                     /db_xref="GI:503717682"
                     /translation="MPASSFLPTVSVCISTCDHPEQLRHTLQSVADSTMPPHQLIVTD
                     DSSGYDTREMMRRDYPDITYLEGPRRSRAANRNRALRAATGSHVLFLDDQTLLGATFL
                     QQMTESVADDHLRRATAGCATPLILTGTEVCQGRRGAPRKPAFLGYPTLDYRRGERLC
                     SVLLHSAVFPRELFENLSFDEHLAVGYDDLELAARAVQEFGYRIEMVPSAVNQRLPSV
                     SADRPCPASDASRLYVACRRYDHGPEHPLKTALFLLLALPHDLAHHLRAAGLRGAGTF
                     YDTATCLWQLLRGPRPAGRQGSGTGLSAPLPRD"
     gene            complement(44604..45560)
                     /locus_tag="CNE_RS18290"
                     /old_locus_tag="CNE_2c00350"
     CDS             complement(44604..45560)
                     /locus_tag="CNE_RS18290"
                     /old_locus_tag="CNE_2c00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013951759.1"
                     /db_xref="GI:503717683"
                     /translation="MNALLIEEHPLLRLGLLQMLENIQESAQVAAIAPADIARLDSRH
                     HNADLLVFGMPADVGSGWPQLEQAREALSPHRILILADILPLHVPNADSARGVCGCLP
                     KSASLAVIEAAIRLAVSGVQGLLFSAETGSMPSASRSAMPAVQSLASAAPLPLNPAHA
                     LTGEQLSLVACAGTPGAARTTVAVRDLTCLRPGQPLSAPASTSPAPLVEEEPSYDEAE
                     MLKITPRQYEVLVLLARGYPIKTVSRMLNISVATVKSHACTLYQRLKVRNKGEAVYAA
                     LQRGATLEWVSGDERLTRGSNARPVVASRTSDAAFQAASPVL"
     gene            complement(46279..46596)
                     /locus_tag="CNE_RS18295"
                     /old_locus_tag="CNE_2c00360"
     CDS             complement(46279..46596)
                     /locus_tag="CNE_RS18295"
                     /old_locus_tag="CNE_2c00360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951760.1"
                     /db_xref="GI:503717684"
                     /translation="MKRQLLLAAAVLATSGVFGLTAPAEAQPVVVAHGYGHPPPPPRY
                     EPHPAARRGQVWVPGHWAATGGRYDWRGGYWQAQRPGYRYVPERWVRGPHGWVMRPGH
                     WAR"
     gene            complement(46636..46758)
                     /locus_tag="CNE_RS18300"
                     /old_locus_tag="CNE_2c00370"
     CDS             complement(46636..46758)
                     /locus_tag="CNE_RS18300"
                     /old_locus_tag="CNE_2c00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951761.1"
                     /db_xref="GI:503717685"
                     /translation="MKRALSLVVLLSTTAALLSACIVVPPRGGPPPRYHHYDRY"
     gene            47482..47925
                     /locus_tag="CNE_RS18305"
                     /old_locus_tag="CNE_2c00390"
     CDS             47482..47925
                     /locus_tag="CNE_RS18305"
                     /old_locus_tag="CNE_2c00390"
                     /EC_number="4.2.1.104"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0K572.1"
                     /note="catalyzes the reaction of cyanate and bicarbonate
                     to produce ammonia and carbon dioxide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyanate hydratase"
                     /protein_id="WP_041228499.1"
                     /db_xref="GI:752557267"
                     /translation="MNRSDVTDLIIEAKVTRGITWAQVAERVGRSKEWTTAACLGQMA
                     FDAAGARAVMEAFGLPPEAEPWLREVPYKGSLPTQVPADPLIYRFYELISVYGTTFKA
                     LIHEEFGDGIMSAIDFRMDLQREPDPNGDRVRIEMSGKFLPYKTY"
     gene            complement(47919..49181)
                     /locus_tag="CNE_RS18310"
                     /old_locus_tag="CNE_2c00400"
     CDS             complement(47919..49181)
                     /locus_tag="CNE_RS18310"
                     /old_locus_tag="CNE_2c00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013951764.1"
                     /db_xref="GI:503717688"
                     /translation="MAEGARGANGSAVRNIRTTPRWLVLAAVAGIGLNLRPFLTAVGP
                     LAPAIRTGTGLSYQGMAWLTLLPMLLMGVGAFFGPAIRERLGARAAVLGALALLGAGC
                     ALRLGVADGTWLIASAALCGLGVAVVQAACPGLVKQEFPGRVAPVMGLYSAALMGGGA
                     LGAQLSPYVTALAGSWRDALALWAMPALAALALAWVALPRAAARGPGVPASRPAGATR
                     ALLRRPRTWLLMACFGVMNGGYASLVAWLAPFYQDHGWSASASGSLVALMAVAQAAAA
                     LLLPVLAARSLDRRAWMALALAMQVAGFGGLALWPDAAPHAWAVIGGAGLGGCFALYL
                     VVALDHLPDPDSAGALSALMQGGGFLLASLAPWITAMLHERTGDFAAGWWYHLACAAL
                     VGVLTMRLDPARYDVSFALPPVRAVAPQ"
     gene            complement(49174..49611)
                     /locus_tag="CNE_RS18315"
                     /old_locus_tag="CNE_2c00410"
     CDS             complement(49174..49611)
                     /locus_tag="CNE_RS18315"
                     /old_locus_tag="CNE_2c00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMP deaminase"
                     /protein_id="WP_013951765.1"
                     /db_xref="GI:503717689"
                     /translation="MREAIRLAAANRDRGARPFGAVLVLDGEAVATGVNDIVHSHDPT
                     THAEMEAVRAAARKLGRPDLRGSVIYASGHPCPMCLAAMTMAGVQAVYYAFDNQDAAP
                     YGMSSDAAYQALRLSLNSPPLPLTRVPVDLSAAQLYGPRAPRG"
     gene            49811..50713
                     /locus_tag="CNE_RS18320"
                     /old_locus_tag="CNE_2c00420"
     CDS             49811..50713
                     /locus_tag="CNE_RS18320"
                     /old_locus_tag="CNE_2c00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228764.1"
                     /db_xref="GI:752557532"
                     /translation="MHDPRLDPVLLQSFVAVAESGSFTRAAQRVHLTQSTVSQQVRRL
                     EDQLGCVLLDRGGRYVTTTPEGERLLGYARRLQQLMAEAVGQLRQSAGQGEIRIGVPE
                     DFAARPLTPVLAGFADDWPGMRLEVTSGMSHELWQRFQDRELDLVLVKQRVGQAPGLA
                     SWPEPLCWFDSRGRPAVARDPVPLVAFPVGGLYRGEMTHALDAGGRRWRVAFVSASLA
                     SILAAVADGLGVTLLPRRLATAQHQVLEDDGWPAAVPDVELSLHAQPDLPAAARDMAA
                     RLAALCETVMGPGEPPADQPKNSL"
     gene            complement(50692..50880)
                     /locus_tag="CNE_RS18325"
                     /old_locus_tag="CNE_2c00430"
     CDS             complement(50692..50880)
                     /locus_tag="CNE_RS18325"
                     /old_locus_tag="CNE_2c00430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228500.1"
                     /db_xref="GI:752557268"
                     /translation="MTSPSNPRAQLARPDHQSAPEAGPLAAPDIPFGSLEAAAMAELP
                     YTFRPAGTCTRYYNEFFG"
     gene            51177..51872
                     /locus_tag="CNE_RS18330"
                     /old_locus_tag="CNE_2c00440"
     CDS             51177..51872
                     /locus_tag="CNE_RS18330"
                     /old_locus_tag="CNE_2c00440"
                     /EC_number="2.4.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_013951768.1"
                     /db_xref="GI:503717692"
                     /translation="MSMPPCFADRREAGLYLGRRLAELGFGAAQLGQPALVLALPRGG
                     VPVAFEVVRALDAQLDVLLVRKIGAAGYPELALGAVVEGDAGGGGPHTVVNNDPWARR
                     AVESGSFDAERGRQLDEIARRQQRYRGGAPVPARAGRTVIVVDDGVATGATMRAALES
                     VRMAGAARVVAATPVGSGEGLASLSAAADEVICLNTPPSFGAVGAFYLDFSQTSDEEA
                     LALLRAAAAPPAR"
     gene            complement(51880..52401)
                     /locus_tag="CNE_RS18335"
                     /old_locus_tag="CNE_2c00450"
     CDS             complement(51880..52401)
                     /locus_tag="CNE_RS18335"
                     /old_locus_tag="CNE_2c00450"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_013951769.1"
                     /db_xref="GI:503717693"
                     /translation="MTSAIAPAPAGRLWRFGDNIDTDAMAPAVLMKSPLPVLARHCLA
                     SLRPEFPGSVRAGDVLVAGANFGIGSSREQAPQALRELGVGAVVAQSFGGLFYRNAIN
                     LGLPVLVCADTSRLADGAHAVLDLASAQLRLDDGSLVACEPIPDFLRAILAAGGLVPH
                     LKARLGKGQADQG"
     gene            complement(52449..53735)
                     /locus_tag="CNE_RS18340"
                     /old_locus_tag="CNE_2c00460"
     CDS             complement(52449..53735)
                     /locus_tag="CNE_RS18340"
                     /old_locus_tag="CNE_2c00460"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_013951770.1"
                     /db_xref="GI:503717694"
                     /translation="MSHTPATLAQKLVARAAGLAHAEIGTVVICRVDLAMSHDSSGPR
                     RVAPLLQELGTGVWDPSRYVVVTDHFVPGGDAQAESILRFTRDWTRQSGAHFIDAEGI
                     CHVVLPERGHVLPGRLIVGGDSHSPTGGAFGAYMFGVGATEMAGVLATGEIWLRVPHT
                     IRLQWDGQLAPGVCAKDMMLFLCATLGMGGGRYEALEYTGSAVAALPMQERMTLANMS
                     AELGAQTGLVAPDAVTLGWLAEAGVPAQTLAAIDLAHWRTDPDAPVLATHRFDAAALV
                     PQVAAPHSPANSAPVGQAAGEPVQIAYLGACTGAKLEDLRMAARVLRGRHVAAGVTLQ
                     VAPASRRDQLLAEQEGTLGILTDAGATLLPNACGACAGYGAARFPAGSRAIASTARNF
                     SGRMGDVGSAVWLGSPMTVAASAVTGRITDPRTLLE"
     gene            complement(53732..54772)
                     /locus_tag="CNE_RS18345"
                     /old_locus_tag="CNE_2c00470"
     CDS             complement(53732..54772)
                     /locus_tag="CNE_RS18345"
                     /old_locus_tag="CNE_2c00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951771.1"
                     /db_xref="GI:503717695"
                     /translation="MPVFRLVPSSPTRSPSIPRRAAVQRLAMASLAACALALPLSAAA
                     QGHPQVAGGKPIRILVGAPAGGTTDTLARTIAQEMSQELGQPVVVENRPGAGGNIAAD
                     LVAKSAPDGSTLLMSFTSHTINATLYKKLPFDPVQDFTPITLVATVPSVLVATPKLAA
                     SNVPELIRLARSEPGKLNFAIGSVGSSLHMAGDMFKMMTGTYIVNIPYKGTAPALTDV
                     LAGQCDLMFASTINVLPHVRAGKLKVLGVTSPAPLPQFPGAAPIGATVKGFESSAWFG
                     LFGPAGMPHDVTQALYQAARKGLETPAVRKRLENDGAQPMGTTPEAFAAFVKQDVKRW
                     AAVVKYSGASPE"
     gene            complement(54883..55668)
                     /locus_tag="CNE_RS18350"
                     /old_locus_tag="CNE_2c00480"
     CDS             complement(54883..55668)
                     /locus_tag="CNE_RS18350"
                     /old_locus_tag="CNE_2c00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013951772.1"
                     /db_xref="GI:503717696"
                     /translation="MSEAVVPLYHQIYVVLRQQIVEGRFGQGPLPGEIDLAKQFHASR
                     VTMRRVFDRLVQEGLVRRHRGLGTFVNPHPVRPAAAAGEERGTSLLDNIIDMGQKTSV
                     KVISIDEVHATPDVAESLQIEPGDPVVKIVRVRHYRNRPLSHITVYLPADLGRPITRQ
                     SLEERPVLRLLEAGGVKLGRATQVLSARLADVVVAPLLDVPVGGALLAVRRVVKDAAG
                     RPVQLLLGQYRPDRYEYRMELSPAGVDSANVWVESETRPGLRD"
     gene            56381..57808
                     /locus_tag="CNE_RS18355"
                     /old_locus_tag="CNE_2c00490"
     CDS             56381..57808
                     /locus_tag="CNE_RS18355"
                     /old_locus_tag="CNE_2c00490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951773.1"
                     /db_xref="GI:503717697"
                     /translation="MNKTLLASAIALAFGAGQALANPTNNADDSGTTNTQNATATSTQ
                     SGSGAAANENSTAVQANDSSTTTKTSTRTSTRTSTNTNSKNRTDQDMRGYGNAAAANG
                     STATANFSNAFNTSKALAISKLEGYVSGNTIAAMGNRAGNWGDANGGLGGKGGRGIGG
                     VGNGGNGGNGGNGGNGGSGGSATNGSATNGAATNYGARAGSGGDGGKAVGWAGDGGNA
                     KSYGGDALSAAATRGGSGGDAIGAGGRALSASLGAGGRGGSALGASLGLGGAAGSAGG
                     SSGNGGAGNDTVGAGGAAGAATAAGSAGAGTGTGGAGGAGTSSASATGGAGSGTGGAG
                     GAGGTGTSTAAGGASTSTGGAGGTQASVGGAGGAGGAATNGSASSSATNGSATAGNGA
                     TGAVGATGGAGGVGNGGTGNGAVGGAGGAGGTVAVSAGSFSLSNVMTSVGQTAAGIMV
                     ANQNLGAASLVQQSVNVQANLSVGR"
     gene            58009..58404
                     /locus_tag="CNE_RS18360"
                     /old_locus_tag="CNE_2c00500"
     CDS             58009..58404
                     /locus_tag="CNE_RS18360"
                     /old_locus_tag="CNE_2c00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951774.1"
                     /db_xref="GI:503717698"
                     /translation="MQPIHTAVTALTAAFLAWPFMQAQAGPLAGDAAVPAPVAAVAPA
                     ASNPFGTAAVAVASDKLDDVRGGAEVVVNDMRLHGTVADNAAVHTLSGTNMITEGAFA
                     NAAGIPTAIQNSGNNVLIQNATIVNVQFK"
     gene            58404..59102
                     /locus_tag="CNE_RS18365"
                     /old_locus_tag="CNE_2c00510"
     CDS             58404..59102
                     /locus_tag="CNE_RS18365"
                     /old_locus_tag="CNE_2c00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C39"
                     /protein_id="WP_041228501.1"
                     /db_xref="GI:752557269"
                     /translation="MKMLQRLLRALPFVLALGGTPPALADRISIYGPVGEYYSVPVTS
                     LREARFKTTIRQQYDFSCGSAAVATLLTYQYGQPVSEELVFANMFVNGDQAKIRQEGF
                     SLLDMKRYLASQGFLADGYELPLSKLEETKIPAIVLIAENGYHHFVVVKGVRGDRVLI
                     GDPARGTRSISREHFESIWESQLLFVIHNRTEQARFNLAADWRVAPSGPYWMGVNRDS
                     LFFTVMPKHGASDF"
     gene            59113..59976
                     /locus_tag="CNE_RS18370"
                     /old_locus_tag="CNE_2c00520"
     CDS             59113..59976
                     /locus_tag="CNE_RS18370"
                     /old_locus_tag="CNE_2c00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="WP_013951776.1"
                     /db_xref="GI:503717700"
                     /translation="MFETSAPNTTACRSRGAGTATAAVLFGAGMACATAAQASEQPLP
                     DALDAAAVPAQTVLDTQENKQDQTLAAATQGSMAGWKPVSEDKLDEMRGGFDAGGLQV
                     SFGIERAVYVNGALVVATSINIPDIARITSDQAAKLASALAPAIVSNTYADVNSAMAG
                     NPATAGVQLGSNGSSSAGAAGTATAVASNGASASSAGAAGLPSTAVTTPTGQVVTNGL
                     LAVIQNGAGNSAAVANGTSPMTVIQNTLNNQSIRSLMTIDTSVNTLQAFRSQVANATL
                     NNVLLRAASMR"
     gene            60062..61501
                     /locus_tag="CNE_RS18375"
                     /old_locus_tag="CNE_2c00530"
     CDS             60062..61501
                     /locus_tag="CNE_RS18375"
                     /old_locus_tag="CNE_2c00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_013951777.1"
                     /db_xref="GI:503717701"
                     /translation="MKKRSMQGIRSAGCSTLLLLGGLAHAQTTLDAGPPAAGLESLQN
                     QLAEQASQLDAMKRALAEQEALIRELRSVIGPEVLSRKRGGAGPGVTPMDNATNAAAA
                     AAGASATQGVPNAVTSPQATQGDQPPQMVVQPGQPQQGESTYQQVVADEPVGKPPERD
                     TRPPEIAPITEQPGVLTAQGKLVIEPGFQYGYSSNNRVALVGYSIIPALLIGLIDVRE
                     VKTSTYIPSVAFRYGITKRLEIEAKVPYVHSSGSTVSREVFTGTAVDRVFNASGSGIG
                     DVEATVRYQLNYGSEKLPYFIGWLRYKSNTGKDPFEVVTDCVTRCVGNATGTGLPLGL
                     PTGTGFQAIQPGVTWLLPTDPAVFFGTFSYLHNFARDNVSRTVLNGEKEPLGKIAPGD
                     IFEFSFGMGLALNERASFSIGYDQSIIWPTKQNGQTVPGSVRVTQGTLLVGYSYRFSN
                     RYTLNLSVGAGLTRDTPDLQVNVRLPITF"
     gene            61717..62229
                     /locus_tag="CNE_RS18380"
                     /old_locus_tag="CNE_2c00540"
     CDS             61717..62229
                     /locus_tag="CNE_RS18380"
                     /old_locus_tag="CNE_2c00540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951778.1"
                     /db_xref="GI:503717702"
                     /translation="MRKRIFWLLPDLASARRTMDDLLLARLENSHIHFVARDGSDMTG
                     LHEANLFQTSDIVHAAEMGLMVGGGVGVVAGVVVAMFPIVSDTPQWGLVGVLAVLGAV
                     FGAWASSMIGSSAPNSRLRAFEKDIEAGKILLMVDVPRSRVEEIETLLANAHPEASFA
                     GLDPAVPAFP"
     gene            62503..63639
                     /locus_tag="CNE_RS18385"
                     /old_locus_tag="CNE_2c00550"
     CDS             62503..63639
                     /locus_tag="CNE_RS18385"
                     /old_locus_tag="CNE_2c00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013951779.1"
                     /db_xref="GI:503717703"
                     /translation="MKAKWIACGMLAATLGWAAQTALAETGVTRNTIRIGQSAGITGP
                     VAGSVKEQIAGAQVYLRTINASGGVAGRRIELVTHDDGFDAKRTPDNVRKLIDEDKVF
                     ALFMVRGTPQNESILPIIAAQKVPLVAPLTGAITLHRPVNRYVFNVRAKYQDEVARAI
                     NHLATSGMSRIGIFYANDGFGRDVLEGYSAALQARGVQPAATASFARPMGDITQSVAA
                     MNKANPQAVLVIGSGSEAARIIRELRRAGSEAQFVTLSNNAADSFIRELGADARGLII
                     TQVVPGTNSSQMTLASEYRSLAKQQGVEPSNAGMEGFMSAKVLVEGLRRAGPDLTRER
                     LVTALEGMRDYDLGGILISYSAERHTGSSFVEMSIVSSTGKLIR"
     gene            63676..64467
                     /locus_tag="CNE_RS18390"
                     /old_locus_tag="CNE_2c00560"
     CDS             63676..64467
                     /locus_tag="CNE_RS18390"
                     /old_locus_tag="CNE_2c00560"
                     /EC_number="1.1.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012354922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="WP_013951780.1"
                     /db_xref="GI:503717704"
                     /translation="MATPTPSPDSRTPFSLHGRVALVTGGAQGLGLAIAAGLADAGAH
                     VLVVARNAQRVQAAVAALAARGGSAEALVLDITDEAAVAAAFDRIDAAHGRLDILVNN
                     AGARNRSTMAQLDAGDLRAMLETNLVAPYTLCRLAAQRMRRGDYGRIVNVSSIAGQVA
                     RAGDVLYPATKGALDALTRAMAADLGRHGVTVNAIAPGYFATEPNQAMVEDEGVAEWL
                     RQRTSLGRWGQPEEVAGAVVFLASPAASYVTGQVLAVDGGYLGHF"
     gene            complement(64523..65428)
                     /locus_tag="CNE_RS18395"
                     /old_locus_tag="CNE_2c00570"
     CDS             complement(64523..65428)
                     /locus_tag="CNE_RS18395"
                     /old_locus_tag="CNE_2c00570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951781.1"
                     /db_xref="GI:503717705"
                     /translation="MNLSVKHLRAFVALATYRNFTRAARACHLSQSAFSALVQTLEEQ
                     AGSRLFERTTRHVELSSDGVRFEQTARRLLADFETAFEDLRAHAERRKGRVSIAALPS
                     LAAGDLPPLLAQFRALYPGIALELFDQLADGCIELVRQGRADFALAPAPAQDDDLRVE
                     PLVRDTFHLVCPADHPLARKRRITPEMLAGLPFIQLSRTTSVRQHLDAALHPLRLTSV
                     MEVEHLATVAALVQAGLGVSAVPSLALFQFRREGLAIRPLQLPSLVRDICLVRLKDRG
                     DSAAAAAMIDCLQAFYRGGKPPARR"
     gene            65543..66904
                     /locus_tag="CNE_RS18400"
                     /old_locus_tag="CNE_2c00580"
     CDS             65543..66904
                     /locus_tag="CNE_RS18400"
                     /old_locus_tag="CNE_2c00580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951782.1"
                     /db_xref="GI:503717706"
                     /translation="MTAPLLIGSGAGFSGDRTDAALPVVRTLIACGQPAALIFETLAE
                     RTLALAQLARRNDPAQGYEPLLDALLVPVLGLCLQHRIPIVGNFGAANPRAAARRVLQ
                     LAQELGLPAPRVAVVEGDDLSDDAGRARLHGILGDAFEADRFVCANAYIGAQGIAEAI
                     AADAQVVVCGRVADPALAVGPAMAHFGWSWDDWDRLAAATMAGHLLECGAQVTGGYFA
                     DPGMKDVPDVHALGFPIAQLDADGGIEIFKAANTGGCVDLRTVKEQLLYEVHDPAAYL
                     TPDVVADIGAVTVAQLGPDRVAVRNVRGHPRPAQLKANVFSHGGWLAEGEISYAGPNA
                     AARARLAADILCRRMQLLGHDAPIRFDLIGVLSVLADDGGAMFAQRQPHEQAAQDVRL
                     RAALAHDDLAVAQALQREVNALYTCGPAGGGGVRTAQRARLNAVSCLVPREAVTATHS
                     FIA"
     gene            66917..67270
                     /locus_tag="CNE_RS18405"
                     /old_locus_tag="CNE_2c00590"
     CDS             66917..67270
                     /locus_tag="CNE_RS18405"
                     /old_locus_tag="CNE_2c00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_013951783.1"
                     /db_xref="GI:503717707"
                     /translation="MTDTAALYQFAHGRTGDKGNRSNISVIAYDARNYDHLVTHVTED
                     AVRALFRERRPTSVTRYLVPSLQAMNFVLDGVLDGGVNDALNLDTHGKALSFRLLQLE
                     IPVPPRLASGAADSH"
     gene            67313..68278
                     /locus_tag="CNE_RS18410"
                     /old_locus_tag="CNE_2c00600"
     CDS             67313..68278
                     /locus_tag="CNE_RS18410"
                     /old_locus_tag="CNE_2c00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013951784.1"
                     /db_xref="GI:503717708"
                     /translation="MYPFLKPLAVAALALILPAGLAWAEFPDKPIRFVVPFAAGSATD
                     QLARAIGQAITVDSKTTVVVDNKPGANGFIAASDVAKAAPDGYTVLISTNTTHAANEH
                     LFKKLPYDPVKDYAPITTLGRGGQIMVVNPQVPAKTVGEFIALAKQQPGKLSFGSGSS
                     SSRIAGELFQQMAHVELLHVPYKSNPLAITDLLGNQIQMMITDTATGLPQVKSGKLRA
                     LGVSGKTRSPLAPDVPTIDEAGVKGYEMSYWFAAYAPAGTPQPVVAKLNAMMVKAARG
                     DTAAGFYKSTGTEVFTSTPAELAKFQLQESGKWGRIIKAANIQPE"
     gene            68465..69511
                     /locus_tag="CNE_RS18415"
                     /old_locus_tag="CNE_2c00610"
     CDS             68465..69511
                     /locus_tag="CNE_RS18415"
                     /old_locus_tag="CNE_2c00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_041228502.1"
                     /db_xref="GI:752557270"
                     /translation="MKQQSVVCHATLRPGRRPVLRQAVLRAAIAVTIGAAVLPAIATA
                     QTTTPPAQQKTQVPGYYRMMVGQLEVTALYDGYIDLDPKILKYTSAREVQSLLARMFV
                     ESTPGMQTAVNAYLIHTGSHLVLVDTGAAACFGPTLGRIGENLRAAGYAPEQIDTVLL
                     THLHGDHACGLATDGKAAFPNATVYVDKADADYWLSEANAAAAPKEAQGLFAMARAAV
                     APYQAAQRFRPFSGGAGVEPVPGVRAVPANGHTPGHSGYLFTSGKDSLLLWGDIVHSH
                     AVQFRRPQVAIEFDVDSHQAVITRQRILADAAKGRLWVGGAHMPFPGLGHVRRDVAGY
                     AWVPAEFGPIRNDR"
     gene            69609..70373
                     /locus_tag="CNE_RS18420"
                     /old_locus_tag="CNE_2c00620"
     CDS             69609..70373
                     /locus_tag="CNE_RS18420"
                     /old_locus_tag="CNE_2c00620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP oxidoreductase"
                     /protein_id="WP_013951786.1"
                     /db_xref="GI:503717710"
                     /translation="MNARASRFDPARRRWLGAGAAALVLAAPLPRAACAQPGPAAGRE
                     AAAQRIGVIGSGRIGGTVGGLWVKAGHPVLFSSRHPEALKPLVEELGTLARAGTVAEA
                     IAFSNVLFLATPYGALPQLSRDHAEAWRGKIVLDATNAYEHRDGPITEEARRDGIGIT
                     TARYLRGARVVRAFNFMGAAQFASEHHRAGGLVAVPIAGDDKAALDVAAQLVRDAGFE
                     PVVVGPLASADRFAPGGPLFRQVGTAEEFRRKMGAR"
     gene            complement(70399..70788)
                     /locus_tag="CNE_RS18425"
                     /old_locus_tag="CNE_2c00630"
     CDS             complement(70399..70788)
                     /locus_tag="CNE_RS18425"
                     /old_locus_tag="CNE_2c00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_010814084.1"
                     /db_xref="GI:498513656"
                     /translation="MEIRNLLPDDIEAARQLLIANGWAHRVGGPEKFARLVANSQRVV
                     VAVEHGEIVGFARALCDDVCDGFLSMVAVAPSHRRRGIGRALVRHIVGNDPDITWMLR
                     AARSSEAAFFGQLGFTPSMVAMERRRP"
     gene            70976..72463
                     /locus_tag="CNE_RS18430"
                     /old_locus_tag="CNE_2c00640"
     CDS             70976..72463
                     /locus_tag="CNE_RS18430"
                     /old_locus_tag="CNE_2c00640"
                     /EC_number="3.2.2.4"
                     /function="Nucleotide transport and metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP nucleosidase"
                     /protein_id="WP_011616336.1"
                     /db_xref="GI:499935602"
                     /translation="MASMNAPVFSSAHPADQLAEFTDADAAIARIRDIYEASVGAVRA
                     RFDAFASGKPLPSAAHACYPYLGISVNIETMVTDSRPSWGTVAYPGVYGTTVTRPDLL
                     ADYYRDQIERLMRYHRVPVVVGLSRRPIPLPFVIEASTTDISYTQARELEASFVLPEL
                     SRIDDGIANGTYEPIPGEAWPLSLFPAERVDLALQRLYHYTGTAPQHFQRFVLFTNYQ
                     RYVDEFVELGRGLMASSDGGGYTRFVEPGDVMQELGGAEPDDASRPRALPQMPAYHLV
                     REDKLGVTLVNIGVGPSNAKTMTDHLAVLRPHCWLMVGHCGGLRRSQQLGDYVLAHAY
                     VRDDHVLDHDLPPWVPVPPIAEIQVALQEAVARVTGLSGNEMKTRMRTGTVVSTDDRN
                     WELKSKSLYARFNQSRAIAIDMESAAVAANGFRLRVPYGTLLCVSDKPLHGELKLRGM
                     ANAFYRQRVSQHMTIGLEAIRILRENGVEQLHSRKLRSFDEPAFR"
     gene            complement(72541..73185)
                     /locus_tag="CNE_RS18435"
                     /old_locus_tag="CNE_2c00650"
     CDS             complement(72541..73185)
                     /locus_tag="CNE_RS18435"
                     /old_locus_tag="CNE_2c00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951787.1"
                     /db_xref="GI:503717711"
                     /translation="MKTISLRTRVTCSAIAACAMLGAFATPAAAADDAQGNWMVRLRG
                     TYLDMAKSSDPVGGVGPSDRITVNNKWIPEFDVTYFFTPNIAAELVLTVPQKQNVYLD
                     GNKVGTFKHLPPTLLVQYHFIPNGTFRPYIGAGLNFTRIWGENIANNALQLDSWSVGP
                     ALQIGMDYKLTKNWFLNADIKKIWLSSDVKAGDVKVSKVNLDPWLFSMGVGYRF"
     gene            complement(73529..75226)
                     /locus_tag="CNE_RS18440"
                     /old_locus_tag="CNE_2c00660"
     CDS             complement(73529..75226)
                     /locus_tag="CNE_RS18440"
                     /old_locus_tag="CNE_2c00660"
                     /EC_number="2.3.3.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_013951788.1"
                     /db_xref="GI:503717712"
                     /translation="MLSNPATKYQPAATVDIPDRTWPGRTITRAPRWMSTDLRDGNQA
                     LIEPMNPARKLRFFEQLVKIGLKEIEVAFPAASQTDFDFVRMLIEEQRIPDDVNIVVL
                     TQSREDLIRRTVQSVRGAARATVHLYNPIAPAWRRIVFNASREEIKEVAVSGTRLIKA
                     LTDAMPGTAWTYEYSPETFSLAELDFSLEVSDAVSAAWQAGPGRPMILNLPTTVECST
                     PNVFADQIEWMHRRLARREHIALSVHPHNDRGTAVAAAELALMAGADRVEGCLFGNGE
                     RTGNVDLVTLALNLYTQGVAPGLDFSDIDAVRQCVEHCNQLPVHPRHPYVGDLVFTAF
                     SGSHQDAIRKGFAQQQPDSIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQ
                     VHGIYMPRRLQIEFSRAVQAMTDDTGLEASADDLYGLFQREYLAQQTPLRYVSHQLVS
                     DSGGATEIEVQMVRDGKQRSVRGTGNGPIDAFVNALDLPVRVMDYHEHAMTAGADARA
                     ACYVEVRVGDSPTGFGAGIDANLVTASLRAVISGVNRHLQAGFGVAQASQSAEAAEA"
     gene            75863..77179
                     /locus_tag="CNE_RS18445"
                     /old_locus_tag="CNE_2c00670"
     CDS             75863..77179
                     /locus_tag="CNE_RS18445"
                     /old_locus_tag="CNE_2c00670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951789.1"
                     /db_xref="GI:503717713"
                     /translation="MTLLLAACGGGGGGSGTPTTPNAGGTTPLTYTVKMSVTSGEVGV
                     GRTITISALAVDSNGIDVSGNTTFNWTSTDSGIATVEPSATTPGSAVVKGIATGTTTV
                     QVVASVKGADNTTVQLPAQSATITVVPASALSYSLSIPNSSLSMSDGQTLPVRVSLVD
                     SNGADVSASVNSWAWSSSGTAVQVTASQNSATLKASNSSPTAVATASVSVSVTAPDGH
                     AIAGVIAVTVQKNGAAAYRVVTTKGGREVNALQVFSNRPETFTSRVLRHDGQDVTADF
                     DGAWTYNATSATLSASEAAGTHDATVSTSLASDKGPVQSSLTVTAVSTRLGERRSATL
                     TVTENPVWALVGDNQDPMTLLLMPPTTVEVTARMKHLGDDAQYTACNNWAWDKTGPVT
                     LSPSMVMLPNQVRAAGTAAGDFTITATCTAAADNTPLKLVFYGTVK"
     gene            complement(77569..77886)
                     /locus_tag="CNE_RS18450"
                     /old_locus_tag="CNE_2c00680"
     CDS             complement(77569..77886)
                     /locus_tag="CNE_RS18450"
                     /old_locus_tag="CNE_2c00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951790.1"
                     /db_xref="GI:503717714"
                     /translation="MSLYHAIETLLVPLIVLACAVQVIARYAPRTRERVKAALAARLG
                     GSAAAGWRARLARWLAPQAAAGCASGCDDGGCNTCGSNTANTTSGAQGQTAEQVVRFV
                     RKR"
     gene            complement(77901..79757)
                     /locus_tag="CNE_RS18455"
                     /old_locus_tag="CNE_2c00690"
     CDS             complement(77901..79757)
                     /locus_tag="CNE_RS18455"
                     /old_locus_tag="CNE_2c00690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoB"
                     /protein_id="WP_013951791.1"
                     /db_xref="GI:503717715"
                     /translation="MSAAPSTSALRIALVGNPNCGKTALFNRLTGSRQKVANYAGVTV
                     ERKEGYFVSPAGRQVRILDLPGAYSLHAASLDEAITRDVCLGMRAGEQRPDLLVSVVD
                     ATNLRLHLRFVLELRRLGLPMVVVLNMSDAAARRGIRIDRDKLSAALGVPVVSTVAVK
                     HDGAAALVSLLDDTLPPAPPATPEPANDIDVHAEVNRLLAAAVSMPARTAALDDRLDR
                     IVLHPVIGLLLLAVLLFLMFQAVFSWAQPLMDGIEGGVHWAGEMLGAHLPDGMLKSLL
                     VDGLIAGLGSVVVFLPQILILFLFILTLEESGYLPRAAFLLDRLMMGAGLSGRSFIPL
                     LSSFACAIPGIMATRTIQDPRDRLTTILVAPLMTCSARLPVYALLIGAFIPERTVMGL
                     FNLQGLVLFALYVAGIVSALVVAYALKFFRRDRTDHPLLMELPSYRIPNPRDVAIGLW
                     ERARIFLSRVGKVILALTVLLWFLSTFPSAPVGATAPAIDYSFAGMIGHALQKVFAPV
                     GFNWQICIALVPGLAAREVAVGALATVYALSGSEEAVATQLAPMISAQWSLATALSLL
                     AWYVFAPQCISTLAVIRRETDSWKVMALSAAYLTGLAYLAAFVTYRVALMFS"
     gene            complement(79773..80087)
                     /locus_tag="CNE_RS18460"
                     /old_locus_tag="CNE_2c00700"
     CDS             complement(79773..80087)
                     /locus_tag="CNE_RS18460"
                     /old_locus_tag="CNE_2c00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoA"
                     /protein_id="WP_041228503.1"
                     /db_xref="GI:752557271"
                     /translation="MRLSELPRRTPAVVQSVDDATPGDPVARRLRELGFVPGEAVQII
                     AYGPFGMDPLVAQVGFTRFALRRSEASRIGVEVASASVTSIAPATQGGDQTAKPSAKR
                     TA"
     gene            complement(80561..81481)
                     /locus_tag="CNE_RS18465"
                     /old_locus_tag="CNE_2c00710"
     CDS             complement(80561..81481)
                     /locus_tag="CNE_RS18465"
                     /old_locus_tag="CNE_2c00710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951793.1"
                     /db_xref="GI:503717717"
                     /translation="MEFRHLRYFLVLAEELHFGRAARRLAISQPPLSLNIQQLEASVG
                     ARLFDRDSRGVRLTAAGRAFRESAMALLAQAEAARVLAREIEAGAVGRLRVGFVGSML
                     YRGLPQTLRGFQAAYPGIQVALTELNSQEQIDALLHDELDAAFIHTGRVPDTLQATLV
                     HSEPFVCCLPADHALAALPELPLAALRGEPFVLFSRKASPDYYSRIFDMCAAQGFYPQ
                     IRHEVRHWLSVVSLVSQGMGVAVVPAALARSGMAGAAFRPLADAAVRSEVYCAWKTAP
                     DHPARDHFVGMVREMTAAAQGSHKEKATGR"
     gene            81602..83397
                     /locus_tag="CNE_RS18470"
                     /old_locus_tag="CNE_2c00720"
                     /note="isovaleryl-CoA dehydrogenase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            83479..84453
                     /locus_tag="CNE_RS18475"
                     /old_locus_tag="CNE_2c00730"
     CDS             83479..84453
                     /locus_tag="CNE_RS18475"
                     /old_locus_tag="CNE_2c00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951795.1"
                     /db_xref="GI:503717719"
                     /translation="MKLWHRVAAIAACSLCIAPAFAQKDFPSKPIMMVVTYPPGGPTD
                     AMARTLAAALKTSLGQPVVVENRAGAGGNIGAEVVARAEPDGYTLMFGTSAPLAINVS
                     LYRKINYDPVKSFAPVIQIGQLPNVLVVNPSVPAKNVTELIAYGKAHPGKLTYASSGN
                     GASSHLAGVLFNNVTGTDFQHIPYKGTGPALNDLLGGQVSMTFTDVLTAMPFIKSGKV
                     RALGVTTKARSQALPDVPTVAEQGVPGFDVSVFFGVVAPAGTPPEVIGKLNRAFADAL
                     KQPEVRKTLQAQGLEFAPSTTPEQLGGFVKAEVGKWRAVVQKSGAQLD"
     gene            84474..85595
                     /locus_tag="CNE_RS18480"
                     /old_locus_tag="CNE_2c00740"
     CDS             84474..85595
                     /locus_tag="CNE_RS18480"
                     /old_locus_tag="CNE_2c00740"
                     /EC_number="5.1.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine dehydratase"
                     /protein_id="WP_013951796.1"
                     /db_xref="GI:503717720"
                     /translation="MTQTSPGALAGIRVVDLSRILGGPYCGQILGDHGADVLKIEPPQ
                     GDDTRTWGPPFKDGVASYYFGLNRNKRVMRLDLTADADREVLLVLLAEADVLVENFKT
                     GTMEKWGLGYDTLSARFPRLVHCRVSGFGADGPLGGLPGYDAAIQAMSGIMSINGEAD
                     GDPLRVGLPVVDMVTGLNAVIGVLLALQERARSGRGQFVEAALYDSGLSLLHPHAANW
                     FMSGKTPQRTGNAHPNIYPYDTVATATDPIFLAVGNDRQFRILCEHLRLPALADDERY
                     GTAGARSVNRVALKAELEARLREFDGKVLADELVAAGVPCAPVLSVADALQHPHTQHR
                     EMVVEMEGGYQGLGAPVKLSRTPATYRYAPLTEGDEFLD"
     gene            complement(85670..87370)
                     /locus_tag="CNE_RS18485"
                     /old_locus_tag="CNE_2c00750"
     CDS             complement(85670..87370)
                     /locus_tag="CNE_RS18485"
                     /old_locus_tag="CNE_2c00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="WP_013951797.1"
                     /db_xref="GI:503717721"
                     /translation="MQPWTQLYTPLGSLWLSSLAAAIPILFFFIALAVWRMKGHVAAA
                     VTLLLALAVAIFAYGMPAQQALASAGFGFAYGLWPIAWIIVTAVFLYKIVVKTGQFDV
                     IRASVLSITDDQRLQMLLIGFAFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLC
                     LIANTAPVAFGAMGIPIIVAGQVTGIDPFHIGAMAGRQLPLLSLLVPFWLVFMMDGAK
                     GVRETWPAALVCGGCFAVTQYFTSNHIGPELPDITSALVSLVSLAAFLKVWQPRGASQ
                     RAGGNVSGGTVALAGFGGGFGGAMSGRKASPYTLAQTLRAWAPFGILTAIVTVWSLQP
                     FKALFAANGALAGTVLKFKIPGLDQMVIKAAPIVATPKAYDAVLKLDLLSAVGTAILL
                     TALISAVLLRMKPRMLLATFAETLVELARPVLSIGLVLAFAFVANYSGMSSTLALLLA
                     GTGAAFPFFSPFLGWLGVFLTGSDTSSNALFCALQNTTAHQIGVSDTLLVAANTTGGV
                     TAKMISPQSIAVACAATGLVGKESELFRFTVRHSLLFAVIIGIMTVVQAYLLPGMIPG
                     "
     gene            complement(87438..88883)
                     /locus_tag="CNE_RS18490"
                     /old_locus_tag="CNE_2c00760"
     CDS             complement(87438..88883)
                     /locus_tag="CNE_RS18490"
                     /old_locus_tag="CNE_2c00760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="WP_013951798.1"
                     /db_xref="GI:503717722"
                     /translation="MSQHTLNFVPPQDFKARAREALDDPKLRQSFRGAMDFLQGKRLA
                     QFPDADELERLRDLGEAVRQHALANLPDLLVQLEAKLTAAGVQVHWAENADEANAIIH
                     RIAASKQAQRVIKGKSMASEEIELNHYLAERGVDCIESDMGEYIVQLAGEKPSHIVMP
                     AIHKTKGDIAQLFQAHIPDTPYTEDVDALIQTGRRALRQAFVEADIGLSGVNFAAADT
                     GTLWLVENEGNGRLSTTVPDVHIAIMGMEKVVARLEHIVPLSTLLTRSATGQAITTYF
                     NLISGPRRAGERDGPREVHLVLLDNGRTQAYADTQLRATLQCIRCGACMNHCPVYTRI
                     GGHAYGTTYPGPIGKIISPHLLGLDATADLATASSLCGACGEVCPVRIPIPQLLVRLR
                     TEANRDPEEQVANPLRGQGAKYSRGEHLVWRFWSGAYSHPATYRLFRWAATRLRALTP
                     SKQMGWTQHRTPLKPAAKSLADLLKEKGQPE"
     gene            complement(88880..89581)
                     /locus_tag="CNE_RS18495"
                     /old_locus_tag="CNE_2c00770"
     CDS             complement(88880..89581)
                     /locus_tag="CNE_RS18495"
                     /old_locus_tag="CNE_2c00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951799.1"
                     /db_xref="GI:503717723"
                     /translation="MSTPGARERMLGRLRAAAPAPSPRTAELDRRIDGHFEARRHGAP
                     AIGELTGAMLAALQGLHAEVWCASEAAWPALLATELANAGVKRLLLDPASQAGAALAA
                     ALPAHIEAIGYDRPIEAWKAELFDTIDAGFTVARSGIAATGTLVVAPDAGSPRTVSLV
                     PPLHVALVRASTLHTDLHMAARTERWSDGMPTNLVLISGPSKTSDIQQTLAYGAHGPR
                     RLWVIIETDTAEAGQ"
     gene            complement(89578..90360)
                     /locus_tag="CNE_RS18500"
                     /old_locus_tag="CNE_2c00780"
     CDS             complement(89578..90360)
                     /locus_tag="CNE_RS18500"
                     /old_locus_tag="CNE_2c00780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_013951800.1"
                     /db_xref="GI:503717724"
                     /translation="MMDRQYPTGPAPAQAYLFATCLVDMFVPQAGLDAVRLLEREGLT
                     VHFPRGQSCCGQPAYSSGNPDAARAVARAQLDLFSQPWPVIVPSGSCAGMMRHHWPQL
                     FADDPVAGPKALELAGRIYELGEFLLHVLKLDFGDAAPAGQPQERIVLHTSCGARREM
                     GTRQHGVALVDTLPGVTRVEHERESECCGFGGTFSLKHPDISGAMVRDKVASACATGC
                     DRLVSADCGCLLNIGHTAAHDHAPLQVEHLATFLWRRTGGAA"
     gene            90487..91212
                     /locus_tag="CNE_RS18505"
                     /old_locus_tag="CNE_2c00790"
     CDS             90487..91212
                     /locus_tag="CNE_RS18505"
                     /old_locus_tag="CNE_2c00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013951801.1"
                     /db_xref="GI:503717725"
                     /translation="MTAAAARHGRTRGRVESVMRRIETALLDGTWPPGTRLPAERVLA
                     GQYEVARNTVREAIQRLAARGLLQSRRGAGVYATDQLRAGIASPWGQLVADHPALRDD
                     ILEFRRVLEGATAYFAALRADAADVKRIRALMAELERARAADDKQAEADADAQLHDAI
                     AQASHNTMFLHLHTSVIGMLREHITINGTGLREQDDGASDLLLLQHRTLCDAICARRP
                     EEARTAMQTHIDFVRSRVEQDGA"
     gene            complement(91259..92296)
                     /locus_tag="CNE_RS18510"
                     /old_locus_tag="CNE_2c00800"
     CDS             complement(91259..92296)
                     /locus_tag="CNE_RS18510"
                     /old_locus_tag="CNE_2c00800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951802.1"
                     /db_xref="GI:503717726"
                     /translation="MKDPDPTTTPRLLPAAWYSVGTVAYLLTALALWTVLHANLVAAL
                     LSGLLLYSLVDVLAPRLKRLNQRHDALAVAILSALILLALTLAGWLLVRFVSGEGNTL
                     DGLLNHVADIIDRSRGQMPPWLSDALPNGVDELANTLIETLREHAAMAQKLGAEVLRT
                     LVHILIGLVIGAMVALYRAVVRPNRRPLAAALVARARTLQQAFSQFIFAQIQISTINT
                     VLTAIYLLLVLPLFGVHLPLTKTLLVITFVAGLLPVLGNLISNTAIVVASLSVSLPIA
                     VASLVFLVVIHKLEYFLNARIIGARIQAAAWELLTVMLLMETLFGIPGVIAGPIFYAY
                     LKRELAGAGLI"
     gene            92500..93882
                     /locus_tag="CNE_RS18515"
                     /old_locus_tag="CNE_2c00810"
     CDS             92500..93882
                     /locus_tag="CNE_RS18515"
                     /old_locus_tag="CNE_2c00810"
                     /EC_number="4.3.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814057.1"
                     /note="with EutC catalyzes the formation of acetaldehyde
                     and ammonia from ethanolamine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia lyase large subunit"
                     /protein_id="WP_013951803.1"
                     /db_xref="GI:503717727"
                     /translation="MAYTHTIGTHRHVFADLRTLLARASPARSGDALAGVAAASEQER
                     MAARLALAEVPLKQFLTEALVPYEDDEVTRLILDRHDGAAFAAIGATTVGDLRNWLLL
                     HETDSATLARVAPGITPEMAAAVSKLMRNQDLVAVARKCQVVTRFRSTVGLPGRLSVR
                     LQPNHPTDDPKGIAASIIDGLLYGCGDATIGVNPASDNLGAIVSLLRMIDELRSRFDI
                     PTQSCVLTHVTNTLRAIGQGAPVDLVFQSVAGSERANAAFGISLSLLAEAHDAAQALA
                     RGTVGDNLMYFETGQGSALSANAHHGVDQQTMEARAYAVARAFSPLLVNTVVGFIGPE
                     YLYDGKQIIRAGLEDHFCGKLMGVPMGCDVCYTNHAEADQDDMDTLLTLFGVAGINFI
                     MGVPGADDIMLNYQSTSFHDALYLREVLGLRPAPEFEAWLQRMGIADASGRLLEPAAR
                     QPLLQMAHSL"
     gene            93893..94678
                     /locus_tag="CNE_RS18520"
                     /old_locus_tag="CNE_2c00820"
     CDS             93893..94678
                     /locus_tag="CNE_RS18520"
                     /old_locus_tag="CNE_2c00820"
                     /EC_number="4.3.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia-lyase small subunit"
                     /protein_id="WP_013951804.1"
                     /db_xref="GI:503717728"
                     /translation="MTARRPPPAAPANADADPWQRLRQFTRARVALGRTGHSQTTDAV
                     LAFGLAHAQARDAVHLPLDVGAVTAALDAAGVQNLAVHSAAPDRAHYLRRPDLGRRLD
                     DASRARLAAARPGDAPDVVFVVADGLSALATQTHALPLLDATRARLPQTWRIGPVVVA
                     EQSRVALGDEIGELLGARQVVMLIGERPGLSSPDSLGIYLTHAPRTGRTDAERNCISN
                     VRPEGLPYAQAADRLAFLLRGAAALGRSGVDLKDDSVPALPEG"
     gene            complement(94775..95248)
                     /locus_tag="CNE_RS18525"
                     /old_locus_tag="CNE_2c00830"
     CDS             complement(94775..95248)
                     /locus_tag="CNE_RS18525"
                     /old_locus_tag="CNE_2c00830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="WP_013951805.1"
                     /db_xref="GI:503717729"
                     /translation="MALASTLASCLSSKNTQYDIIRHPYTLSSMATAEAAHVPGDRLA
                     KTLLLEDDRGYVAAVIPSSHHLHMAAICEQTGRNLVLAHEDEIREIFKDCDLGAIPPV
                     AMAYGMQTYVDDSLMAQPDVYFEGGDHQELVHMSGEQFSRLMSDAGHGQFSRRMM"
     gene            complement(95705..96781)
                     /locus_tag="CNE_RS18530"
                     /old_locus_tag="CNE_2c00840"
     CDS             complement(95705..96781)
                     /locus_tag="CNE_RS18530"
                     /old_locus_tag="CNE_2c00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013958574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041227807.1"
                     /db_xref="GI:752556575"
                     /translation="MAFELGEKSWKLSLGDGVRGPSRYTVAAGDKDAVLRAIAKAKAR
                     CGLTSQVPVRSCYEAGRDGFWLHRWLTEQGIDNLVVDSSSIEVNRRARRAKTDRLDGD
                     KLLSMLLRYHAGERRVWGVARVPTPEQEDERRLHRELGRLRQERTALSNRIRSLLVLH
                     NLRVAHVGGRSWAHWWNDHGAQLPVGLRAEIERSVARLSLAVTQIRTIEAQQHATVKT
                     GAQPAIALLARLRGIGVGSAWILVKELFGWRNFHNRREVASSLGLAPTPYSSGESQVE
                     QGISKAGNKRARWLMIELAWSWLRYQPASQLTQWFNERFAPGGKRMRRIGIVALARRL
                     AIGLWRYLEYGEIPVQASFKPVAT"
     gene            complement(96923..97858)
                     /locus_tag="CNE_RS18535"
                     /old_locus_tag="CNE_2c00850"
     CDS             complement(96923..97858)
                     /locus_tag="CNE_RS18535"
                     /old_locus_tag="CNE_2c00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951807.1"
                     /db_xref="GI:503717731"
                     /translation="MDLNALRLFVDIVDAGNLSAAARKLKMTRANVSYRLKALEEELG
                     VQLLRRTTRHVEPTPVGAGLYEHGRNILGEVAAANALISNMGKSLQGHVRLSVPTGLG
                     HTLLSPLLVLFKQRYPDITLDVMFDNRVHNLVSEDVDVALRIISTPPDSVVATEIGEV
                     DWIVCASPGYLAAHPAPKTLTGLQGHAMVCASPVGQKLKASGTRLDADEGHDANETRE
                     QVVLEPTLTSENFAFLKESVLAGLGIGILPIYAIGAELDSGALVPLLCDYRISVFGSK
                     LYMLTMPNRYQTLATRYLLNFLKTELQAVWPRLHR"
     gene            complement(97951..99264)
                     /locus_tag="CNE_RS18540"
                     /old_locus_tag="CNE_2c00860"
     CDS             complement(97951..99264)
                     /locus_tag="CNE_RS18540"
                     /old_locus_tag="CNE_2c00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate transporter"
                     /protein_id="WP_013951808.1"
                     /db_xref="GI:503717732"
                     /translation="MTDLPATLAQTAAPSREEVRKRIYAIVAASSGNLVEWFDFYVYA
                     FCAIYFAPSFFPKSDPTAQLLNTAGVFAAGFLMRPIGGWLFGTIADRHGRKNSMLISV
                     IMMCAGSLLIACLPTYASIGNWAPALLLLARLIQGLSVGGEYGTTATYMSEVALRGRR
                     GFFSSFQYVTLIGGQLLAVLVVVILQQLLDEAELKAWGWRIPFVVGAVTAVVALFLRR
                     TLHETSSAATRGSKEAGSVAALFRNHKAAFFTVLGYTAGGSLIFYTFTTYMQKYLVNT
                     AGMSIKTASYVMTGCLFLYMCMQPVFGALSDRIGRRTNMLLFGALGALCTVPILTALG
                     KVSSPELAFVLIAVALAIVSFYTSISGIVKAEMFPPEVRALGVGLAYAIANAIFGGSA
                     EYVALGMKTLGHETAFYWYVTAMMVIAFFVSLRLPRQAKYLHHEH"
     gene            99664..100029
                     /locus_tag="CNE_RS18545"
                     /old_locus_tag="CNE_2c00870"
     CDS             99664..100029
                     /locus_tag="CNE_RS18545"
                     /old_locus_tag="CNE_2c00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951809.1"
                     /db_xref="GI:503717733"
                     /translation="MMRAGPSTGLLRPPFAMHRSLRRWLCLPLLFAAASAPAQDLVEC
                     KRIEHDQLITASQETLLFLRCRARRVAYEAPRLKGVSQRVKDDLVFACLDQADAVEHQ
                     LRVRHGYSREALARLRCEL"
     gene            complement(100076..100825)
                     /locus_tag="CNE_RS18550"
                     /old_locus_tag="CNE_2c00880"
     CDS             complement(100076..100825)
                     /locus_tag="CNE_RS18550"
                     /old_locus_tag="CNE_2c00880"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_013951810.1"
                     /db_xref="GI:503717734"
                     /translation="MTSTPAISRRAALVTGASRGIGRAIALRLAADGFDVAIGYAGNA
                     ARAEATVAAARESGVNAIAIQGDVAQASDVARLFDAAQQAFGRLDVVVNSAGIMQMAP
                     VAPASLDAFDQTIATNLRGAFLVLGEAAARLGEGGRIIALSTSVIARSFPGYGPYIAA
                     KAGVEGLVRVLASELRGRGITVNAVAPGPVATELFLDGKSEAQVAQLSKVAPLERLGT
                     PEDIAAAVSFLAGPDGAWVNAQVVRVNGGFA"
     gene            101088..101858
                     /locus_tag="CNE_RS18555"
                     /old_locus_tag="CNE_2c00890"
     CDS             101088..101858
                     /locus_tag="CNE_RS18555"
                     /old_locus_tag="CNE_2c00890"
                     /EC_number="1.18.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020201932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_013951811.1"
                     /db_xref="GI:503717735"
                     /translation="MSNLNQQSILSVHHWTDTLFSFTCTRDPGFRFENGQFAMVGLEV
                     NGRPLLRAYSIASANYEETLEFFSIKVPDGPLTSRLQHLREGDQIFVGKKPTGTLLVD
                     NLLPGKTLWLLATGTGLAPFLSIIRDPEVYERYDKVVLTHTCRFVEELAYRELIQEHL
                     PQHEHLGDLVREKLVYFPTVTREEFDNRGRITDLIASGELFERLGVEPFSLENDRIML
                     CGSPDMLKDVRGILEARGFAEGNMSHPGHFVLEKAFVG"
     gene            complement(101920..103326)
                     /locus_tag="CNE_RS18560"
                     /old_locus_tag="CNE_2c00900"
     CDS             complement(101920..103326)
                     /locus_tag="CNE_RS18560"
                     /old_locus_tag="CNE_2c00900"
                     /EC_number="4.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_013951812.1"
                     /db_xref="GI:503717736"
                     /translation="MSAPSTSATRIEKDSLGDVPVPADHLWGAQTERSRQNFRIGNEK
                     MPPALIEAFAILKLCAARANGELGVLKPELAHAIEQAATEVIEGRWPDEFPLSVWQTG
                     SGTQTNMNLNEVIANRAIQLLGGKVGSKTPVHPNDHVNASQSSNDSFPTAMHIAATRA
                     IQQELLPALEQLQQTFARKVEAFADIVKVGRTHLQDAVPLTLGQEFSGYMTQVADAQS
                     RLQQAMLRAMPVAQGGTAVGTGLNAPHGFAAAFARALADYTGLPFEPAPNRYALQASH
                     DALADLSGALSTTASSFLKIARDFMLLGSGPRAGFAELVLPANEPGSSIMPGKVNPTQ
                     AEALAMVCCRVIGNHTTVTLANGLGTLELNAYKPVIIYSLLQSVSLLAGAASSFAEHM
                     VEGVEADRERIAELLERSLMPVTALNPHIGYDKAAEIAKLAVKRNLSLREAAIASGHV
                     TEAQFAEWIDLKGMTREV"
     gene            103461..104351
                     /locus_tag="CNE_RS18565"
                     /old_locus_tag="CNE_2c00910"
     CDS             103461..104351
                     /locus_tag="CNE_RS18565"
                     /old_locus_tag="CNE_2c00910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228504.1"
                     /db_xref="GI:752557272"
                     /translation="MLIAQLKSFFMVARIGSVTQAAKRLGLSQPTITAQIRALEEAYG
                     VELFHRGGRRLALSDAGLALLPRVEALVQQETEIDFFLRHSGDLRTGSLRVGATAPYY
                     VLELIRSFSERFPAIDVSVVTGNSQEVLEALQEYRVDIATSSQRVDDARLSRVLLGVD
                     PLMLVVHRTHALAGHTEVAVSALAGCRLLMRELGSTTRIATEDMLAQARVSPAAQMEI
                     GSRESIREAVIRNLGVSVIARHEVPSHPDLRVLGFTDASPCLHEYLYCLRERRGARLI
                     DAFVALAEPPQGQQESGWDR"
     gene            complement(104348..104698)
                     /locus_tag="CNE_RS18570"
                     /old_locus_tag="CNE_2c00920"
     CDS             complement(104348..104698)
                     /locus_tag="CNE_RS18570"
                     /old_locus_tag="CNE_2c00920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_013951814.1"
                     /db_xref="GI:503717738"
                     /translation="MIRPTVQENAARYADCIAACNAAAAAALKCAAACLEEQDVRKMA
                     RCIALDMDCAGIAQLAASYMLRNSEFAPLVCEDCAEVCKWCKEECEHHDNEHCQDCAR
                     ACAACMEQCLKMTA"
     gene            105022..105396
                     /locus_tag="CNE_RS18575"
                     /old_locus_tag="CNE_2c00930"
     CDS             105022..105396
                     /locus_tag="CNE_RS18575"
                     /old_locus_tag="CNE_2c00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010814047.1"
                     /db_xref="GI:498513619"
                     /translation="MGEAKRRGTPEERAAQARAKIEALRPAQLVCGHCKTAFAQFDAL
                     DVPGLPGIDAVFGGECPGCGNDVVVFKGAPDAVAQAMIAWEKMLGADAQLGYQSSDGR
                     HVPFEPEGAGGAASDKPGGTIH"
     gene            complement(105415..107406)
                     /locus_tag="CNE_RS18580"
                     /old_locus_tag="CNE_2c00940"
     CDS             complement(105415..107406)
                     /locus_tag="CNE_RS18580"
                     /old_locus_tag="CNE_2c00940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_041228505.1"
                     /db_xref="GI:752557273"
                     /translation="MPVYTPTLKARIAIITTVLAAVFGTGIVLTALYDAHRDLHDALQ
                     VQQDSVVKLTASQLDTAMSDRIVLLSHQAAQLSGLLAQAHGAQAAAVRERALDALSAA
                     IPVPAAFNALLVADMQGNIVSNRGSGADIGDRSYFREAARSLAPVVSPPIRSRTNGQM
                     GVMVAVPVLAPNQAFVGLVGGWLDLSSANFLVEILHNRLGTTGYYCLVSAGPEPVYIR
                     HPDPAQARQPAQAVADTCGEDDSPAPLEFLTPARPVIARYLMSSTGWELVALLPAREA
                     YAPLHQMQQRFLSMAGMAMAAVALLIWLAVRRQLAPLARLHKVVQASANDLSAFERLP
                     TRQQRDEIGDVTRAFIKLMRDVRERRQALDRSERRLRAVTDTLPSLLAFIDTDERYVF
                     NNQAYERVFGLKPEELRGRHVREILGEARYARVQPFMQRALAGTAVTFETEDSDLEYH
                     CMESSLRPEWSADGSEVVGVHIHVQDITQRKLETQRLARMSRTDHLTQLMNRSAFEGQ
                     LHAAMVRSREHGTLMALLYLDMDRFKAVNDIHGHAAGDQLLQTFAQRVRRCVRERDTV
                     ARQGGDEFAVVLEDMTRPAAARRVAQAILQAMDEPFDFEGVSADVDVSIGVALYNGGP
                     AQDRELMRLADVLLYRAKGAGRGRYEIGPPELAGELSAQ"
     gene            107800..111045
                     /locus_tag="CNE_RS18585"
                     /old_locus_tag="CNE_2c00950"
     CDS             107800..111045
                     /locus_tag="CNE_RS18585"
                     /old_locus_tag="CNE_2c00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_013951816.1"
                     /db_xref="GI:503717740"
                     /translation="MRLTSLSPALLSLLVAASGALLTAGAWLQAERLERREAQQHFDA
                     LLGQAGSVLRERMLENERLLRGVAAVLSANPDTSRAQWRDYLYTAQLDDLPAGTQSIG
                     YAPLTPLQRVPRLVQAARADGLADYDIHPGGTRDLYAPIFYIEPLDGRNTRAAGFDML
                     SEPTRRATLEAARDSGEPRLTPGLALVREAEAAQRQHGALIFLPVYAGEAAVSTVAQR
                     RHAVLGYVYVSLRLGDLMRAAGAPAAAELELSLYEGSPAAPGPMLSGGPTEGERREDG
                     SAALLQGERQLQYGGVTWTLRGATRPAFEAAHGPRQAYLVLAAGTLATLLLAWLTHAL
                     ACRGRAARQREAQAVHAWEDDNAMLQACMAQSADGFLLADAQGVVVRASERAGQLFGA
                     DPAALAGRSLDTLVPGATGVVPSGAAAGVEAHRELAGVRADGSRFALRAGAARLPVAD
                     GGTAHWLWAVTDLEPERRAQQAAAVQAARYAGLLDHAAFCVITFDEDGLITGINAAGQ
                     RMLWYNTAELVGHMHMTGLHIADELADHARMLSGELGEPVPPGLPALVAKARLGLTDE
                     REWTWVRKGGSRMPVQLAVFALPAPIEAAAADAAPAGPADGAEPRSAPSPGYQAIGYD
                     LTERLRVDEYIRHLALHDPLTGLPNRAELSERAQALLLHARSHGERVALLLLDLDHFK
                     HINDSLGHPVGDDVLRTMADRLKGTVRQGDLVARMGGDEFGVVLGGLRHDSEAELIAA
                     KIQVRVNEELQAGGQRLRVTPSIGMAIFPDDGDSLTELLKAADSAVYAAKHDGRAQLR
                     RFASAMAEASLARFTIEGLLRRALARDEFRLRYQPIVDAATLAITGVEALITWNTPER
                     GAMQPAEFIPIAEQSGLVAPLGEWTLATACREIQALRQALGSEIEVAVNISPLQLRQA
                     NFPDTVAHCLQQAGLPPQGLVIEVTEGILVDGGETTIETFRRLRELGVGLSIDDFGTG
                     YSGLNYLTRLPISRLKIDKSFVDDVATPGHDQAVAAAIIALGHQLHLKVIAEGVETAA
                     QFEFLRAQGCDGLQGFLFSQAVPHEVLREILEKGIRAPTPTSAGATALRES"
     gene            111213..112307
                     /locus_tag="CNE_RS18590"
                     /old_locus_tag="CNE_2c00960"
     CDS             111213..112307
                     /locus_tag="CNE_RS18590"
                     /old_locus_tag="CNE_2c00960"
                     /EC_number="3.6.3.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="WP_013951817.1"
                     /db_xref="GI:503717741"
                     /translation="MQAGKSGEGRAFLAVEQVSKRFGSFMALDGVSLSVGQGELLCLL
                     GPSGCGKTTLLRIIAGLEREDAGRIHAGARELTGLPPQARDYGILFQSYALFPNLTVA
                     QNVAYGLHGRGMGRTHRDARVAEMLGLVGLAGSERKFPGQLSGGQQQRVAMARALAPA
                     PSLLLLDEPMSALDARVREHLRLELRQLQRRLNITTVMVTHDQEEAMTMADRIAVMDG
                     GRIVQAGTPAEIYEQPASAFVAGFVGQANWLPGRSAQAGRFTVGEGSQAVDFLVDTPQ
                     PAASAGRLCCRPEAVRLDPDPAESNRLLARVVDQTYLGNRYRLALEADRLPGLTLFAD
                     VAREARHRLPDAGGHKFWIALPAQALRVFA"
     gene            112304..114034
                     /locus_tag="CNE_RS18595"
                     /old_locus_tag="CNE_2c00970"
     CDS             112304..114034
                     /locus_tag="CNE_RS18595"
                     /old_locus_tag="CNE_2c00970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter permease"
                     /protein_id="WP_013951818.1"
                     /db_xref="GI:503717742"
                     /translation="MMRAAATVESHPGTQAASSRGTGLASRLAHGAPAAMKWIWLAGL
                     AVGLLLPLLALFRQAWFDAAGQWALGARMAALVTSPNFLPMLGRSVAVSLAVVALVVP
                     LAFGFAYALQRSCIALRPLWRGIALLPLFAPSLLPAIALVYLFGNQGIFRGAFGQGGI
                     YGFWGIVLGEAFYTFPHALMVLVATLSLADARLYEAARAMGASPWRTFCTVTLPGARQ
                     GLFAAACLVLTLVITDFGVPKVVGGGYPVLALEAYKSVVGQQQFDRGALIGMLLLAPA
                     LLTFAVDMAMQQRQRTQMGSRAQVYVPAPERGRDGACLLLVALVSAALLAVIATAVGA
                     SLVKLWPYNLGLTLAHYDFDNMDGGGWLAYRNSLKLSALTALAGTAAIFLGAWLTLRT
                     RGPAWLHGVLRASFLLPMAVPGLVLGLGYVFFFNAPGNPLHALYGTMALLVLCNVAHC
                     YTTGHLTAAAALRQLDNEFEAAALSLGVAPLVTCWRVTVPVCLPALLDIFRYLFVSSM
                     TTVSAVIFLYSPDTVLAAISVLNMDDAGDTAPAAAMSTLILLTSVLAALLLHAVSAGW
                     LRRAQRWRAG"
     gene            114105..115124
                     /locus_tag="CNE_RS18600"
                     /old_locus_tag="CNE_2c00980"
     CDS             114105..115124
                     /locus_tag="CNE_RS18600"
                     /old_locus_tag="CNE_2c00980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_041228765.1"
                     /db_xref="GI:752557533"
                     /translation="MTNLVTALAAAAALPMLAGNASAATVLTVYTALEADQIAAYKAA
                     FEKVHPDIEIKWVRDSTGIVTAKLLAEKAAPRADAVWGLAGSSLAILDKEGMLDPYAP
                     KNLAAIDAKYRSPANPPAWVGMDVWGAAICFNTVEAQKQGLPKPTSWADLTKPIYAGK
                     VVMPHPASSGTGFLDVSAWLQMMGEQKGWQYMDGLHKNIGLYTHSGSKPCKMAAQGEF
                     PIGIAFEYRAMKSKKEGAPIDIVLPSEGLGWDIEATAIVKGSKNLDAARKLADFSASR
                     EAMALYEKNFAVLAVPGIAKPDALLPADYEKRLIKNDFRWASDNRDRILAEWSKRYEG
                     KAEKK"
     gene            complement(115207..115530)
                     /locus_tag="CNE_RS18605"
     CDS             complement(115207..115530)
                     /locus_tag="CNE_RS18605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_041228506.1"
                     /db_xref="GI:752557274"
                     /translation="MKRQFLGLLARVYVLQFALEVPATVAMLADMLLEYGFQVDIGSV
                     RPLLRALQMEGYLESVLRDGIGRVYLLTERGREELQASRKRIDDLYRRLHAGQPATDE
                     VPRLA"
     gene            116068..116991
                     /locus_tag="CNE_RS18610"
                     /old_locus_tag="CNE_2c01000"
     CDS             116068..116991
                     /locus_tag="CNE_RS18610"
                     /old_locus_tag="CNE_2c01000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT transporter permease"
                     /protein_id="WP_013951821.1"
                     /db_xref="GI:503717745"
                     /translation="MKPADLARLLALAAIWGASFLFIRIGAPVLGPMPTAFARVLIGA
                     LTLAACLPLLKLRWDMQGKWPAVLALGVVNSGIPFVMYAVAALWLPAGYSAVFNAMTP
                     LMGVLIGALAFSERLTRAKAAGVLLGVAGVAVLTRTGPVAFSADVLLGALACLLATAC
                     YGLSGFLARRWITQRGGLDSRLVAAGSMVGATVFLLPFCLAALWRHNTLPAAGTGVWA
                     AMLGLGVLCTALAYILYYRLIADLGPVRSLSVTFLIPPFGIIWGALFLGEALSWAHAA
                     GGALIGVAVWLVLRPVAGVETPVQARPVAGR"
     gene            117071..117388
                     /locus_tag="CNE_RS18615"
                     /old_locus_tag="CNE_2c01010"
     CDS             117071..117388
                     /locus_tag="CNE_RS18615"
                     /old_locus_tag="CNE_2c01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013951822.1"
                     /db_xref="GI:503717746"
                     /translation="MKIQTIFGADGQPAFVVIPYADYLSQHARASELIPYPVVRRVLA
                     DDVPPLRAWREHLGLTQADVAVRLGISQPAYAQQENSTRLRKTSRERIAAALGITAAQ
                     LDI"
     gene            complement(117411..117645)
                     /locus_tag="CNE_RS18620"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(117674..118162)
                     /locus_tag="CNE_RS18625"
                     /old_locus_tag="CNE_2c01020"
     CDS             complement(117674..118162)
                     /locus_tag="CNE_RS18625"
                     /old_locus_tag="CNE_2c01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_013951823.1"
                     /db_xref="GI:503717747"
                     /translation="MPMPSAMSFESRKPIHLKRAGLKATSPRMRILEVFRTSARRHLS
                     AEDVYRILLTQDEDAGLSTVYRVLNQLVQADILLRHSFESDHAVFELNEGGHHDHLIC
                     VACGRVEEFRDESIEQRQRQVAADNAFVLREHMLVLYGVCPQCRAGATEAEPTPGLPA
                     RA"
     gene            <118719..118934
                     /locus_tag="CNE_RS18630"
     CDS             <118719..118934
                     /locus_tag="CNE_RS18630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814033.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron uptake protein"
                     /protein_id="WP_041228767.1"
                     /db_xref="GI:752557535"
                     /translation="AGAFALAWSLHVAADGGPLGTVSWLGTLTASAFAVALGRSYAPR
                     AVQRLLPGVAGIGLAALVARWLLATWV"
     gene            complement(118948..119373)
                     /locus_tag="CNE_RS18635"
                     /old_locus_tag="CNE_2c01040"
     CDS             complement(118948..119373)
                     /locus_tag="CNE_RS18635"
                     /old_locus_tag="CNE_2c01040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem reaction center subunit H"
                     /protein_id="WP_013951825.1"
                     /db_xref="GI:503717749"
                     /translation="MPNQPPTREGAAIIGSGVGEGPGPEVMAASSLDGTKAYSSDGEH
                     VGKISEIMLDVPHGRIAYAVLTTGGFLGIGDTLHAIPWNALVMDTDEKCFRIAVTADR
                     LKSAPGFNKDSWPSMADPQWGKSLHEYYGRDPYWVSPPL"
     gene            complement(119854..120771)
                     /locus_tag="CNE_RS18640"
                     /old_locus_tag="CNE_2c01060"
     CDS             complement(119854..120771)
                     /locus_tag="CNE_RS18640"
                     /old_locus_tag="CNE_2c01060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951827.1"
                     /db_xref="GI:503717751"
                     /translation="MRNDIPNLGALQAFEASARLGSFTRAAAELALTHSAVGRQVAQL
                     EQRLGVALFTRVRRRLELTDTGREYAARIRRHLDHLQRDTLEITTGRAMGYTLELAVV
                     PTFATQWLIPRLPDFARRHPNVTVNLSARSQPFSFQECAYDAAIYFGDQFWPGTRGGV
                     IFREGGMVPVCSPAFLAGHPVTGAASLARCRHLHLSTRANAWRDWYAAQGWAYDLAAS
                     RGPRYELFTMMTAAAAAGLGIGLAPRLLIERELQTGQLVIPLAGMLDEQQGYYFAYPE
                     GRPESEALAAFRNWILGLSRDAPATAAGN"
     gene            120959..121981
                     /locus_tag="CNE_RS18645"
                     /old_locus_tag="CNE_2c01070"
     CDS             120959..121981
                     /locus_tag="CNE_RS18645"
                     /old_locus_tag="CNE_2c01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IQ calmodulin-binding motif-containing protein"
                     /protein_id="WP_041228507.1"
                     /db_xref="GI:752557275"
                     /translation="MTSKLSTLLTANVGAARAAQLLALVTLPADLPQAPQGRASRAEI
                     AQALNMVLFGGILERVPSGRAYTDDVAAAGGKVTFDHGALRTVKWRDNGALPEGEAAF
                     TRILRPLGYVLNGTYPLDRIGMTGRSYAHADAPEDIAQFFLSEFHPERFSEAFRAAVS
                     RVTGTSADPLTPRAQTLLWQLERDGALDLADGAELVGLLVPCFERQHATPSLADYETL
                     LSESAEMAWVATEGNAFNHATDRVDDVFALAEQQKQLGRPMKDKVEVSRSGRVKQTAF
                     RADTVRRNFVGAQGETVERDVPGSFYEFITRDRFAEEAAAPQRYDLGFDAGNAQGIFK
                     MTAAAC"
     gene            complement(122073..124181)
                     /gene="fusA"
                     /locus_tag="CNE_RS18650"
                     /old_locus_tag="CNE_2c01080"
     CDS             complement(122073..124181)
                     /gene="fusA"
                     /locus_tag="CNE_RS18650"
                     /old_locus_tag="CNE_2c01080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951829.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_041228508.1"
                     /db_xref="GI:752557276"
                     /translation="MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKLGEVH
                     DGAATMDWMEQEQERGITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIEVERS
                     MRVLDGACMVYDAVGGVQPQSETVWRQANKYAVPRIAFVNKMDRVGADFFRVQTQIAD
                     RLKGRAVPIQIPLGAEDHFQGVVDLVKMKAIVWDDASQGVRFEYQDIPADLLATAQEW
                     RDKMVEAAAEADETLLHQYLSGEPLTEEQIKRGLRKRTIANEIVPMLCGSAFKNKGVQ
                     SMLDAVIDYLPSPADVPAILGHTEDDREAERHPSDDEPFAALAFKIMTDPFVGQLIFF
                     RVYSGVVKSGDTVYNPVKAKRERLGRILQMHANVRQEIKEVRAGDIAAAVGLKEATTG
                     DTLCDPDKVIILERMSFPEPVISQAVEPRTKADQEKMGIALNRLAQEDPSFRVTTDEE
                     SGQTIISGMGELHLEILVDRMRREFGVEASVGKPQVAYRETIRQPVKDVEGKFIKQSG
                     GRGQYGHVVLNLEPMPHGGGYEFVDAIKGGVVPREFIPAVDKGIRETLQSGVLAGYPV
                     VDIKATLVFGSYHDVDSNENAFRMAGSMAFKEGMRRARPILLEPMMAVEVETPEEFTG
                     NVMGDLSSRRGMVHGMEDIAGGGGKIVRAEVPLATMFGYSTTLRSLTQGRATYTMEFK
                     HYAEAPANVAEAVISTKRAG"
     gene            124474..125103
                     /locus_tag="CNE_RS18655"
                     /old_locus_tag="CNE_2c01090"
     CDS             124474..125103
                     /locus_tag="CNE_RS18655"
                     /old_locus_tag="CNE_2c01090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_041228509.1"
                     /db_xref="GI:752557277"
                     /translation="MTTILIVDDHPAMRLVLRHHLLQLLGVDEVIEADNGQCAIELVR
                     ARMPDRVLLDLDIPRSSGLDVAPRLRAIHPQVRILVVTALDPAVFISRSWQAGAQGFV
                     SKTQDIKEILRAVEAVLAGYTVFPVLNRGGAPRQAMSADEEILRRLSDKELVVLQMLA
                     RGMSYKAISASLFISNKTVSSYKARIMGKLQVSSLVELGDFARCCRLTP"
     gene            complement(125173..125946)
                     /locus_tag="CNE_RS18660"
                     /old_locus_tag="CNE_2c01100"
     CDS             complement(125173..125946)
                     /locus_tag="CNE_RS18660"
                     /old_locus_tag="CNE_2c01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_041228510.1"
                     /db_xref="GI:752557278"
                     /translation="MPNSTPAQSVPPVPAPQAPLRRRGRTLAEEVVQALGEEIRQGQL
                     KPGNKLPTESEIMASMGVSRTVVREALSRLQASGLVETRHGIGTFVLARAAEAPSPFR
                     IGPDALGTAMDVMAMLEFRVSLEAEAAGLAASRRTDAQLAAMRQALDELKRSAGAGND
                     AVESDFAFHLAIARATGNRYFTDIMGHLGTMVIPRSRLQVSTPEREQYLERVSIEHEN
                     IYDAIERRDPDGAKAAMRMHLTNSRERLRKASGTAAAQG"
     gene            126102..127457
                     /gene="gudD"
                     /locus_tag="CNE_RS18665"
                     /old_locus_tag="CNE_2c01110"
     CDS             126102..127457
                     /gene="gudD"
                     /locus_tag="CNE_RS18665"
                     /old_locus_tag="CNE_2c01110"
                     /EC_number="4.2.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951832.1"
                     /note="catalyzes the formation of
                     5-keto-4-deoxy-D-glucarate from glucarate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucarate dehydratase"
                     /protein_id="WP_013951832.1"
                     /db_xref="GI:503717756"
                     /translation="MTPTAAPMASAHTPVVTELTVVPVAGHDSMLMNLSGAHGPYFTR
                     NIVIVRDSAGQTGVGEVPGGEGIRQTLEDARPLLVGQPIGQYQAILNRVRAAFASRDA
                     GGRGLQTFDLRITIHAVTALEAALLDLLGQHLEVPVAALLGEGQQRDAVEMLGYLFYI
                     GDRQRTTLDYRTEPDADNAWFRLRNEVAMTPAGVVRLAEAAYERYGFNDFKLKGGVLS
                     GDEEMEAILALAERFPKARITLDPNGAWSLAEAVRLCRDKRGVLAYAEDPCGAEDGYS
                     GREIMAEFRTATGLPTATNMIATDWRQMGHAVRLQSVDIPLADPHFWTMQGSVRVAQM
                     CAEWGLTWGSHSNNHFDISLAMFTHVAAAAPGRVTAIDTHWIWQDGENLTRNPLQIEG
                     GLVQVPKTPGLGVELDMDALARAHALYQRKGLGARDDAAAMQFLIPGWKFNNKAPCTV
                     R"
     gene            127545..128567
                     /locus_tag="CNE_RS18670"
                     /old_locus_tag="CNE_2c01120"
     CDS             127545..128567
                     /locus_tag="CNE_RS18670"
                     /old_locus_tag="CNE_2c01120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951833.1"
                     /db_xref="GI:503717757"
                     /translation="MYTFQRQPALRLHHWLRAFALGSVVTVAALTVSAAAYAAPQDWP
                     QRPVSVVVPFPPGGSSDAIARMLTVPLNEKLGQPFVIDNRPGATGAIGATFVKRAPAD
                     GYTMMVASIGVYAVNPFLQKNLAYDPARDFDLLTVAVRAPNVLVANPQFPANTLQELV
                     AYMKKNPGKVSFASSGAGSSDHLTAALFWQKSATDGLHVPYKGGGPAISDLLAGQVDV
                     SFQNVNAVLQHIRTGKLKAMAVTSDKRSPVLPNVPTMAEAGVKDVEVYSWQGVAAPRG
                     LPPEVKSRLHGALVSSLNDPKMRQKLSENGFEVVANTPEQFSQFEAQELQRWKTVIEK
                     GKIALD"
     gene            128668..129666
                     /locus_tag="CNE_RS18675"
                     /old_locus_tag="CNE_2c01130"
     CDS             128668..129666
                     /locus_tag="CNE_RS18675"
                     /old_locus_tag="CNE_2c01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013951834.1"
                     /db_xref="GI:503717758"
                     /translation="MTQGRRTFLKQSSALAAGLAAGPLAGLSSAAHAAQDWPTRPIRL
                     VVPYTAGGSSDIIARLISKQLGEALGQSVVVDNRPGANGNVGAALVAQATDNHTLMLC
                     DIGALAISPSVYTKLTFNIAKDLKPVSMLAYSPHLLVVHPSVQAASVKELVALSQRSQ
                     LNFAVTAIGSAPHLAGVAVEQATGARWQYVPYKGGSQAIADTVGGSAQVLMNGMLATL
                     PHVQSGKLKLIAQSKRTRMPLLQNVPTIAEQGVPNFESGTWQGVMAPASMSDAMVARI
                     SGELIRIIRAPDLRAQLVAQGAEVVTMTPGETGKFFVAEQTRWAGVVKQAGIKLEA"
     gene            complement(130216..131742)
                     /locus_tag="CNE_RS18680"
                     /old_locus_tag="CNE_2c01150"
     CDS             complement(130216..131742)
                     /locus_tag="CNE_RS18680"
                     /old_locus_tag="CNE_2c01150"
                     /EC_number="1.2.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dioxovalerate dehydrogenase"
                     /protein_id="WP_013951835.1"
                     /db_xref="GI:503717759"
                     /translation="MHITGDMLIGAQAVRGTEALLQAINPTTGEALGPDFHGGGQAEV
                     ERACALAEAAFDTYRNTTPEQRAALLEAIATGIEALGDTLTERARLESALPIARLQGE
                     RGRTAGQLRLFATVLREGRWQQATFDAALPERNPPRPDLRMQCIAIGPVAVFGASNFP
                     LAFSVAGGDTASALAAGCPVVVKAHPAHLGTSELVGRVIQKAVQDAGLPEGVFSLLVG
                     AGNAIGTALVSHPAIQAVGFTGSRAGGLALMQAAQRRPQPIPVYAEMSSINPVFLLPA
                     ALDARGEEIGRQLVDSLVMGVGQFCTNPGLVIGIEGPALDKFRAAALGALQGKPAATM
                     LTPGIHAAFEQGVAQLSSLDGLQRIGDGVDGNGANQARPVMFETTAAQFMADHRMQAE
                     VFGPSTVLVVCRDLDEMLTVARQLEGQLTATMQLDDADHAAARRLLPVLERKAGRVLC
                     NGYPTGVEVAYAMVHGGPFPATSDARSTSVGATAIDRFLRPVCYQNLPQALLPEAVKG
                     "
     gene            complement(131847..132761)
                     /locus_tag="CNE_RS18685"
                     /old_locus_tag="CNE_2c01160"
     CDS             complement(131847..132761)
                     /locus_tag="CNE_RS18685"
                     /old_locus_tag="CNE_2c01160"
                     /EC_number="4.2.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315188.1"
                     /note="catalyzes the formation of 2,5-dioxopentanoate from
                     5-dehydro-4-deoxy-D-glucarate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-4-deoxyglucarate dehydratase"
                     /protein_id="WP_041228511.1"
                     /db_xref="GI:752557279"
                     /translation="MLAPNELKKIVSEGLLSFPITDFDAQGDFAPHAYAARLEWLAPY
                     GATALFAAGGTGEFFSLTPQDYSAVVDTAVRTCAGMVPILAGAGGPTRTAIAYAQEAQ
                     RLGAAGVLLLPHYLTEASQDGIAAHVEQVCKSVDIGVIVYNRANSKLDATQLARLAER
                     CPNLVGFKDGVGDIEAMVSIRRKLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFN
                     FIPKTAMDFYRAIAADDHDTVGRLLDNFFLPYLAIRNRKAGYAVSIVKAGARLVGRDG
                     GPVRAPLTDLTGEEMEMLGTLINKLGPQ"
     gene            133177..134154
                     /locus_tag="CNE_RS18690"
                     /old_locus_tag="CNE_2c01170"
     CDS             133177..134154
                     /locus_tag="CNE_RS18690"
                     /old_locus_tag="CNE_2c01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041228768.1"
                     /db_xref="GI:752557536"
                     /translation="MGELQALLENHGLMLVFLNVLVEQAGLPVPAYPMLFVAGALGVQ
                     DTGPSIGAVLAAVIFACLIADTGWYFAGRRLGQPMLRTICRVSISQDSCIRQTQSLYL
                     RVGPRSLVIAKLLPGAGALSTAMAGMTGTPLPVFLFYDAIGALVWAGSALLIGVVFSD
                     FIDAILEAFSAYGHMAVVGLLVAFALFLAWRWWRRLRLLRRTRRVPRMTVDELEARRL
                     AGSLPVVIDVRAHGDTPMERIPGSVVLDMQGALDSLDALGVPHAGADIVVYCACPNEL
                     SAALLAERLRVAGYPKTWALAGGFDEWKRRHGGTAPTEAANQPGPAEAA"
     gene            complement(134180..135136)
                     /locus_tag="CNE_RS18695"
                     /old_locus_tag="CNE_2c01180"
     CDS             complement(134180..135136)
                     /locus_tag="CNE_RS18695"
                     /old_locus_tag="CNE_2c01180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011301646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951838.1"
                     /db_xref="GI:503717762"
                     /translation="MALQQTLVIHEALDSPHANGAVVSELFVPYAGAGVSVEVTTVHN
                     APPENTANTTDFITIVIPGTTGKRSGGSAPTLGVIGRNGAIGARPELVGLVSDADGPI
                     GCLAVALKLAQMKARGDHLVGDVIVTTHLSTNVSMQPHDPVPFMGMPVSSDTMNDYQV
                     LPEMDAILSIDASKGNSIIKHRGFAISPTAMQGYILRVAPDLVATMESTTGCPAVTFP
                     ISQQDITPYHNGLYHFNSIMQPHVATQAPVVGVAVTAQSVVSGSATSANHEIDIAEAV
                     RFCVEVSKRFGAGKCQFFNAAEWEKIRAVYPDLSVFQTAGKR"
     gene            complement(135195..136355)
                     /locus_tag="CNE_RS18700"
                     /old_locus_tag="CNE_2c01190"
     CDS             complement(135195..136355)
                     /locus_tag="CNE_RS18700"
                     /old_locus_tag="CNE_2c01190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951839.1"
                     /db_xref="GI:503717763"
                     /translation="MSHTTRHAGRLALPLLLGLPAAAMAQSGVTLYGVIDTALTYQSH
                     SNPAGDAQIGLQQGGEGFLSGSRFGLRGIEDLGGGLKAGFVLENGLLADTGKLDQQGQ
                     LFGRQAYVKIGNQWGELALGRQYTTANTMLYYVDPLGVGAAPSNAWMVYLTGQRYDNA
                     VSYTGNFGPVSVIAEYALGETAGNTRATSSMSFGVRYAAGPIAAVGDFQQTRDSQSRA
                     ASIYLAGLKAAVGRASLFANYIHSDRDAGFDSSKGGTDTATITSMSTAATPTNRAAIN
                     SVFGGSRHDDFFTLGASYPVTGNVTLIGSVMHNRTRADGFSGNRTTAYAVADYAFSKR
                     TDAYLALAYDRVHGDWSGLFGNNTTSWTGGSGKPLDGRDSQTTMMVGLRHQF"
     gene            complement(136490..137245)
                     /locus_tag="CNE_RS18705"
                     /old_locus_tag="CNE_2c01200"
     CDS             complement(136490..137245)
                     /locus_tag="CNE_RS18705"
                     /old_locus_tag="CNE_2c01200"
                     /EC_number="3.4.13.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase E"
                     /protein_id="WP_013951840.1"
                     /db_xref="GI:503717764"
                     /translation="MTQRILLMSSSRKDNHGYLEHAGEQIHTLLRREPRKVLFVPFAG
                     VTFSFDTYEGMVKPVFETLGYALESIHHSADPLRAVEQAEAIAVGGGNTFALLKRMYD
                     AGIVDAIRARVRAGMPYVGWSAGSNAACPTIRTTNDMPIVQPPSLRALGLVPFQINPH
                     FISGKPAGHNGESREERLAEFLHINAPEQVFALPEGSALFSDGTRGTVLGERHALWFP
                     AEGKAETIREGETFPLSQITGPAGMPDWPGFAA"
     gene            complement(137290..138483)
                     /locus_tag="CNE_RS18710"
                     /old_locus_tag="CNE_2c01210"
     CDS             complement(137290..138483)
                     /locus_tag="CNE_RS18710"
                     /old_locus_tag="CNE_2c01210"
                     /EC_number="2.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013951841.1"
                     /db_xref="GI:503717765"
                     /translation="MDIQAIQAIRADTPLTASTIYLDTAAASLPPDAVLDTVRSYLLD
                     TGHVGIYLPAFRKETYTRVEAVRGKLAGLLNCAADEVAFTKNATESISIVARGIAWEA
                     GDEVLVADTEMLSNLLPWRRLEQSHGIVVKMVAANAEGLLSPEAFEGAVTPRTRLLTF
                     SHLPNSTGAVQPAKQICAVARRHGVLSLVNAAQSVGMLRSDVAELDCDFLAGCGRKAL
                     RATEGSGFLYVRRALIEQVEPALVGWWNGAYDRATGALSLVAGARRFEAGCPIVPAIL
                     GMGTAIDYAAAIGIDAIEARVRDLTGYAVAKFASIPGFELYGPADLANRIGIVPFNVR
                     GVDPARIVAALEAQQCIIEAGNFMADAILARYGVSTMARVSLHYFNTHEEIDRVAALI
                     RAAIA"
     gene            complement(138551..140158)
                     /locus_tag="CNE_RS18715"
                     /old_locus_tag="CNE_2c01220"
     CDS             complement(138551..140158)
                     /locus_tag="CNE_RS18715"
                     /old_locus_tag="CNE_2c01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951842.1"
                     /db_xref="GI:503717766"
                     /translation="MTMPTQLNAPMAAQPATRTRFMEPLLLLVSVGLSVFGAMIGMQL
                     IVSLGISANTSIIGALIAIVFSRIPLEITRRFRVLERQNLVQTAISSATFGAANSLMI
                     PIGVPYAMGMPELATPMLIGAVIAMFVDGAMLYFLFGSRIFPATGTWPAGIATAEAIW
                     AGDRGGRKAAFLGLGIAVGVGGAWLGVPMSAFGAAFLGNLAALTMFGIGLLVRGYSVA
                     LTGIDIAKAYIPHGLMIGAGIVALFQVANEIRRARYVPAADARTIEVPASRASRILSG
                     GFLIYLAIALLISVLAGHVSDMSLGMLVVFVLYAAFAAYVHELIVGIAAMHSGWFPAF
                     AVALITLTIGILIGFPPTALAVLVGFSAATGPAFADMGYDLKTGYLLRGEGRDMEAEL
                     AGRKQQFLAAMIGFAVAAVVVLVFHRTFFAQNMIPPVDRVYAASIKAGSSAEIARNLV
                     IWAIPGALLQLIGGSRRQLGILLSTGMLIASPLAGWAVLAGLAIRFVLQRLRGDKHVA
                     EMSAFAGGVIAGDALFSFFGSVTKLRK"
     gene            complement(140223..140936)
                     /locus_tag="CNE_RS18720"
                     /old_locus_tag="CNE_2c01230"
     CDS             complement(140223..140936)
                     /locus_tag="CNE_RS18720"
                     /old_locus_tag="CNE_2c01230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013951843.1"
                     /db_xref="GI:503717767"
                     /translation="MLKTLDGALALLTHFTARQPSWGVRELARHSGVHHAVVHRVLAT
                     FAGNGFLVQDALGRYGLGLRWFELGQVMRRTLSPAEVVQPALEALARECGETVFLSWL
                     DGGEGLCTDIAQSQHQLRFSIEVGQRFALDAGAHAKAILAFQPEAFRRQVAGDAPELE
                     ARLDQIRADGWAYTCEESAATVAGLALPLRHRDTQAVVGSLAIAGPLQRLTPEAVPRL
                     LEALRTTRNTIGPVAGFMR"
     gene            141140..143923
                     /locus_tag="CNE_RS18725"
                     /old_locus_tag="CNE_2c01240"
     CDS             141140..143923
                     /locus_tag="CNE_RS18725"
                     /old_locus_tag="CNE_2c01240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951844.1"
                     /db_xref="GI:503717768"
                     /translation="MAAEHHGTGGSGDEATRIAQRRRQLGIAPRADDGQRNWALALSG
                     GGIRSATFCLGVMQAMAGTAMSAKAAAPAPAPEAATPAAATAAAAQTVPGLASLLAQF
                     DYLSTVSGGGYLGAFFVSLFVPGRLRRGAGPVQAATDAYHTLQCEPPGRIHTSVSYAA
                     DPGRGAVAWLRENGRYLSPTGAGDNLYAAALVVRNWLAMHFVIGSALLVLLAALALGQ
                     HIAVGVSYGLGRHEMDLLHDARQAYNQGECAIWWSTLLWLPLATALAGAVPPGLAYWL
                     IYPRANDPQATARFLSPAPLLATLLGLMLLAAARWSEWLGSGLVIGKLFAALGVLTLL
                     GVLWCLALLQGEPRTVAAYRVRATRALRGALTLTLWLAALGIADTIARTAYLFAHQAH
                     HQWGAALPATVLGVLVWLVRYGSRWRDAGRQGSTDTPWRALCARLPVSLLAGAVAAVL
                     ALLLFVLWSWLVLWVRWDGREPVDWLVFGNAYTGPALAMLTVVSLALALVVGRFAGFL
                     NLSTLQPFYAARLTRAYLGASNGERFAPPDPTTDQDGSQGARFSVAEPVPGDQLSLNT
                     YYDPRVLAPLHLINVTLNLTVDPAEQLVQRDRKGKPLCLAPGPCVAQSGVAAAIPPDA
                     YARFTIDGRGCCPDVSWPSSGKLAESRTVGDWMAISGAAVSTRLGRATTLGTSMLLGL
                     ANLRLGIWWPSYPASHAREGGRRGRARRHPERATHPWLAAGIALFRTQYYLGCELSAR
                     FHGTRRGWQFLSDGGHFDNTGVYELLRPGRDVSLIVLCDCGGDPDYRFGDLANLIRLA
                     RIDHGLEIVVDTEAATTHPVLSRVFGVPDDFMPGAPTGDKCAVLLNVFRTGPECGAPR
                     ARTCRIVLLKPRLVSWAPADVRHYGATHPAFPQEATGDQFFDEAQWESYRALGHAIGQ
                     RVLGGAVGKALLV"
     gene            complement(143936..144691)
                     /locus_tag="CNE_RS18730"
                     /old_locus_tag="CNE_2c01250"
     CDS             complement(143936..144691)
                     /locus_tag="CNE_RS18730"
                     /old_locus_tag="CNE_2c01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011301653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013951845.1"
                     /db_xref="GI:503717769"
                     /translation="MTLKTLDGALALLTHFTVRQPTWGVRELAKHSGVHYAVVHRVLA
                     TFAANGFLVQDAATGKYSLGLRLFELGQVVRKSFSPDEIVRPVLEKLAAQSGETVFLS
                     WLDGHEGLCVGLVQSQHQLRFSIELGERFPLYAGAHAKAMLAFQDDAFRDEVYRQGLA
                     RMAPHTTLNRERIEQQLAEVRERGWAHTREEAAASVAGLALPLWSRDRSAVVGSVAIA
                     GPQQRLDEAAVPRLLEALRDASGRLEDVIGFVR"
     gene            144881..145921
                     /locus_tag="CNE_RS18735"
                     /old_locus_tag="CNE_2c01260"
     CDS             144881..145921
                     /locus_tag="CNE_RS18735"
                     /old_locus_tag="CNE_2c01260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkane 1-monooxygenase"
                     /protein_id="WP_013951846.1"
                     /db_xref="GI:503717770"
                     /translation="MNHDSIPNGAGVAWSVLDLAPIPEGSDAGQAMRNSLDLARHAEQ
                     LGYHRYWLAEHHNMPGIASAATAVLIGYVANGTRTIRVGSGGVMLPNHSPLVIAEQFG
                     TLASLYPGRIDLGLGRAPGTDQATARALRRHLSADSADTFPQDVEELQAYFEDVRPGQ
                     RLRAVPGAGLKVPIWLLGSSLFSAQLAAAMGLPFAFASHFAPGFMRQAVDLYRRTFRP
                     SEALDRPYVMLGLNVFAAETGDQARRLFSSLQQQFLALVRGTPGQLRAPVDDIESLWT
                     ESEADHIRRSLACSVVGDPDAVRAGMQRFVDDLRPDELMLAGQIHDHQARLRSFAIAA
                     DAARSLKTSSAL"
     gene            146143..148149
                     /locus_tag="CNE_RS18740"
                     /old_locus_tag="CNE_2c01270"
     CDS             146143..148149
                     /locus_tag="CNE_RS18740"
                     /old_locus_tag="CNE_2c01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P28614.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013951847.1"
                     /db_xref="GI:503717771"
                     /translation="MDLRQREHIETVVQATTYLAPPAVLADRIAHDAIIQNSWRRCVH
                     QYGLDPSRMQEARILPQPRLREHQERIDDFARIARHGLQSLYGQVAGLGYVVLLTDAQ
                     GVTVDYIGEARSDAALRHAGLYLGAEWSESGAGTCAVGTALATGQALTVHQADHFDAT
                     HIPLTCTAAPLFDTHGNLHAILDISALTSPQAKDSQGLALQMVRIYAAHIENANFLRA
                     HRRDWILKLNVAPEFVDVNPEYLLALDEAGRIVGHNHRARLMLEGELGGAPGATVLGQ
                     RFETLFDARLEDLGHYVYSRPSEQRLVALTRSGGLLYLSVLPPALRWQAPPAETQVEM
                     PAALAALTGGDAALQQQLQRAARLVDSPINLLIHGETGSGKEFLAKALHLASARRGGP
                     FVAVNCAAIPETLIESELFGHLPNSFSGAGPRGKRGLIQEADGGTLFLDEIGDMPREL
                     QSRLLRVLAEGEVLPVGAARPVPVRLRVISATHHSLEQLVADGRFREDLYYRLNGARF
                     TLPPLRARTDLDWLVRKLLQEGGAEGGEITLSPAARERLHRHRWPGNLRELRNVLEYA
                     RAVCADGYIDVPDLPDSLAGPAPSAALPQPGPAQSPAAAPFDPHQLPPEGMLLMQYLR
                     ASGWNLSAVARQIGVSRMTLYRRMERYGIQSPNRRDGGPEPTDA"
     gene            148385..149464
                     /locus_tag="CNE_RS18745"
                     /old_locus_tag="CNE_2c01280"
     CDS             148385..149464
                     /locus_tag="CNE_RS18745"
                     /old_locus_tag="CNE_2c01280"
                     /EC_number="2.7.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin catabolism protein X"
                     /protein_id="WP_013951848.1"
                     /db_xref="GI:503717772"
                     /translation="MGHAAGASAQIAPVVGIIANPISARDIRRVIANANSLQLADRVN
                     IVLRLLAALASCGVERVLMMPDREGLRVMLARHLARRQGPDSGLPAVDYLDMPVTARV
                     DDTLRAARCMADAGVAAIIVLGGDGTHRAVVRECGAVPIAGLSTGTNNAYPEMREPTI
                     IGLATGLYATGRIPPAQALASNKRLDIVIRDGNGGFRRDIALVDAVISHEHFIGARAL
                     WKTDTLAAVYVSFADPEAIGLSSIAGLLEPVGRREEGGLAIELAAPGEGEFDLCAPIA
                     PGLMCTVPVAGWQRLEHGRPHRVRQRSGIVALDGERELAFGPDDEVTVTLHDHAFRSI
                     DVAACMRHAARHHLMRRLPRHAAAG"
     gene            149536..150537
                     /locus_tag="CNE_RS18750"
                     /old_locus_tag="CNE_2c01290"
     CDS             149536..150537
                     /locus_tag="CNE_RS18750"
                     /old_locus_tag="CNE_2c01290"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P27745.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit alpha"
                     /protein_id="WP_013951849.1"
                     /db_xref="GI:503717773"
                     /translation="MTARASQDSAALPLDKETLLTVYRKMRTIRDFEERLHVDFGRGD
                     IPGFVHLYAGEEAAGVGILHHLNDGDRIASTHRGHGHCIAKGVDPVAMMKEIYGKKGG
                     SCNGKGGSMHIADLSKGMMGANGILGAGAPLICGAALAAKFRGKGEVGITFCGDGASN
                     QGTFLESLNLAAVWNLPVIFVIENNGYAESTSRDYGTAVDSYVDRAAGFGIPGVTVDG
                     TDFFAVHEAAGEVIRRARDGGGPSLLECKMVRFYGHFEGDAQTYRAAGELDDIRANKD
                     CLKLFGRAVTQAGVVAREELDAIDREVAALIEHAVQEAKAAPQPGPEDLLTDVYVSY"
     gene            150574..151590
                     /locus_tag="CNE_RS18755"
                     /old_locus_tag="CNE_2c01300"
     CDS             150574..151590
                     /locus_tag="CNE_RS18755"
                     /old_locus_tag="CNE_2c01300"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018310279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase subunit beta"
                     /protein_id="WP_013951850.1"
                     /db_xref="GI:503717774"
                     /translation="MARKLSIKLAINEAIDQEMTRDPSVIMLGEDIVGGAGADGEKDA
                     WGGVLGVTKGLYAKHGDRLLDTPLSESAYVGAAIGAAACGMRPIAELMFIDFMGVCFD
                     QIFNQAAKFRYMFGGKAETPVVIRAMVGAGFRAAAQHSQMLTPLFTHIPGLKVVCPST
                     PYDTKGLLIQAIRDNDPVIFCEHKNLYGLEGEVPEGAYAIPFGEANIVRDGKDVSIVT
                     YGMMVHRSLEAAATLAKEGIEAEVIDLRTLSPLDMDTVLESVENTGRLVVVDEASPRC
                     NIATDISAQVAQQAFGALKAGIEMVCPPHTPVPFSPTLEDLYIPSAAQIVAAARKTMK
                     GGKH"
     gene            151590..152714
                     /locus_tag="CNE_RS18760"
                     /old_locus_tag="CNE_2c01310"
     CDS             151590..152714
                     /locus_tag="CNE_RS18760"
                     /old_locus_tag="CNE_2c01310"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine acetyltransferase"
                     /protein_id="WP_013951851.1"
                     /db_xref="GI:503717775"
                     /translation="MATAISPTIIPIVMPKWGLSMKEGTVNAWLVDEGTEITVGLPIL
                     DVETDKIANAVEAPDAGTLRRKVAQAGDVLPVKALLGVLAPAEVSDAQIDDYVAAYET
                     PADDAGEEEAAAAYQFADVDGIRVRYARKGGGAETVLFIHGFGGDLDNWLFNLDPLAD
                     AYTVVALDLPGHGQSSPRLAGTTLAQMAGFVARFMDETGIEAAHVVGHSMGGGVAAQL
                     AVDAPQRVLSVALVSPVGFGDAVNSGYTEGFVSAQSRRELKPVVELLFADAGLVSRQM
                     LDDLLRYKRLDGVTEALTALGQGLFGGGRQSEQPGQRLAGSGKRVLVVWGGQDQIIPA
                     AHAEAAPAGATVKVFADAGHMSQMEKANDFNALLKKHLAG"
     gene            152795..153136
                     /locus_tag="CNE_RS18765"
                     /old_locus_tag="CNE_2c01320"
     CDS             152795..153136
                     /locus_tag="CNE_RS18765"
                     /old_locus_tag="CNE_2c01320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951852.1"
                     /db_xref="GI:503717776"
                     /translation="MTTDLKTRLTEINKQFGALGQAQPAAMSAFQGVMKAATQDGSLP
                     AAVKELIAVALAVQKGCDDCVLFHTSQALRHRATREQLAEVLAINIEMGGGPGAMYAS
                     KALAYFDALNV"
     gene            153183..153944
                     /locus_tag="CNE_RS18770"
                     /old_locus_tag="CNE_2c01330"
     CDS             153183..153944
                     /locus_tag="CNE_RS18770"
                     /old_locus_tag="CNE_2c01330"
                     /EC_number="6.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P27750.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951853.1"
                     /db_xref="GI:503717777"
                     /translation="MPFEFVDAAHAGQAGSDPLQDELALLDLAAQGRQVAQLWEAPLS
                     LVVPRTYLRHAALETARADFAQQGCPVFLRMSGGGLVPQGPGILNLSLAYAVGQPPGA
                     RSDAVYLHLCEVIGDALQALGVDTHWQAVAGSFCDGRFNLAWGPPEAARKIAGTAQYW
                     RRAPAAMQAPDGQRHLVLAHAVLLVSADPVQINARANAFEAAIDSGRRYDAGKVVSVR
                     EALLAGGRAVDDDGALMAQVSDALRRSVGQTPPPA"
     gene            complement(154127..154948)
                     /locus_tag="CNE_RS18775"
                     /old_locus_tag="CNE_2c01340"
     CDS             complement(154127..154948)
                     /locus_tag="CNE_RS18775"
                     /old_locus_tag="CNE_2c01340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951854.1"
                     /db_xref="GI:503717778"
                     /translation="MTNFIEAYCAQVRLAGAVGVIAKPVVVAQDSTYAMHYVPCEYLN
                     TQAPLVLVSTTPGHAHVRLAAAVTEELMRAHAPGRVIQRENKRRVELGGKLVRPNLIR
                     MLDHFRVPELVGLPHAAALWNDGFERLQPLALLPHATTRRGLAFDGPLEELLETPMLR
                     EVFEVQFLGAVRQMRTDALYIALGRTAWAGLRHAVSRRLLAKSQLLGMMPVPARAGSM
                     VRYFLREIAASDLSAKDPVRHRVAWLDAAHAELEASVRKLRTAIRPDPHSAYLIA"
     gene            complement(155384..155773)
                     /locus_tag="CNE_RS18780"
                     /old_locus_tag="CNE_2c01350"
     CDS             complement(155384..155773)
                     /locus_tag="CNE_RS18780"
                     /old_locus_tag="CNE_2c01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein C"
                     /protein_id="WP_013951855.1"
                     /db_xref="GI:503717779"
                     /translation="MTIQATWQPSQGNSICHLTNGTAEWRADLDASAGGDTQYPNPHD
                     LLDSALAACTTLTLQLYAKRKGYVITGVHVSVAHEEANGTYTMNREVKVSGELTPQIL
                     DDLLRVANRCPVHKTLSGQFSIQTSIA"
     gene            156334..157911
                     /locus_tag="CNE_RS18785"
                     /old_locus_tag="CNE_2c01360"
     rRNA            156334..157911
                     /locus_tag="CNE_RS18785"
                     /old_locus_tag="CNE_2c01360"
                     /product="16S ribosomal RNA"
     gene            157933..158009
                     /locus_tag="CNE_RS18790"
                     /old_locus_tag="CNE_2c01370"
     tRNA            157933..158009
                     /locus_tag="CNE_RS18790"
                     /old_locus_tag="CNE_2c01370"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:157967..157969,aa:Ile,seq:gat)
     gene            158021..158096
                     /locus_tag="CNE_RS18795"
                     /old_locus_tag="CNE_2c01380"
     tRNA            158021..158096
                     /locus_tag="CNE_RS18795"
                     /old_locus_tag="CNE_2c01380"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:158054..158056,aa:Ala,seq:tgc)
     gene            158386..161290
                     /locus_tag="CNE_RS18800"
                     /old_locus_tag="CNE_2c01390"
     rRNA            158386..161290
                     /locus_tag="CNE_RS18800"
                     /old_locus_tag="CNE_2c01390"
                     /product="23S ribosomal RNA"
     gene            161400..161512
                     /locus_tag="CNE_RS18805"
                     /old_locus_tag="CNE_2c01400"
     rRNA            161400..161512
                     /locus_tag="CNE_RS18805"
                     /old_locus_tag="CNE_2c01400"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            161653..161931
                     /locus_tag="CNE_RS18810"
                     /old_locus_tag="CNE_2c01410"
     CDS             161653..161931
                     /locus_tag="CNE_RS18810"
                     /old_locus_tag="CNE_2c01410"
                     /EC_number="3.1.25.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951856.1"
                     /db_xref="GI:503717780"
                     /translation="MSADSAWYLYLLECTGDSIYTGITTDVARRFAEHLSGKGAKYTR
                     SRKPIRVLGQLRFETKSEALKAEIEIKRLSSTQKRAFCAQLPAAEPAQ"
     gene            complement(162001..162423)
                     /locus_tag="CNE_RS18815"
                     /old_locus_tag="CNE_2c01420"
     CDS             complement(162001..162423)
                     /locus_tag="CNE_RS18815"
                     /old_locus_tag="CNE_2c01420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018004795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic hydroperoxide resistance protein Ohr"
                     /protein_id="WP_013951857.1"
                     /db_xref="GI:503717781"
                     /translation="MKLEKVVYTAHATATGGRDGRATTSDGQLDAKLAVPKEMGGAGN
                     GLNPEQLFAAGYSACFLGAMRYVAGQQKIAVPADATIEGAVGIGPIPQGFGIQVELKI
                     SLPGFEREAAEKLVEQAHQVCPYSNATRGNIDVTLTVV"
     gene            complement(162470..162946)
                     /locus_tag="CNE_RS18820"
                     /old_locus_tag="CNE_2c01430"
     CDS             complement(162470..162946)
                     /locus_tag="CNE_RS18820"
                     /old_locus_tag="CNE_2c01430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013951858.1"
                     /db_xref="GI:503717782"
                     /translation="MERDNDPSPNWLLLDRQLCFALYSSSLAMTKLYKPLLSELGLTY
                     PQYLVMLVLWETETLTVSELGARLALDSGTLTPLLKRLETARLVTRTRDAADERRVLV
                     SLTDSGRALRQRAEHIPEQMLCATQCPVEEIQALTQRLHALRSSLEQARTDSSLPD"
     gene            163128..164594
                     /locus_tag="CNE_RS18825"
                     /old_locus_tag="CNE_2c01440"
     CDS             163128..164594
                     /locus_tag="CNE_RS18825"
                     /old_locus_tag="CNE_2c01440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_041228512.1"
                     /db_xref="GI:752557280"
                     /translation="MMRQTIARTAVGIAALAALGGGYAYLQKEVITPGYAAPAPAVAP
                     AQPAAAVATPTDFSGIVAQYGPAVVNISVTARAQRTAAQMPPGIDPDDPLFQFFKRFG
                     PQFQGPQGGQQQLVRGLGSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLG
                     SDPQTDVAVIRIDARNLPTVRLGDPSRVRVGEPVLAIGSPYGFENTVTAGIVSAKSRS
                     LPDDTYVPFIQTDVAVNPGNSGGPLFNQRGEVVGINAQIYSQTGGYQGLSFAIPIDVA
                     TKVQQQLVAHGKVTRGRLGISVQEVNQALAQSFGLPKPTGALVNSVELDSPAARAGLK
                     PGDVIVQLDNDVIDHSGDLPEHVADIKPGTQTSLKIIRKGQPMTLSVTVGTAKDRAVA
                     QKGGGSEAGGRLGLAVRPLTPAEKRDSGIDGGLVVEDVAGPAARVGIQPGDVILSLNG
                     TPISSAEQLRSLVSKSGKQVALLVQRDDARIFIPLDLG"
     gene            164855..165187
                     /locus_tag="CNE_RS18830"
                     /old_locus_tag="CNE_2c01450"
     CDS             164855..165187
                     /locus_tag="CNE_RS18830"
                     /old_locus_tag="CNE_2c01450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018004792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010809792.1"
                     /db_xref="GI:498509321"
                     /translation="MQLDFTRAITPGTDRARRLTSTTSTAGSAPKPRRRKKVVAPHWE
                     RGYRSHFYRNERGDKLGEVRLSERGDIPVVYHWAAGNYSGAEGSLAHARARVEETIGF
                     GMRQLSLF"
     gene            complement(165340..166875)
                     /locus_tag="CNE_RS18835"
                     /old_locus_tag="CNE_2c01460"
     CDS             complement(165340..166875)
                     /locus_tag="CNE_RS18835"
                     /old_locus_tag="CNE_2c01460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_041228769.1"
                     /db_xref="GI:752557537"
                     /translation="MRWLRWLSHRQRQTLLMMLLALATGVEFLENIMFVFASSHIVGG
                     LDADPRSFALVQAAYAVGSMLMILKQQWLSRRFGYRYYLTGALLLFMAGTVVAATSHA
                     LPQMVVARFIQGVGGGALFTSCRILVNVLFGPTARPRATRIFMIGIFSASALGPAFAA
                     ELIDHGVWQDVFYGVLPFAALATLGAWLLLPDAEPRADTSGPALGPLLLFGAAIVTLQ
                     AALTEARFDVFSHPLRLALVAAAGLALLAVFLFHQWHHRDPVLHLRALRQPVYLTGLA
                     MYFVYYMISNLSGYLFPIYAEQALKIPLATTGWLNTFAALVSLAGIFVYLQVAPRLTR
                     KKPLMVAGLVLMAATAWWFSQMPPDAGPPALAWGLVGKGLFGVLVIIPIAGLTFRALS
                     PDEFAHGYRSKNLMRQVASSFASALGAVLLQNRQFAVHDSLLHAVGQRPAETEHWMAA
                     MQAALAARGFDAAQAHLGALAQLNGLIEQQARLIACEDIYRLIAVLALGAAAYMLLQR
                     RLA"
     gene            complement(166920..167408)
                     /locus_tag="CNE_RS18840"
                     /old_locus_tag="CNE_2c01470"
     CDS             complement(166920..167408)
                     /locus_tag="CNE_RS18840"
                     /old_locus_tag="CNE_2c01470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013951861.1"
                     /db_xref="GI:503717785"
                     /translation="MSFEQRIDRFCASHPEAPRDLILASRLLLRTARLLRGHIDQALA
                     PFELDMSQYLLLSMLAVDDNQPSMPSELGTTLDATRTQMTRLLDGLEARGLLRRRASA
                     SDRRSLELTLTPAGRRLLERAAPAVHAAYGEAWAPLGAGGLASATRALTQLHQTLEGL
                     QP"
     gene            complement(167533..169503)
                     /locus_tag="CNE_RS18845"
                     /old_locus_tag="CNE_2c01480"
     CDS             complement(167533..169503)
                     /locus_tag="CNE_RS18845"
                     /old_locus_tag="CNE_2c01480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="WP_013951862.1"
                     /db_xref="GI:503717786"
                     /translation="MKPVARPLQHDDHGLLLGQLALVLAPQARTLPVAVSLLLVLLLG
                     WRWLLWRRRAPLPSRWMLGITAVMVLLVASALVWQDGGGMGRELAVALLGAFVILKLL
                     ECRALSDATLVTQLSFYLLLTLYLSDQPFWLALYSLAIGAWVLRNWLLLHHPEARSRL
                     AIWPLLGRMALLGLPWALALFVLFPRLEHPLWQLPQSAPRGTTGISDTMRPGSVGQLI
                     RSPEVALRAEVAGPPLPSAALYWRALVLWEYDGTTWHPSRQRRQQLAPAPAAGNTEGI
                     DISITLEPSQQRWLFALDRGQALSAGVDAAATPDGEFMVRGPVDQRIRYRTHSTLSPA
                     PEALTAATRRLALSLPDGNPRARALAAQWADRHADPAARVQAALRLFAAAPFAYTLSP
                     PPLGSEQVDSFLLDTRRGFCEHYASSFVFLMRAAGVPARVVTGYQGGEYNPIGNHYVV
                     RQSDAHAWAEVWLDGRGWVRVDPTGAVAPSRIEQGLDAVVGSEAADWRPSQQPAWLKD
                     LRWAYEGVVYTWQRWVLQYDHAQQQRLLLALGAGVGAGQLLAGVLGALCLLALVPLWR
                     RRGPADPVDAAYARFCALLARHGCERAQAEGPQDFAARASARLPRAADAIAAVSAAYV
                     GLRYSNLPAARHAQALAAMRAGIRQIAAALRH"
     gene            complement(169500..170531)
                     /locus_tag="CNE_RS18850"
                     /old_locus_tag="CNE_2c01490"
     CDS             complement(169500..170531)
                     /locus_tag="CNE_RS18850"
                     /old_locus_tag="CNE_2c01490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951863.1"
                     /db_xref="GI:503717787"
                     /translation="MAARKSVLRGAPAMAQRRTAGRRPAGETGGTLLLDRRHLYILPT
                     RGGLGFAVVLAAMLLTSLNYNISLGFALTFLLAGIGMACMWLAYRNLLDLAVAAGPAA
                     PAYAGQDAVFQLRIDNRDADARIGIEAHVPTLPNVAIAMLMLEGSASGMLALYVPTAR
                     RGRLVLPRVAIASRFPFGLFRVWSYADLDMSTLVYPAPEPDAPPPPAAYRPDGGDAVH
                     TTASAASSDDGVDQLRRYRSGDPLHRIAWKHSARTGRWLSRAGDPPQQPARWLDWHAL
                     PAGMEAEARLSRLCAWLLAAGDDAEIGLRLPGVELPPARGASHRRACLEALALWPQRP
                     AACRAGDRV"
     gene            complement(170537..171463)
                     /locus_tag="CNE_RS18855"
                     /old_locus_tag="CNE_2c01500"
     CDS             complement(170537..171463)
                     /locus_tag="CNE_RS18855"
                     /old_locus_tag="CNE_2c01500"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013951864.1"
                     /db_xref="GI:503717788"
                     /translation="MTARPRIVASLSEAQAQLGRIVLGKPQQVRLALACMLARGHLLL
                     EDVPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSVFVRDAGEFRFHRGPVF
                     AQVVLADEINRAPPKTQSALLEAMAEGQVTHDGTTHALPSPFFVIATQNPLEQIGTHA
                     LPESQLDRFTMRLSLGYPDPVFERVLYLGGASAPELPPVMDGSQVLALQEAAAQVYAS
                     PALVDYVLALVQATRSHGGFAAGLSPRAGLALLACARAWALLAQRNMVLPEDVQAVFT
                     AVATHRLLPAGAGGHAAVAGELAALQAGVAIP"
     gene            171719..172540
                     /locus_tag="CNE_RS18860"
                     /old_locus_tag="CNE_2c01510"
     CDS             171719..172540
                     /locus_tag="CNE_RS18860"
                     /old_locus_tag="CNE_2c01510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_013951865.1"
                     /db_xref="GI:503717789"
                     /translation="MTSLDPCADLPSSVLSADPGALPRLVQAFHANGFVILRGFADEP
                     ACAALEAVTREHLAVAVPPVEFEADLGYPGAPAARDAAGGGTVRRLRQAYGRDEVFRR
                     WASDPQLVAVVQALLGEPARITLAHHNCVMTKHPHYGSQTGWHRDTRYWSFARPELVT
                     VWLALGDEDERNGVLRVIPGSHQAKLEPGQLDPAEFLIEAHPASQPLLDAAQPLALHR
                     GDVLFFDSRLFHAAGRNASNAVKLSVAFAYFGASNRPLDGTRSAEFGSVELPAAV"
     gene            complement(172556..173389)
                     /locus_tag="CNE_RS18865"
                     /old_locus_tag="CNE_2c01520"
     CDS             complement(172556..173389)
                     /locus_tag="CNE_RS18865"
                     /old_locus_tag="CNE_2c01520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013951866.1"
                     /db_xref="GI:503717790"
                     /translation="MASPADSRQNPPQAPQTAAATPEKPSDSYVQSFARGLSVIRAFN
                     AQHPAQTLTEIAQASGLTRAGARRILLTLVGLGYVQADGRLFRLTPKILDLGFAYLTS
                     MPFWNLAEPIMETLSQQVHESCSISVLDGTEIVYVLRVPARKIMTINLSIGSRLPAYC
                     SSMGRVLLAGLAEPELDSVLRATELRARTGRTVTDVDALKAIVADIRKRGWALNDQEL
                     EEGLVSLAAPIRNRAGHTIAAINISGQANRTSAQEMLERFLPPLLEASEKISGLVGLR
                     T"
     gene            complement(173508..175109)
                     /locus_tag="CNE_RS18870"
                     /old_locus_tag="CNE_2c01530"
     CDS             complement(173508..175109)
                     /locus_tag="CNE_RS18870"
                     /old_locus_tag="CNE_2c01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013951867.1"
                     /db_xref="GI:503717791"
                     /translation="MQQTPVPAGPDASAPAVPAALAPAAPTPQRPRMQLASHPEMGHW
                     RLSLFGLTLGLVTGIDFSSTLMMGVASQHIQGGVGAAPEDYLYAISAYAATAVLMNMV
                     LDQVARRITYKRFTMGSLLVFVLGSLICAEFASPTGLITGKAVQGLGAGGLFAASRIL
                     VQLVSTPAERGPLMLRFGGGAFSMLAITPWLTSIFLDDIGWRAVFLFQAGIALPVLLS
                     VALTYPTRAPRDPHPPVSTLDWPAAIAAALGALVFLHTLQEMRYTRFFSSLEMPLAAL
                     CGLALFAFSGWRLYRHPDPWIDFSRLAGRQYLYGLGFYTLYYLLSSAWSFLLPSLTQT
                     GLGLTFRTTCMLLSTSGTVSTIGAVVITLGMALVFRKRRVIAIGFVVYACAAMLLSHQ
                     LMPGAPDYALVPVVLLEGLTPVLLMVQVASMTYLEVPVEDFSHAYQFKNVCKQIASAM
                     GTGLASVFMQDGLAQHRTHLVEHITRYNPVLQAPDALSATSLAKISLEVDRQATLLAG
                     MDMLHGFAVLCVVAAVFVLAQRSFR"
     gene            175171..176151
                     /locus_tag="CNE_RS18875"
                     /old_locus_tag="CNE_2c01540"
     CDS             175171..176151
                     /locus_tag="CNE_RS18875"
                     /old_locus_tag="CNE_2c01540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951868.1"
                     /db_xref="GI:503717792"
                     /translation="MNETIQWNDWEAFCCVVEQGTFTAAAEQLDCPKSRVSAAVARLE
                     TAIGAKLLERTTRRMRLTDAGKAVYRDVAPLFARLREIRQETLAREERVQGVLRIATP
                     YEFGAQQLGGVICRTLAAHPALDVAVEITQGLVDPIRDGFDVAFVVVDTDLPDSGTVA
                     RRIYHVERGLFAAPALADSLPAQLRPEDLANMPTLTTPGDTVWEFTRDGQTVSVPIRP
                     RMQTHNAELRVQGALAGLGIARLSVIYCEAEIAQGRLVRVLPDYPLPPLRVFALLPDR
                     RLQPRKVRAFMEAIESMMVSELEPNAGLDGGMGAEAAASGHAEGEAHPAG"
     gene            complement(176205..176486)
                     /locus_tag="CNE_RS18880"
                     /old_locus_tag="CNE_2c01550"
     CDS             complement(176205..176486)
                     /locus_tag="CNE_RS18880"
                     /old_locus_tag="CNE_2c01550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951869.1"
                     /db_xref="GI:503717793"
                     /translation="MKTITQRRSLALSLLCAVSLSFAAAAAHASEPVSDIARLDGSIA
                     HVGKADPFLDGAKIGQPDPYTDGARVGKPDPFTDGANVTDRRDAFTDGA"
     gene            complement(176627..177190)
                     /locus_tag="CNE_RS18885"
     CDS             complement(176627..177190)
                     /locus_tag="CNE_RS18885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041228513.1"
                     /db_xref="GI:752557281"
                     /translation="MFSEIALFLLDTVFTLFGMALLLRVWMQLTRLPTRNAVSQGVFQ
                     ITDWLVRPLRRIIPGLGGIDWATVVGAWLTAVVFLVLVALISGIDLLGFLPAMLLTAL
                     LYVLKWAISLVMWVTLLMAILSWVNPHSPVTPAIDHLTAPVLRPIQRVVPRLGGFDVS
                     PLVLFVIAQILLMVIARLGAGIFGMHY"
     gene            177429..177887
                     /locus_tag="CNE_RS18890"
                     /old_locus_tag="CNE_2c01570"
     CDS             177429..177887
                     /locus_tag="CNE_RS18890"
                     /old_locus_tag="CNE_2c01570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013951870.1"
                     /db_xref="GI:503717794"
                     /translation="MPSKSAPSRKSTSLTKADFEALSDFRYQLRRFLRFSEDAAREEG
                     LTVQQYLLLLHIRGCADKDWASIGELAERLQAKQHGVVALVNRCEAAGLVKRRLNPED
                     RRVVQVHLLAKGERYLNRLAMLHRSELESLRGAFRVARITQFNDDGAERG"
     gene            178020..178739
                     /locus_tag="CNE_RS18895"
                     /old_locus_tag="CNE_2c01580"
     CDS             178020..178739
                     /locus_tag="CNE_RS18895"
                     /old_locus_tag="CNE_2c01580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951872.1"
                     /db_xref="GI:503717796"
                     /translation="MSIPFRSVVLAVLGAGALAGCASPYGYDNGYGGGYGGSYGGGYN
                     SSGYGSSGYGGSTTISGYPAQQGYPQASGYPQGYPQQGYPQQGYPQQGYPQQEYPQSS
                     YPQQPYPQQSYPDGSYGNNHGNQAYGVRYGWVEAIEVVPGQPPSTSGAGAVVGGIVGG
                     LLGHQVGGGRGNTVATIGGAVAGAVAGNEVEKRTGSSAAAYRVRVRTSDNAYLTLTQS
                     NAYQMRIGDRVKVENGVAVPY"
     gene            complement(178736..180298)
                     /locus_tag="CNE_RS18900"
                     /old_locus_tag="CNE_2c01590"
     CDS             complement(178736..180298)
                     /locus_tag="CNE_RS18900"
                     /old_locus_tag="CNE_2c01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951873.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_041228514.1"
                     /db_xref="GI:752557282"
                     /translation="METTMQSEQQRALRNTIPDAIARAVRRSPGKTAIRFGDRAWTYR
                     QLDEAAARVAGALAQWGLRSGDRVAAFGKNSDAYVLLWLACLRSGLIHVPVNFSMTRA
                     EAEYIVTQSGASAIFADPALADRVDGLPCKVSGTLHGGKVRDILVAAAANGPVSPVSE
                     ALTDNTPAQILYTSGTTSAPKGAVLTHRALLAEYGSTIAACDIRASDYSLAALPLYHS
                     AQMHVFLMPLLLCGGTTLIADSPEAGYCLRTIHAEGITSFFAPPTVWIALLRHADFDP
                     ARLGSLTKAYYGASIMPVPVLLELQQKLPALRFYNCYGQSEIGPLATVLGPDEHAGRP
                     ASAGRPVLNVETRIVDETMQDVLPGELGEIVHRSPQLLTEYWAKPEQTAEAFTGGWFH
                     SGDLGYMDAEGYLYVVDRIKDVINSGGVLVSSREVEECLYTHGAVAEAAVFALPHPKW
                     VEAVAACVVRKRGHEDAAEEELIAHARQALAPFKVPKRIVFVADLPRNTAGKLLKRQL
                     REDYAQLFGTQA"
     gene            complement(180399..181109)
                     /locus_tag="CNE_RS18905"
                     /old_locus_tag="CNE_2c01600"
     CDS             complement(180399..181109)
                     /locus_tag="CNE_RS18905"
                     /old_locus_tag="CNE_2c01600"
                     /EC_number="3.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymethylenebutenolidase"
                     /protein_id="WP_013951874.1"
                     /db_xref="GI:503717798"
                     /translation="MTAIPDSQWICVDTAAGSFDAYLSLPPAGVQPGAPGIVLLQEIF
                     GVNEHIRAVADQYAADGYAVLAPDVFWRQAPRVQLGYEGDDMARAMALRKAVDVPAAL
                     DDIAATVQVLRQHTGAGKVAAVGYCFGGLLSYLSAARGLVDAAVPYYGGGIQNQLQEA
                     ANIRVPVQFHYGALDAHIPPGAVQGVRDAMTGKPGSEIFVYEGADHGFNCWARGSYHQ
                     PSAALAHGRALVFLSEAL"
     gene            complement(181204..181971)
                     /locus_tag="CNE_RS18910"
                     /old_locus_tag="CNE_2c01610"
     CDS             complement(181204..181971)
                     /locus_tag="CNE_RS18910"
                     /old_locus_tag="CNE_2c01610"
                     /EC_number="3.1.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_013951875.1"
                     /db_xref="GI:503717799"
                     /translation="MRRAARACCHSPTQRSAVTYRFIRRAVLGLGLAAAVSAFTSFSP
                     FALLAHARSASTFDQVTDTIANSISETFNEAVANHFPTRAGKPAQPAQPPDAKPVPAR
                     PFADGSGYTLCFVPDGASCQALLVNAIRSTRHRLLIQAYSFTSAPIAEAVAQAHRRGV
                     DVRVILDKSQQSERYTSATYLKHAGVPVVIDNKPAIAHNKVMVFDDQAVFTGSFNFTK
                     SAQERNAENGMLIRGDAAVVRAYTDNWNKRYKQSRAY"
     gene            182154..182360
                     /locus_tag="CNE_RS18915"
                     /old_locus_tag="CNE_2c01620"
     CDS             182154..182360
                     /locus_tag="CNE_RS18915"
                     /old_locus_tag="CNE_2c01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951876.1"
                     /db_xref="GI:503717800"
                     /translation="MSNHTYKLVEIVGSSPDGCDQAIQSAIEKAGETIKNIDWFEVVE
                     TRGHITNGKIAHYQVTLKVGFRVT"
     gene            complement(182537..184204)
                     /locus_tag="CNE_RS18920"
                     /old_locus_tag="CNE_2c01630"
     CDS             complement(182537..184204)
                     /locus_tag="CNE_RS18920"
                     /old_locus_tag="CNE_2c01630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide transporter"
                     /protein_id="WP_013951877.1"
                     /db_xref="GI:503717801"
                     /translation="MRARHRVAALLVSVGAFHHGLVQADPRSPVQGDPTQTLPKIAPA
                     RPDSSVTVQVERPQAAMQDLLNTRLTPRRFRIEGAKTLPFEEVAAQFKPLANREITVA
                     QLLEAASTVTQMYKDRGYPLSFAFVPAQDFANGDVLITVVEGYVAKVTVTGKAGPAEG
                     RLRAIAEKLQQDRPLRQDRFEHYVNALALQPGLQVAATVQPPTTTDGACEMVLDVKRK
                     PFTFGTGIEYMSPGLRAIATATTNSLTPLGEQISVSALFPKGRDNEEYYAASYAQPLG
                     TEGMIARLNASHYRGVPQNATLEAIGFNPRYVNDTKRIGGSLSYPLLLSNAHSLTLTG
                     GFYGADQFERYTHTATGTRVTLGTNVRVGTAELTYAQRGEGVSRNATLGLYKGFDALG
                     ASRQNNTNDLSFFRTRLLLSQSKDLPAGFGLTVAAAGQYSGDRLASGEQISFGGRFFG
                     LGYPAGEVAGDKGWGASAEISRLFLPDMAYLRTIQPYVSADVARVFSNSVSLSHRSLS
                     SVAIGARFSDRRYYTLDLSVAQPVGDKPTNASHRSPRINMTYSYQFD"
     gene            complement(184388..185893)
                     /locus_tag="CNE_RS18925"
                     /old_locus_tag="CNE_2c01640"
     CDS             complement(184388..185893)
                     /locus_tag="CNE_RS18925"
                     /old_locus_tag="CNE_2c01640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin"
                     /protein_id="WP_013951878.1"
                     /db_xref="GI:503717802"
                     /translation="MRKQQLAVTALLATLLALGGCASGSGSTSMGTSDTAGTNGGTKT
                     TGTDGTGGMGGSGGSTDLAGGGTGGTGGGTGGTGGTGGTGGNGGNTGGGETPTSLTPT
                     ATVINNAGTVLGNTGSTVTDLGNQLGSANLPLVPTQTQSGLGGVVASTGDAVGALATG
                     LQAGLGSIPNSTNPVGTTVASTGNVVTELGKGVSSAGTAVSGLGTGQLAPLAPLTSPL
                     GTVVDKLGDTVTSTGGTLTTVLSTGAVEQVTTTTSKLIVPITSQLTGATQTLGAATGL
                     GAPTGGLLATVGGALATAGIKLQQTNTPVVSGIGGVVNATGTTVASLGGAVNGPASGG
                     GLGALSPVLAPVTALAGGLTGGAGAGGTGSPLAPVTSLVSTITGGLGSATGGGSGSPL
                     APVTSLVSTFTGGLGSATGGSTGSPLAPATTAVSGVVNGVVGGVSGAAAGTGTTSPLA
                     PVTNVVAAVTGGATSTAGSTTSKGSTTGATGPIGGLVGGLLGGLTGALGQK"
     gene            186624..187730
                     /locus_tag="CNE_RS18930"
                     /old_locus_tag="CNE_2c01650"
     CDS             186624..187730
                     /locus_tag="CNE_RS18930"
                     /old_locus_tag="CNE_2c01650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin"
                     /protein_id="WP_013951879.1"
                     /db_xref="GI:503717803"
                     /translation="MQTKHPSQHSMTSLAAAGVAAIALLMAGCSSSGGGSGANPRPNS
                     NIDTPVTPGPSASGETTPTAKVTEGAGNTVVATGNAISEVGKSIQEAPLPLLPTKARE
                     GAGDVVINAGRAVGSLGAGVRDGLGQIGSVDNPVGVTVASTSNVVHDVGETLISGGDL
                     VYGLGTEKLAPLAPVTEPVGGLVRHVGIAVHDSSGKVHSVLSEGPVAQVTNSVSKVIV
                     PLTSKVTDGTQTLGAVTHLGDPANGLLYKVGNTAAAGGSMISNSHAPVVSPLGGVVTE
                     AGKTVAAAGALLNGNGQGGGNPLGGVVNNLPLAKVAGGGEGGSAGGALSPVTALLAPV
                     TGLVGGLKQGAQDSQGGSGDVKTLQLPLVGGLLR"
     gene            188101..188280
                     /locus_tag="CNE_RS18935"
                     /old_locus_tag="CNE_2c01660"
     CDS             188101..188280
                     /locus_tag="CNE_RS18935"
                     /old_locus_tag="CNE_2c01660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_013951880.1"
                     /db_xref="GI:503717804"
                     /translation="MKRLIARFIKDERGATAIEYGLIVGLVALAIAVGAGQLGTELNA
                     SFTRLSVKVSGWFVN"
     gene            188305..188832
                     /locus_tag="CNE_RS18940"
                     /old_locus_tag="CNE_2c01670"
     CDS             188305..188832
                     /locus_tag="CNE_RS18940"
                     /old_locus_tag="CNE_2c01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013951881.1"
                     /db_xref="GI:503717805"
                     /translation="MIAALLCAATLYTDLAYRRVPNALLAAAVLVLGLALLAGQATEL
                     PLAARLTGAGLGLAVTLPAYALGRMAAGDVKFLAVVGLFTGPQGLVVAWVVGSLLGLV
                     HALLALALDSSVLAALRQRAAARLRVAASTPATEQALHHQDRPIPTAQFSRARGIPYA
                     AYLAVGVLVWMAAGQ"
     gene            188905..189381
                     /locus_tag="CNE_RS18945"
                     /old_locus_tag="CNE_2c01680"
     CDS             188905..189381
                     /locus_tag="CNE_RS18945"
                     /old_locus_tag="CNE_2c01680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadG"
                     /protein_id="WP_013951882.1"
                     /db_xref="GI:503717806"
                     /translation="MLLHARANRGINRRRHGAGSAAIEFAIVAPVLLAIVIGIIYYGV
                     MLALQQVLTLAAEEGARAALRYPAGVSGSGLAATQGARVDAAAAMARGTLPTSIRNLL
                     PPGNVAQAVPCAPGSTDVCVQVTLNLPTTNILPAVPMVPIPAMLSGSAMVQLSPDI"
     gene            189432..190385
                     /locus_tag="CNE_RS18950"
                     /old_locus_tag="CNE_2c01690"
     CDS             189432..190385
                     /locus_tag="CNE_RS18950"
                     /old_locus_tag="CNE_2c01690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaB"
                     /protein_id="WP_013951883.1"
                     /db_xref="GI:503717807"
                     /translation="MTSKQIRLLAGVLLGLALLLALLAWQVGRQPAQVPAASNAARPL
                     HPVVVTTRAAEAGKPLDADALKVEMLPIDPAGAYSEVARVTGQVPLLALGANVPVLES
                     QLLAGLATQVREGERAVAVSVDEVIGVGNQVQPGDYVDVFLVLRRDQQEIPESQARML
                     LSRLRVLAYGVASVNRPQNAKPEQMMARQEGAKTAVLSVPLEQVSRLAMAQQSGRLLL
                     ALRNPQDEAMPSDGMFAEPQPALAARAGVPADAPRAAPDKAMAGVVLSGLAATTGASA
                     PRAPVAAPVPRPLQVAAPPAPALARQSAGVEVIRAGKREIE"
     gene            190405..191844
                     /locus_tag="CNE_RS18955"
                     /old_locus_tag="CNE_2c01700"
     CDS             190405..191844
                     /locus_tag="CNE_RS18955"
                     /old_locus_tag="CNE_2c01700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951884.1"
                     /db_xref="GI:503717808"
                     /translation="MHIQKNQARKYQARKYPHSAALRRRLMQLALAAMLATTAWCALA
                     PRARAQEAVNARQLRLLAGAQKEIRSAQPVERVAVGNPAVADALVLRTRGAPSVLLVA
                     KQPGVTDVMVWTRGGAEPLTYNVQVDAIAPDADGAKLGYSAAGTTITGQSPDAYAAAR
                     AQAAARAATNGKSDGKPGLVVDRSTVPLSGTVQVDVKVVEISKTVLKEVGINFFRNNS
                     GFAFGTFSPSTLNKFTFTPGSGGAPGSFSADIASPMSNAFNLVAASLTHGIFANISLL
                     EANGLVRVLAEPSLVALSGQSASFLAGGEIPIPVPQALGTTTIQFKPFGIGLTVSPTV
                     LSADRIALKVAPEASDLDPSRGISINGAVVPAIVTRRADTTVELGDGESFVIGGLVSR
                     NTVSNVNKVPVLGDLPVIGAFFKNLNFHQEDRELMIVVTPRLVKPLAKGAPAAQAVGA
                     DGRTSGNPNVWGWYVLGEYADPTLPGFSK"
     gene            191891..193132
                     /locus_tag="CNE_RS18960"
                     /old_locus_tag="CNE_2c01710"
     CDS             191891..193132
                     /locus_tag="CNE_RS18960"
                     /old_locus_tag="CNE_2c01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_013951885.1"
                     /db_xref="GI:503717809"
                     /translation="MDYFLLHATQGEVKDWLGRVLGGLGTLVAEGGAQEAFLERAAQL
                     RPGLVFLHFSTELAGASARLGEQLLRLFPGLPLVAVGHADEPGIMLAALRVGVKDFID
                     LRDAPADAEAVVKRLAVPGEQVRPAQSVRQGKIVALLGARPGVGVTSLAVNLAAAARR
                     HLPLNEKTDARAEVLLLDLGLPARDGALYLNLSPGFHFVEAVRNLRRFDQVFVQTALT
                     RHGNGVCVLPLPAALGELRDISYSEASSLLERLRAFFDMQIIDLGGFGNAEFTAQIFK
                     AADSVVLVADQSVGAIVSAAELVHELRAREVERDDLHLLVSRFDARLGVDAAQIAQRV
                     GVQSVGTLPDSRAPLVLAMNRGAVLADDDPHDPYVRALADLLARLGYRAAQARETSLL
                     ARMKDKLPEALRAVRVARTGS"
     gene            193134..194450
                     /locus_tag="CNE_RS18965"
                     /old_locus_tag="CNE_2c01720"
     CDS             193134..194450
                     /locus_tag="CNE_RS18965"
                     /old_locus_tag="CNE_2c01720"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaF"
                     /protein_id="WP_013951886.1"
                     /db_xref="GI:503717810"
                     /translation="MTQAIEFSDNTPAPFPVSQEFQNIKEAAHEHLLTRIEELGAEFG
                     RWSRTAIQRFVDLELESFTRLRRIPINEAELRQIAEALTKELAGFGPIEDLLNDPAVE
                     DILVNGHLDVYVSRHGVLERIPVRFTDSGHLLRIVRRILAPIGRRLDESNPMVDARLP
                     DGGRINVVIPPLALEGPVVSIRKFRKDPMTPADLQALGTMSPEICDLLQAAVQARCNI
                     LVSGGTSSGKTSLLNALATFVPTTERVITIEDTAELALNHPHVVRLESRPGGFEGTGA
                     VSIRDLLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRL
                     EMLAGFAGFQGSEASLRRQIANAIDFIVQIARLSNGKRRIVSITEITGLGDNIISTQE
                     LYRHEPFMNPDGTETDRWLSLGLLPHSPKLARMRGQGFMLDDRFDV"
     gene            194443..195369
                     /locus_tag="CNE_RS18970"
                     /old_locus_tag="CNE_2c01730"
     CDS             194443..195369
                     /locus_tag="CNE_RS18970"
                     /old_locus_tag="CNE_2c01730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951887.1"
                     /db_xref="GI:503717811"
                     /translation="MSSATLLLAAMALVITGLGLLLLASAQARARREQQQAFLQAQTE
                     QVRLRYAQAPDPALQAPARDLRRRWDDFLRRADLAPTRRTAIVWITPVVLCTLAGAVA
                     GQWLGAVSALIVALAVAAFAAWNRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQ
                     NSIANTEAPLRQCLVQAIHLQRAGKELDQAVLQVGRVYKVEELVLVASVLRLSVRYGG
                     RADVVMERTAAFMRDREQAQRELMALSAETRLSAWILGLLPLVVAGGLFMLNAGYIMM
                     MWKDPTGKSMLLSALALEIAGAFMLYRLAKSI"
     gene            195401..196447
                     /locus_tag="CNE_RS18975"
                     /old_locus_tag="CNE_2c01740"
     CDS             195401..196447
                     /locus_tag="CNE_RS18975"
                     /old_locus_tag="CNE_2c01740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadC"
                     /protein_id="WP_013951888.1"
                     /db_xref="GI:503717812"
                     /translation="MDRLTLISLSLLVAACGVGVLTLPLLRDWRQRRLAARTIDGALA
                     RQRAAEAAQAAHAAQAAAPAAPGAQAAAKAGAAAPQGRGGAATAIGVQLGARVGERIS
                     AHWLDSRLGRAVVTPEDQQLLEQCGWYGPQSRMLFGVLRLGLPLALALAAMLWQVGAG
                     AFAIVAWGFGTFALAYLAPKWHLRRRAAARLRMVDDELPVLIDMLRLLQGVGLSIDQS
                     LQVIVAEFGSMLRVLGPELARANQQFASGRSREQTLLRIGRLFDSEDLKSLITLLTQV
                     DKHGGAVQEPLRQFGLRMQEARKSRMKDEIGRLTVKMTAVMVVSLLPVLLILTAGPGF
                     LGVIRMLAHMGGTR"
     gene            196444..197307
                     /locus_tag="CNE_RS18980"
                     /old_locus_tag="CNE_2c01750"
     CDS             196444..197307
                     /locus_tag="CNE_RS18980"
                     /old_locus_tag="CNE_2c01750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadD"
                     /protein_id="WP_013951889.1"
                     /db_xref="GI:503717813"
                     /translation="MTRSVGPALGRISKTAACLLLAALSGCAANQNGAAAMHEQAEAQ
                     VELAKLRDKTARAEYSEQAVYLGLIRKMQQDGLYFASLAHIEVYVKRFGAGPEIQAMR
                     ADALRETGQDKAATDAYQQLAATSQGEQAAHAHHGLGLLAGRQDDFARAVTELRQAAA
                     LDPVNPRISGDLGYALMRAGALQDARVPVMQALELDAHNPRVISNAVVWLMADGKRAQ
                     ANAMMQKAALPEATRSAIRKEADRIARATAARDRAAARPAPAVRAPSKPATTAPATSV
                     AAVAATAGATP"
     gene            197304..197651
                     /locus_tag="CNE_RS18985"
                     /old_locus_tag="CNE_2c01760"
     CDS             197304..197651
                     /locus_tag="CNE_RS18985"
                     /old_locus_tag="CNE_2c01760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951890.1"
                     /db_xref="GI:503717814"
                     /translation="MTAIFRIAIPALCLLMLALAAQAQTDRATTEAATTGMPAGSPAQ
                     REIGADTRAILAIQREGTQAGPMLPMHGEQAALGYERYMNSFRFALPEFYTGQANAST
                     ARSGSAGQMLGGK"
     gene            197648..199336
                     /locus_tag="CNE_RS18990"
                     /old_locus_tag="CNE_2c01770"
     CDS             197648..199336
                     /locus_tag="CNE_RS18990"
                     /old_locus_tag="CNE_2c01770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951891.1"
                     /db_xref="GI:503717815"
                     /translation="MSLRQPRLRRAPRSARGAISVMAALLIATVAIAALVSIDVGHVF
                     MRQRQLQNMVDLAAMSAAQQLKRADSAANLNAAVLGTVRNIGAKNGYPSGIAMGCGDA
                     TGGSADAMTACLGVWDPASGGPRHFSAAYNPAQVSPNAVRVQATQTVPILFVINGGGG
                     RQLFAESIASGSPPVAAFSLATGLLDVSTANSMLSVLLGNTVSLSLVDWQGLVNTNVT
                     LDQLRLKADVGTVDQLLNTSLNLRDFYALVLGAAGRDALLTTMLGSPPTALGASGAAA
                     TVSLARLLDLGVMAPAASSAVEVGLNVAQLLLASAQVARGDTAVALPLNIPKLPLGLG
                     GISANLRVIEPPVTAAGPARQLSSNPDTWQTTASASQVKLTLMLQITANILKPVLDAN
                     LNVPLYLDVANATADLTKLQCAANPGDRRATMHVKSGLVTACLTDGCTSSDVVLGQAK
                     LGLFDIADVIATDVPRYGSTAGQEVTLAPGGHAQVGTADPFGGLFSQVLALKVRTKLL
                     GILSVPIDLGPLLAPVGAALDALVPPLLNSLGIQLGTADLWVHSIDCNNAELVY"
     gene            199375..200739
                     /locus_tag="CNE_RS18995"
                     /old_locus_tag="CNE_2c01780"
     CDS             199375..200739
                     /locus_tag="CNE_RS18995"
                     /old_locus_tag="CNE_2c01780"
                     /EC_number="3.6.1.-"
                     /function="Transcription / Signal transduction mechanisms"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_011616405.1"
                     /db_xref="GI:499935671"
                     /translation="MKTDRWAYENLEVYVWEGKYEIADRVTRFLAPLGVDVIRAGALE
                     ALPAEPRLKPCIAVISVSVIGAARFSLDWEAAHGMPVIWVAGPGREADPGRFPPEYAH
                     ILADDFTGADLRSQIGKLLPQLLATDAPGEREADLVAGSPAMRQLLQHVETFADFGSN
                     VMLYGETGAGKERIARLFHERNGTYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGA
                     SFAHRGYFEQANGGTLFLDEIGDLPLFQQVKLLRVLEENVITRLGSTLAVKLDFRLVA
                     ATNKDLRDAVRQGRFRADLFFRLAVIEMRIPSLEERGQADKVALLQSFLRHMLGESGF
                     DALPPMPDWLKGAVGTAYFTGNVRELRNLAERVGITVQQTGHWDEERIRPLFRSLHPG
                     AFDGGERNDLRADTEERRRILAALDANGWRRQDTAASLGISRKVLWEKMRKYQIADSE
                     AEPV"
     gene            complement(200755..201111)
                     /locus_tag="CNE_RS19000"
                     /old_locus_tag="CNE_2c01790"
     CDS             complement(200755..201111)
                     /locus_tag="CNE_RS19000"
                     /old_locus_tag="CNE_2c01790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951892.1"
                     /db_xref="GI:503717816"
                     /translation="MKRILTATALTLALGLAATGASAQYTGPSAIPAMTVKALQAEGK
                     DDQHAMLRGKIVSNVGHEHYLFSDGTGQMKVKVKARLWPAQKPVDAQTTVELVGEYDK
                     ELIGESHFDVKEIRLQ"
     gene            201250..202398
                     /locus_tag="CNE_RS19005"
                     /old_locus_tag="CNE_2c01800"
     CDS             201250..202398
                     /locus_tag="CNE_RS19005"
                     /old_locus_tag="CNE_2c01800"
                     /EC_number="3.1.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_013951893.1"
                     /db_xref="GI:503717817"
                     /translation="MRFLHTADWHLGRLFHARSLLEDQAHILDQFVELVRTERPDAVL
                     IAGDVYDRAVPPPEAVALLDDVLGRIVIDTGVPVVMIAGNHDSAQRLEFGARLMRAQG
                     LHVAGRTLAEAACVTLHDAHGEVRIYALPYAEPAVVRDAMGTDLPSHEAALRAQLDAI
                     RAVHPPGVRAVVVGHAFVVGGAASESERPLSVGGSGAVAADLFAGFDLVALGHLHRPQ
                     TLGGGRVHYAGSLLKYSLSECAHDKSVSSIELGADGAVTITPVALQALRDVRVVEGEL
                     AQVLAAGADDPQRDDYIHARLTDTGALLDPMARLRQVYPNALAIERTVLARTGTASEA
                     GRKLRQLGTGELFANFFREVADAELEPDQRAVLDQVLTGIAAADRESA"
     gene            202395..205457
                     /locus_tag="CNE_RS19010"
                     /old_locus_tag="CNE_2c01810"
     CDS             202395..205457
                     /locus_tag="CNE_RS19010"
                     /old_locus_tag="CNE_2c01810"
                     /EC_number="3.1.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease"
                     /protein_id="WP_013951894.1"
                     /db_xref="GI:503717818"
                     /translation="MRPLHLTLQAFGPFAATEQVDFTRLGEQAFVLIHGPTGAGKTTL
                     LDAICFALYGDTSGGERSAQAMRSANAAPALRTEVTLEFSLGAQRWRVARSPVQERPK
                     QRGEGWVTEPARAQLDLHDGNDWVSKASQPARVSDAVRDLLGFDSAQFRQVIVLPQGR
                     FRELLTASSQARQAILERLFRTELYRRVEELLKAEAAGIRRDAERIAIQRDEALRQVG
                     VESAQALAEGIEALQAELQALQGQEQGARATLATAQAALGAGEQVAARLQERQLAQAA
                     HAALLARQPAMEDERARLHAAQRAARVRPALQAWQAAQRDQAASAVALTRAGEQAARA
                     AQQATQAAAALQAETARAEARQSAQRRVSQLADMLPRAQQLGAQLAALQAAEARQVAA
                     ATARERAAAQLATRQADAVAAESALAQGQIAAAQAQATALQLAALQERARQLDRHQQA
                     ARALDVANAQAATAAAAEQLALRQREQCRAALAEAEAAWRAGQAARLAATLAAGDACP
                     VCGSTAHPAPAQHVAAPLSDQALEQARHAALEAESHAVRSAGQHQAAQAAIAQARERL
                     DELAQALGEVGDESARKLKAEITALEAALAEGRQAAASLAQCEVAIVSCRTALAAAEA
                     ASRDAAAAAEAAAQALAHCRGEWQAASAQVPEDSRDPVALGEALRQAQAMLAALEQAL
                     AAAQAAERQAAADAAGAQAGLVSAQQAQAQAAHRLAEAESALAQALAQQGFANEPAHA
                     AACLGDDAMQALDATLRAFDTQLATAADRRERAEAAAQTLDAPDLDGLRAARDASTAA
                     VEALVRQQAERGRSRDTLLQCQLRLQQLDAQGRDIEARYAVLGRLAEVANGNNPRRMT
                     FQRFVLATLLDEVLEAASARLLAMSRGRYVLQRVREQADQRSAGGLDIEVFDHDTGAA
                     RPANTLSGGEGFLASLSLALGLADVVQSRAGGIQLDTLFVDEGFGTLDPESLDFAIRT
                     LLDLQQAGRLVGIISHVTELRERIDVRLEVRPGVGGSRVLLTGVATPA"
     gene            complement(205476..205733)
                     /locus_tag="CNE_RS19015"
                     /old_locus_tag="CNE_2c01820"
     CDS             complement(205476..205733)
                     /locus_tag="CNE_RS19015"
                     /old_locus_tag="CNE_2c01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951895.1"
                     /db_xref="GI:503717819"
                     /translation="MATVHVPFTSTPHAAALARILHVTQQAWGLKPRKDRLQSPVPAP
                     AGTDMPSRPPPLSRRARLARAAARAFEAQVMAIRCRQVFVA"
     gene            206216..206878
                     /locus_tag="CNE_RS19020"
                     /old_locus_tag="CNE_2c01830"
     CDS             206216..206878
                     /locus_tag="CNE_RS19020"
                     /old_locus_tag="CNE_2c01830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase"
                     /protein_id="WP_041228515.1"
                     /db_xref="GI:752557283"
                     /translation="MINKLYDTVEAAVAGIHDGATILIGGFGLAGMPAELIDALIEQG
                     ARDLTIVNNNAGNGDTGLAALLKTKRVRKIVCSFPRQADSYVFDSLYHAGEIELELVP
                     QGNLAERIRAAGAGIGGFFTRTAYGTPLAEGKETRIIDGQGYVFETPIHADFALIKAD
                     TADRWGNLTYRKTARNFGPIMAMAANCAIVQVSRVVELGEMDPEHIVTPGLFVKRVVK
                     VA"
     gene            206901..207542
                     /locus_tag="CNE_RS19025"
                     /old_locus_tag="CNE_2c01840"
     CDS             206901..207542
                     /locus_tag="CNE_RS19025"
                     /old_locus_tag="CNE_2c01840"
                     /EC_number="2.8.3.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="WP_013951897.1"
                     /db_xref="GI:503717821"
                     /translation="MQRLTRDQMAARVAKDIPEGAVVNLGIGLPTLVGNHLPADKEIL
                     LHSENGLLGMGSAPAPGEEDGDLINAGKQPVTIKPGGSYFHHADSFAMMRGGHLDFCV
                     LGAFQVSEKGDLANWHTGAPGAIPAVGGAMDLAIGAKQVFVMMEHQTKQGESKIVPQC
                     TYPLTGIGCVTRIYTDLATIDVTADGLVARDLVEGLSFDELQRITGVPLKLAA"
     gene            207583..208785
                     /locus_tag="CNE_RS19030"
                     /old_locus_tag="CNE_2c01850"
     CDS             207583..208785
                     /locus_tag="CNE_RS19030"
                     /old_locus_tag="CNE_2c01850"
                     /EC_number="2.3.1.174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006161349.1"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013951898.1"
                     /db_xref="GI:503717822"
                     /translation="MTEAFICDAIRTPIGRYGGSLSAVRPDDLGAVPLKALMARNPNL
                     DWKAIDDVIYGNANQAGEDNRNVARMSALLAGLPQEVPGATLNRLCGSGMDATGTAAR
                     AIKAGEATLMIAGGVESMSRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGV
                     DSMPETAENVATDYKISREDQDLMALRSQEKASRAQADGTLAQEITPVTIAQKKGDPI
                     VVERDEHPRATSMEALAKLRGVVRPDGTVTAGNASGVNDGACALLLASEAGIKQHGLT
                     PRARIVGMATAGVAPRVMGIGPAPASQKLLKQLGMTMDQIDVIELNEAFAAQGLAVLR
                     ELGVADDDKRVNPNGGAIALGHPLGMSGARLVTTAMYQLHRTGGRFALCTMCIGVGQG
                     IAMVIERV"
     gene            208876..209607
                     /locus_tag="CNE_RS19035"
                     /old_locus_tag="CNE_2c01860"
     CDS             208876..209607
                     /locus_tag="CNE_RS19035"
                     /old_locus_tag="CNE_2c01860"
                     /EC_number="1.1.1.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013951899.1"
                     /db_xref="GI:503717823"
                     /translation="MSLPVATLVTGGSSGIGRAICEMLLADGVTQVVNVDYAEPAWSH
                     PNMTFFQADLTDAEATRAVAAQVTSRFAVTRLVNNAGATRPGTADTATVADLDYVTGL
                     HLQATLLLTQACLPAMRAAGFGRIVNMASRAALGKAERVVYSATKAGLIGMTRTLAME
                     LGGDGVTVNAVAPGPIATELFRKSNPEGAEQTRRILASITVKRMGTPEDVARAALFFL
                     SPDSGFVTGQVLYVCGGTTLGVAPV"
     gene            209812..210819
                     /locus_tag="CNE_RS19040"
                     /old_locus_tag="CNE_2c01870"
     CDS             209812..210819
                     /locus_tag="CNE_RS19040"
                     /old_locus_tag="CNE_2c01870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951900.1"
                     /db_xref="GI:503717824"
                     /translation="MRQDSQTSTTRRRLLAAGVALATTIAGFAGAAHAQGGYPTKPIT
                     LIVPFSAGGTTDILARIVGLQLGKALGQPVVIDNRPGAGGNIGASLAAKAPGDGYTLF
                     MGTIGTHAINQSLYSKLPYDPVKDFAPITRVAMVPNLVVVNPKVPVNNVKELITYVKA
                     NPDKLSYGSSGSGSSMHLSGELFNSMTGLHIQHIPYKGSAPAVNDLLGNQIGLMFDNM
                     PSSYPHVKAGKLRAIAVTSAKRSPALPNVPTVAESGVPGYEATSWFALYATGGTPQPI
                     VDRLNAEVVKILAMPEVKKQMADQGAEPNPEKPAQLAAFMKSETAKWAKVVKASGATV
                     D"
     gene            complement(210920..212119)
                     /gene="tcuB"
                     /locus_tag="CNE_RS19045"
                     /old_locus_tag="CNE_2c01880"
     CDS             complement(210920..212119)
                     /gene="tcuB"
                     /locus_tag="CNE_RS19045"
                     /old_locus_tag="CNE_2c01880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312848.1"
                     /note="with CitA (TcuA) catalyzes the oxidation of
                     tricarballylate to cis-aconitate; originally thought to be
                     involved in citrate utilization; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate utilization protein B"
                     /protein_id="WP_013951901.1"
                     /db_xref="GI:503717825"
                     /translation="MQKLEALAREAAQLAGQDAATPAPQSRIIRVLPLTDNEAEVARQ
                     MQICNACRYCEGFCAVFPAMTRRLEFGKADVNYLANLCHNCGACYHACQYAPPHDFGV
                     NVPQAMAKVRLETYSEYAWPAPLGKLYQRNGLTVSVALAFGLALFLVLAATLGGALWQ
                     THARGNFYAVFPHNTLAALFGGVFAFAVLALGLGVRRFWRDVSAGTASAPAVAEAARN
                     VLALTYLDGGHGDGCNEASDRFTLARRRFHHFTFYGFMLCFASTVVATGYHYLLGWHA
                     PYPVMSLPVLLGTAGGVGLLVGPAGLMWLNLRRHPMHGDARQRPMDRGFIALLLLTSA
                     TGLGLLAGRGTAAMPLLLAVHLGVVMALFATLPYGKFAHGIYRSAALLKAAIEKRQKN
                     KLQLGSD"
     gene            complement(212106..213515)
                     /locus_tag="CNE_RS19050"
                     /old_locus_tag="CNE_2c01890"
     CDS             complement(212106..213515)
                     /locus_tag="CNE_RS19050"
                     /old_locus_tag="CNE_2c01890"
                     /EC_number="1.3.99.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616411.1"
                     /note="catalyzes the oxidation of tricarballylate to
                     cis-aconitate; FAD-dependent; required for the utilization
                     of tricarballylate as a carbon and energy source by S.
                     enterica; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate dehydrogenase"
                     /protein_id="WP_013951902.1"
                     /db_xref="GI:503717826"
                     /translation="MVDVLVIGGGNAALCAALMAREAGASVLLLESAPRAWRGGNSQH
                     TRNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTGGITDENLARLVIRASSTCRPWMRRH
                     GVRFQPPLSGALHVARTNAFFMGGGKALVNAYYRSAEAMGVQVRYETPVDTIELDGDR
                     FVAARSGSQRFTARTCVLAAGGFESNREWLREAWGQNERGEWPADNFLIRGTRFNQGV
                     LLRHMIDAGADTIGDPSQSHCVAIDARAPLYDGGICTRIDCVSLGIVVNCDAVRFYDE
                     GEDFWPKRYAIWGRLVAQQPGQIGYSIIDSQAIGRFMPPVFPGEKADTLPELARKLGL
                     PEAQFVRTVQDHNAACRVGTFDHTALDDCHTEGLAPAKTHWARPLDQAPFYGYALRPG
                     ITFTYLGLKVNDCAQVHFGGKPSGNLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIA
                     GTQAALAAGINTGAVHAEA"
     gene            complement(213627..214553)
                     /locus_tag="CNE_RS19055"
                     /old_locus_tag="CNE_2c01900"
     CDS             complement(213627..214553)
                     /locus_tag="CNE_RS19055"
                     /old_locus_tag="CNE_2c01900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951903.1"
                     /db_xref="GI:503717827"
                     /translation="MELRQLRYFVSVIEHGSMGKAALELGVVTSALSQQISRLESELS
                     TRLLQRTSTGVVATDAGLAFWRQAQLALRHIDDAALAARQARLSGHVSVGLPPSTAAV
                     LALPFMQAMRERYPDVRLRMVESLSGYLGTMLSARQIDLAVLFSEEPAQRWSVLPLLD
                     ERLFVIGAEGLAGMPRGEQTSVAALGKLPLILPSGSHGLRALVAACFRQAKREPQVVA
                     EIDGLAILMDAVRGGLGATIQPGAALARSHGTPYRSILVTDDGATRPNLLVSLSDDEL
                     SPAGLAARVVLADVATTLVREGRWPGATLRPR"
     gene            214753..215739
                     /locus_tag="CNE_RS19060"
                     /old_locus_tag="CNE_2c01910"
     CDS             214753..215739
                     /locus_tag="CNE_RS19060"
                     /old_locus_tag="CNE_2c01910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951904.1"
                     /db_xref="GI:503717828"
                     /translation="MTTVSRMRRAVVAGLAGTAVLGAPAAFAADNWPTKPITLVVPFA
                     SGGTTDILARTIGQKLGEALQQPVVVDNRPGAGGTLGAANVARAPADGYTFLLATVAH
                     TMAPAIHKSLPYEFTRDLDPVGLVALTPNVLVVNPAIPVKSVSDLIAYIKAHPGKVNY
                     GSAGIGSTEHLSGELFRALTGTDIAHVPYKGGAPMMTDLIAGQIQMAIETSPSASQHV
                     RSGKVRALAVTTAKRSAAYPGVPTLAESGVRGYEVTTWFALMAPRGTPAAIEQRVSAE
                     LGKLLKAPEVQKRFDEQGVTAGDMTPTQLAAFIRAETDKWAKVARDSGAKAE"
     gene            215892..217070
                     /locus_tag="CNE_RS19065"
                     /old_locus_tag="CNE_2c01920"
     CDS             215892..217070
                     /locus_tag="CNE_RS19065"
                     /old_locus_tag="CNE_2c01920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228516.1"
                     /db_xref="GI:752557284"
                     /translation="MHDLSFVHADAAHVEWQVALADCQRQLDTQDFLRQAKADNAPPL
                     TLGWCYLSDYYALAAEAILAALQQNWPGVSWVGTVGLGVSASGKEYFDEPAMVLMAAP
                     FPRDAFQLFSGRQPLPSASSGFVPHTALVHAEGSTPDVQDLLHELSARTATGYLFGGL
                     SSARNRTLHIADGVFSGGLSGVLFGPEIELVSRVTQGCQPIGPVRAVTRSDHNLLFEL
                     DGKPALDCILHDLGVERDAQVETMAEALSGTLAGLNSAADDAPVLPGRFGSDTLVRHL
                     IGLDVQHRMLALADMVEPGMRLAFCMRNADAARADLVRVATEIRTEIERGGSRARGAL
                     YISCSGRGGPHFGAPHAELQTVRRALGDLPLAGFFAGGEIARDHLYGYTGVLTVFTGH
                     "
     gene            complement(217072..218118)
                     /locus_tag="CNE_RS19070"
                     /old_locus_tag="CNE_2c01930"
     CDS             complement(217072..218118)
                     /locus_tag="CNE_RS19070"
                     /old_locus_tag="CNE_2c01930"
                     /EC_number="2.5.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="farnesyl-diphosphate farnesyltransferase"
                     /protein_id="WP_013951906.1"
                     /db_xref="GI:503717830"
                     /translation="MRDPSRAFLLGPLLKGVSRSFYLTLRVLPVHMRDPVGLAYLLAR
                     AADTIADTSLIPPQRRLTLLLSLRDQVNGATADSALADSIATEVAGRQEQSDERILLQ
                     SLGPALALLAQLEPDDQQAVRQIVSTLTEGMEFDLRTFPDEHAGRIVALGEPEALDRY
                     TYLVAGCVGEFWTSMTAAHVPGAIRVPDAMLRRGVRFGKALQMTNVLRDCGKDLRIGR
                     CYLPATMLHQHGLSPQDLLLPDASLRARALMLELVHDTLDHFHEAMAYTLAIPPHFIR
                     LRLACLWPVLIGMETLLLLVRNDDWLDPAKTSRLQRSKVYRIIACSLPMVPSNSLLRI
                     WFARQMRNIDAVIR"
     gene            complement(218230..218886)
                     /locus_tag="CNE_RS19075"
                     /old_locus_tag="CNE_2c01940"
     CDS             complement(218230..218886)
                     /locus_tag="CNE_RS19075"
                     /old_locus_tag="CNE_2c01940"
                     /EC_number="3.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_013951907.1"
                     /db_xref="GI:503717831"
                     /translation="MRSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRL
                     SPRNRYVAAELNRCGMATLLMDLLLPEEDQVQAIRFDVELLATRLAQATSWVARQQAV
                     PQRFGYFGASVGGAASIRAACQSPIPIHAVVSRGGRVDLAGPDALAKLLAPTMLIIGG
                     LDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALESVARLAAQWFERYLGKDSP
                     "
     gene            219044..219529
                     /locus_tag="CNE_RS19080"
                     /old_locus_tag="CNE_2c01950"
     CDS             219044..219529
                     /locus_tag="CNE_RS19080"
                     /old_locus_tag="CNE_2c01950"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase"
                     /protein_id="WP_013951908.1"
                     /db_xref="GI:503717832"
                     /translation="MKTLFLVRHAKSSKDDPSLPDRERPLNDRGRQDAPEMGKRLAER
                     KLKPDLLLSSPALRALTTAQLIADELGYARKDIALDDQLYATSAEELLAVVRALDKKL
                     DCVMLFGHNPEFTDFAHRLSDEITDMPTCAVARFSFDTKAWEDVGEITPSKVTLESPK
                     E"
     gene            219655..220581
                     /locus_tag="CNE_RS19085"
                     /old_locus_tag="CNE_2c01960"
     CDS             219655..220581
                     /locus_tag="CNE_RS19085"
                     /old_locus_tag="CNE_2c01960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951909.1"
                     /db_xref="GI:503717833"
                     /translation="MIPPVSTLHGRLKMQHLRLLLAVEERGSLRQAAEALTLTQPAVS
                     KMLQDMEDLLGVPLFERHARGLRATRFGLAATRYARLVFADMGGLRDELVALESGKIG
                     RVRVGAVMAPTPGLLADVIRRLNRDHPRLEVAVHVETSDVLMPQLERDQLDIVLGRVP
                     DGWDSSGLEFEQLGDEGLAIVVGPQHPLARRRKLSFEELTGYPWIMQPRPSPMRALID
                     RSFEDAGVPAPPSTIETAAVLMTTSLLADSELIAVLPESVAAYYGRLGALAVLPLPLP
                     RKLGPYGIVTRRGRPPTASMSLLIDALRALSR"
     gene            complement(220585..222168)
                     /locus_tag="CNE_RS19090"
                     /old_locus_tag="CNE_2c01970"
     CDS             complement(220585..222168)
                     /locus_tag="CNE_RS19090"
                     /old_locus_tag="CNE_2c01970"
                     /EC_number="1.2.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dioxovalerate dehydrogenase"
                     /protein_id="WP_013951910.1"
                     /db_xref="GI:503717834"
                     /translation="MTLSGELLIGRRAERGGNGTIRAIDAATGATLEPAFGGATAAQL
                     DRACALAWQAFDAYRETAPERRADFLEAIAANILALGDALIERCTSESGLPRARIEGE
                     RGRTVGQLRMFASLLRQGDFLELRVDPAQPERKPLPRVDLRLRHIPLGPVAVFGASNF
                     PLAFSVAGGDTASALAAGCPVVVKAHPAHPGTSELVGRAIRKAVDDMDLPEGTFSLLF
                     DAGLKVGQGLVADPRIKAVGFTGSRAGGMALMAIAAARSEPIPVFAEMSSINPVLLFP
                     HALANRAEAIGTAFADSLTLGAGQFCTNPGLVLAVAGDDLDRFLHAAAARLGVLPAAT
                     MLTPGIHRAYCAGVDTLASHAQVQTVARGAAGSAAQGQAALFATDAGAFLADEALRHE
                     VFGAASLVVRCRDLTEMRRVIDALEGQLTAALHIDDADHDAARTLLPALERLAGRILV
                     NGFGTGVEVGHAMVHGGPWPATSDGRSTSVGSLAIARFLRPVSYQDMPPGLLPASLRP
                     DSPQRHAWRLDGKLQGMPG"
     gene            complement(222189..223121)
                     /locus_tag="CNE_RS19095"
                     /old_locus_tag="CNE_2c01980"
     CDS             complement(222189..223121)
                     /locus_tag="CNE_RS19095"
                     /old_locus_tag="CNE_2c01980"
                     /EC_number="4.2.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcdA"
                     /protein_id="WP_013951911.1"
                     /db_xref="GI:503717835"
                     /translation="MTRTPSPNVYRGVFPVAPTIFDAQGGLDLDGQRRCIDFMIDAGS
                     HGICILANFSEQFVLSDDERNVLMKTVLEHVDGRVPVIVTTTHFSSRLCAERSRAAQD
                     AGAAMVMVMPPYHGATIRVPERSIYEFFATVSDAIDIPIMIQDAPVSGTILSAPFLAR
                     MAREIGNVSYFKIEVPQAAAKLRELIELGGDAIVGPWDGEEAITLMADLEAGATGAMT
                     GAGFPDGIRQILDAWQAGDAELAAQRYQQWLPLINYENRQGWLATSKVLMQAGGVIAS
                     DAVRHPLQPMHPATREGLLKIARRLDPLVLRWAR"
     gene            223234..224190
                     /locus_tag="CNE_RS19100"
                     /old_locus_tag="CNE_2c01990"
     CDS             223234..224190
                     /locus_tag="CNE_RS19100"
                     /old_locus_tag="CNE_2c01990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951912.1"
                     /db_xref="GI:503717836"
                     /translation="MKSTLDTLTGRLRMKQLQLLIALDEHSSLHQAAAAMAMTQSAAS
                     KSLQELESMLEAPLFERSKRGMRPNAFGHCVIRHARQLVADLGAMCEEVAGIRAGSGG
                     RVAIGVIMGAVPEVLVPALAQLREAQPELALEIIEDTSLRLLGLLDDGHLDLVIGRSL
                     VSDEPARYHYHPLGDEQVAVVAGHAHPAPRARAMGFADLAGYRWITYAGHMPMHALLQ
                     RELDLAGMSFPANAISTSSALVTVAMLQGDPGLVSLLPTGVAAMFERQKMLRILPVRL
                     QSRQQTFGIVTRRGGTLSASARQLVAILKALPRTAQQAAAEV"
     gene            224300..225268
                     /locus_tag="CNE_RS19105"
                     /old_locus_tag="CNE_2c02000"
     CDS             224300..225268
                     /locus_tag="CNE_RS19105"
                     /old_locus_tag="CNE_2c02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013951913.1"
                     /db_xref="GI:503717837"
                     /translation="MKTWIAGALAGLVTVAAVTGNAWAQDTRPVRLMVGAAPGGGTDV
                     MARIVSDKLAAQLKQPVVVDNRPGASNTIAADLTAKAAPDGNTLLMGVVTSQAIAPHL
                     LKLQFDPLKDLAPVALVSSVPNVLVVNNQVQARDVKALVAQIQANPDKFRYSSSGVGS
                     TQHLAGASFARQIKGKLLHVPYKSSSSALVDLMGGQVDMSFETMPSVISHIKAGKLHA
                     LAVTADQRSALLPNVPTLAEAGVPGIQMSAWYGVYAPAGTPPATLQKLSSALATVIKD
                     PDTVRRLADVGAVPGALTAAQFDAFSRAEYVRYGKLIAELGVKLDQ"
     gene            225284..226300
                     /locus_tag="CNE_RS19110"
                     /old_locus_tag="CNE_2c02010"
     CDS             225284..226300
                     /locus_tag="CNE_RS19110"
                     /old_locus_tag="CNE_2c02010"
                     /EC_number="1.1.1.262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_013951914.1"
                     /db_xref="GI:503717838"
                     /translation="MNSRPRIAMVLGDPAGIGPELIARLLADPATAAQAEILLIADRD
                     EWRHGMRIAGVELALAETDAPAFADDGKPRLYHWQLPERPTFARGEASAEGGRYSLGT
                     LALALQLAQAGQADAILFGPLNKSSLHAAGMAHSDELHWFAEQLGYHGNFCEFNVLDG
                     LWTSRVTSHVALKDVPAMITQERVGGAIDLIDHALRRAGMARPRIAVCGLNPHNGDNG
                     AFGREEIDVIAPAVAAARERGVAADGPFPADTIFLKVQGGPSQRQFDAIVTMYHDQGQ
                     IGIKLMGFSRGVTVQGGLPVPITTPAHGTAFDITQQGRADPGATLQAFQIACRMGAQR
                     RAAP"
     gene            226391..227566
                     /locus_tag="CNE_RS19115"
                     /old_locus_tag="CNE_2c02020"
     CDS             226391..227566
                     /locus_tag="CNE_RS19115"
                     /old_locus_tag="CNE_2c02020"
                     /EC_number="4.2.1.90"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose 1-epimerase"
                     /protein_id="WP_013951915.1"
                     /db_xref="GI:503717839"
                     /translation="MKITNVRARVFEWKGKTVPPQAHFCTNATDILFERGDAMGSFRF
                     HGWLVVEVETDTGLVGIGNCALAPRVAKEIVDQYLAPVVIGQDPFDNEYLWQKMYRRT
                     HAWGRKGIGMAAISAVDIALWDLMGKAVGKPVFKLLGGRTKEKIWCYASKLYNNDDRD
                     AFLAEAQGYLDQGFTAMKMRFGYGPKDGPAGMQKNIEQVRLLRELVGDGVDIMLECYM
                     GWTLEYARRMLPRLAEFNPRWLEEPVIADDIEGYAELKKASPFPISGGEHEFTSYGFK
                     DLLERRAVDVIQYDTNRVGGITAAQKINAMAEAWSVPVIPHAGQMHNYHLTMASTASP
                     MSEYFPVHDVEVGNELFYYIFKGDPAPDNGYLQLDDNLPGLGLELNEEYFSQFNIIG"
     gene            227642..228955
                     /locus_tag="CNE_RS19120"
                     /old_locus_tag="CNE_2c02030"
     CDS             227642..228955
                     /locus_tag="CNE_RS19120"
                     /old_locus_tag="CNE_2c02030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013951916.1"
                     /db_xref="GI:503717840"
                     /translation="MTTSVTPEAAASPPAAIASAEAPSRVRWRIFAVVFVLVVMNLLD
                     RISLSIAMPTIGKEFGLSPTMQGLVLSSFFWSYALLQVPGGWLIDRFGPRKVITGSTA
                     LWGAFQALAAFATGGISLMATRMALGAAEAPLFPAGAKLNALWLSSGERSRGAVLVDA
                     GSPLGAAIGGIVISYLIVAFGSWRTAFFIAGAVTVVMSWVSWRYLRDQPSQHPGVNDG
                     ELAHIRATAGNAAAAAQDRRIAPRSWCGLTIGRACWAMVFFGLLTWGPNYLAHARGFD
                     LKQIGMAMFFIFLSGAVGSLASGFGADALMRRLPRALVLKGMLTVSGLVICAVFLLLP
                     RIDDPVEAVVLLCLAAFITMWGSLYWSLPAILAPAHRVGIVGATMNLAGSLGGIVVPI
                     LVGLILQHLGSYQTVLHFFAGCAVVFVACTLLIDLGSGKLNKELR"
     gene            228952..229890
                     /locus_tag="CNE_RS19125"
                     /old_locus_tag="CNE_2c02040"
     CDS             228952..229890
                     /locus_tag="CNE_RS19125"
                     /old_locus_tag="CNE_2c02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_013951917.1"
                     /db_xref="GI:503717841"
                     /translation="MNASTRYDGPIVDAHHHFWDPVTNYHPWLSDPGLIPFRYGDYSA
                     LKRRYYPADYFADAGGHDVRKTVYVETEWDPCDPIGETAFISRVAAEHGTPHAVVAQA
                     WLHHDDAADVLARQAEFPLVRSVRHKPGGAPDALSAARMPSLMEDERWRRGFAELGRH
                     GLHFDLQVPWWHAQEAVRLARDFPATTIILNHAGLPADRSPAALAAWEDAMAMLAECP
                     NVVIKVSGLGQAGQPWTAAANARIVLACIRLFSPARVMFASNFPVDGLCASFDQIFSG
                     FKVITAGFTPAEQRAMFHDNACRIYSLAADTAVPQG"
     gene            complement(229881..230858)
                     /locus_tag="CNE_RS19130"
                     /old_locus_tag="CNE_2c02050"
     CDS             complement(229881..230858)
                     /locus_tag="CNE_RS19130"
                     /old_locus_tag="CNE_2c02050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228517.1"
                     /db_xref="GI:752557285"
                     /translation="MQAPANSPAPDAAPLWQSHTRLKSRQLLLLLAVADEGSIHRAAE
                     RLAMTQPAASKLLRELEEMLSVLLFERLPRGMAPTDYGRAMIRHARAVIGSLNQAREE
                     VLALKAGRLGHVAIGAITSPGVRLLPPAIAQIKARYPGLRVSVEIDNSNVLLDRLGQE
                     KLHMVVARLFPEHDKGRLRYEPLSEEPVCAVVRPGHPMLSAQGLSLADTTEAAWLIPP
                     AGTVLRHRFELMFQRASLAPPVNVVETAALLFLTRMVTQSDMIAVLTADVAQYYAAFG
                     MVEILPMEMPCHMDDFGLITPTDRLMSPGALLVADALRESGQQIYGAQP"
     gene            231070..232815
                     /locus_tag="CNE_RS19135"
                     /old_locus_tag="CNE_2c02060"
     CDS             231070..232815
                     /locus_tag="CNE_RS19135"
                     /old_locus_tag="CNE_2c02060"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018004738.1"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_013951919.1"
                     /db_xref="GI:503717843"
                     /translation="MSDSKDKQRKPLRSTAWFGSADKNGFMYRSWMKNQGIPDHAFDG
                     RPVIGICNTWSELTPCNAHFRKLAEHVKRGVYEAGGFPIEFPVFSNGESNLRPTAMLT
                     RNLAAMDVEEAIRGNPIDAVVLLTGCDKTTPALLMGAASCDVPAIVVTGGPMLNGKLD
                     GKDIGSGTAVWQLHESLKAGEINLHQFLSAEAGMSRSAGTCNTMGTASTMACMAEALG
                     TSLPHNAAIPAVDSRRYVLAHMSGIRIVEMAREDLTLSRILTRQAFENAIRVNAAIGG
                     STNAVIHLKAIAGRIGVPLELEDWSKVGRDTPTIVDLMPSGRFLMEEFYYAGGLPAVL
                     RRMGEAGLLPHPGALTVNGKAIWDNVRDAPITNDEVIRPLDQPLIRDGSIRILRGNLS
                     PRGAVLKPSAATPRLLRHRGRAVVFENLEHYKERIVDEALDVDENSVLVLKRCGPRGY
                     PGMAEVGNMGLPPKLLRQGVKDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAIVRD
                     GDWIELDCEAGRLHLDIDEAEFARRMADVQPLEAPADGGYRKLYVNHVLQADEGCDLD
                     FLVGCRGREVPRHSH"
     gene            232883..234226
                     /locus_tag="CNE_RS19140"
                     /old_locus_tag="CNE_2c02070"
     CDS             232883..234226
                     /locus_tag="CNE_RS19140"
                     /old_locus_tag="CNE_2c02070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951920.1"
                     /db_xref="GI:503717844"
                     /translation="MHGTQTAPMERAAPTQGEDSQAIEESRIIGMLVRRLIPFLALIY
                     VVAYIDRSVVGFAKLHMNAAIGISDAAYGLGAGLFFIGYFLCEVPSNLALERFGARRW
                     FARILLTWGVITMAMALTSGPYSFYALRFLLGAAEAGLYPGILYFLTKWFPMRHRARI
                     IGLLVLAQPIALIITGPLAGLVLSTHGLFGMNNWQTLFVLSGLPAVLLCLPTLKLLPE
                     SPASAAWLAPGDRAWIERELAADQAAYALKSYGNPLQALKDKRVLLLSLLFLPFPLSI
                     YGLSLWLPTIIKQFGVTDVMTGMLSAVPYLFAVVGLYLVPRHSDRKRERYGHIVVVSG
                     MAAVTMALSAWVQSPVLQFLFICLTAFSIYSIQAVVWALPGEFLTGASAAVGIATINS
                     LANLGGYFGPYGIGVIKDATGSLAAGLYFLAVMLLFAVLMAFVVRAALRPAAARA"
     gene            complement(234251..234487)
                     /locus_tag="CNE_RS19145"
                     /old_locus_tag="CNE_2c02080"
     CDS             complement(234251..234487)
                     /locus_tag="CNE_RS19145"
                     /old_locus_tag="CNE_2c02080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951921.1"
                     /db_xref="GI:503717845"
                     /translation="MYMVYWSEGDGTGLSPHAQSFPSDAMREALRFTEALRQRQHAGE
                     PVSFVTLCSENPNSVGRAGAADPPPDYEWKKRRP"
     gene            234671..235216
                     /locus_tag="CNE_RS19150"
                     /old_locus_tag="CNE_2c02090"
     CDS             234671..235216
                     /locus_tag="CNE_RS19150"
                     /old_locus_tag="CNE_2c02090"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_013951922.1"
                     /db_xref="GI:503717846"
                     /translation="MSDLALIPATAADAERLAAMHAASWQHTYPGMLPAAYLRDQAYP
                     ERLAAWRARMHDGADGPVEVTLAMVDGEAAGFACLLPEAEPRFGIYLDNLHVLPAFHG
                     QGLGKRLLAHCAQRVAARWPGRPLFLYVLEANTQAREFYQRLGGEESEAFEDDFHGPD
                     LRVMVRRVTWPDVAALVRRLG"
     gene            235276..236421
                     /locus_tag="CNE_RS19155"
                     /old_locus_tag="CNE_2c02100"
     CDS             235276..236421
                     /locus_tag="CNE_RS19155"
                     /old_locus_tag="CNE_2c02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951923.1"
                     /db_xref="GI:503717847"
                     /translation="MLQAIALVVPRKPCRALAGASIAMAVLAGCASAPDTPSAARAIE
                     AAATPAQTKPHWQRVHLGTGAGYDFPVYANHQLDADLSRIREVVFVQHGLQRNGDDYY
                     AAGAALLKASGRNPDEVLLVAPNFPGTPDHGKGFDGMPQWSVQGWMSGQNAVNSPFTV
                     SSLQVLDDLMAFVTDKARLPQVARVTVAGHSGGAQIVHRYAVLNNVDERIRARGIDLR
                     YVVANPSSYLYFTPVRPAGADGRSFAPYDKAACPDYDKYRYGMQDIVPYAKGANGPSL
                     YQRYAGRQVTYLAGTEDNDPNHRVLDKACGAEAEGPTRLQRARGYLRYERYLASPGLV
                     IRHQAYEVVGVGHDQARMFGSQCGARAVFGMAETANPDGAACLAPQL"
     gene            complement(236525..236752)
                     /locus_tag="CNE_RS19160"
                     /old_locus_tag="CNE_2c02110"
     CDS             complement(236525..236752)
                     /locus_tag="CNE_RS19160"
                     /old_locus_tag="CNE_2c02110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951924.1"
                     /db_xref="GI:503717848"
                     /translation="MTGRILLAEERDVAWEADAGELPFGILPPMRDKAPIYYRLPDTP
                     DGHHIKEYASGLRQLVRFVGVEEQVVKFSLG"
     gene            237092..237640
                     /locus_tag="CNE_RS19165"
                     /old_locus_tag="CNE_2c02120"
     CDS             237092..237640
                     /locus_tag="CNE_RS19165"
                     /old_locus_tag="CNE_2c02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_013951925.1"
                     /db_xref="GI:503717849"
                     /translation="MSTQHALLISLIEKPSSGYDLARRFDRSIGYFWHATHQQIYREL
                     GRMADSGWIAADEAEAAEGETGAGDRKNRKKVYRVLPAGRDELARWVLTPGASLDQRE
                     EILVKLRADAVIGPLGLGDEMRRLIALHRARLETYLAIERRDFSAPDMDRAQQLRYAL
                     LQRGIRFEQDWVAWGEELLPLL"
     gene            complement(237695..238690)
                     /locus_tag="CNE_RS19170"
                     /old_locus_tag="CNE_2c02130"
     CDS             complement(237695..238690)
                     /locus_tag="CNE_RS19170"
                     /old_locus_tag="CNE_2c02130"
                     /EC_number="1.13.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_013951926.1"
                     /db_xref="GI:503717850"
                     /translation="MALPAQLQNRLSLPVVCSPLFIISNPDLVIAQCKAGVVGSFPAL
                     NARPAPKLEEWLDRITTELAEHDAKHPDRPSAPFAVNQIVHKSNDRLEHDLELCVRYK
                     VPIVITSLGARKEVNDAVHSYGGIVLHDVINNTFARKAIEKGADGLVAVAAGAGGHAG
                     TLSPFALLHEIREWFDGPLLLSGSISSGDAILAAQAAGADLAYIGSAFIATQEANAQD
                     GYKQMIVDSNANDIVYSNLFTGVHGNYLRGSIERAGLDPNALPESDPSKMNFGSTSVK
                     AWKDIWGAGQGVGAIKRVVPAGELVRRFAEEYALARRRLGLGEARQAGTRAVDLA"
     gene            complement(238752..239186)
                     /locus_tag="CNE_RS19175"
                     /old_locus_tag="CNE_2c02140"
     CDS             complement(238752..239186)
                     /locus_tag="CNE_RS19175"
                     /old_locus_tag="CNE_2c02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951927.1"
                     /db_xref="GI:503717851"
                     /translation="MTTTNLIPAAQASLEAWHQMLANGSMAGLDAIVADEVVFRSPVA
                     HTPYPGRAAIGLVLTTVNQVFQDFRYHRSFVSEDGHSVVLEFSAAVDGKALKGIDMIR
                     FDDAGRIAEFEVMVRPRSGLEALAAAMGARLASQRDVLTGTA"
     gene            239410..240432
                     /locus_tag="CNE_RS19180"
                     /old_locus_tag="CNE_2c02150"
     CDS             239410..240432
                     /locus_tag="CNE_RS19180"
                     /old_locus_tag="CNE_2c02150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013951928.1"
                     /db_xref="GI:503717852"
                     /translation="MTTKPSAAHPEQAALFDADLAAWRDHPERAFDGWLARHGFRHGT
                     SVVYRAMWGKLLRWSAERGLPPLSWSAEQIGEFLDAQQLHKSHRYRYTRLIERVFHHL
                     ARLREGMHNPASQAVRAHLADGENDPTAFLLPGERDLLVARILGPAGMLAGDTHTAAS
                     PTQWKRARDAALLAVLLGGGLKVGEARALRVDAIEAGAPGRMALRMVRADNGRAYTVP
                     LFSLAHAPLRAWLALREASGTLGGLVFPAMPSGRPMHAASVYRRVEILLDEAGVLASR
                     SERASPQTLRNTCAAMHFEAGTAPAEVAQCLGMRDLESGWRLRAAYEAWQARAGLVAE
                     APASRA"
     gene            240592..241611
                     /locus_tag="CNE_RS19185"
                     /old_locus_tag="CNE_2c02160"
     CDS             240592..241611
                     /locus_tag="CNE_RS19185"
                     /old_locus_tag="CNE_2c02160"
                     /EC_number="5.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010809858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_013951929.1"
                     /db_xref="GI:503717853"
                     /translation="MPETLLLTGATGYIASHTWVALLNAGYHVIGLDNLCNSSPVVLE
                     RLATITGQTPHFVQGDVRDRALLDRLFAEHRISGVIHFAALKAVGESVSQPLEYYSNN
                     LGGLLTVCAAMGAAGVKQLVFSSSATVYGNPHAVPILEDFPLSATNPYGQTKLMGEQI
                     LRDLETSDPDWRIAYLRYFNPVGAHESGLIGEDPRGIPNNLMPYVAQVAGGRRERLMV
                     FGGDYPTPDGTGVRDYIHVCDLADGHLAALGYLRAQGKSMTVNLGTGRGYSVLEVVQA
                     YQRASGKPVPHDIVARRPGDIASCYADPALANQLLGWRARHDIDRMCEDSWRWQSMNP
                     QGFDA"
     gene            complement(241722..242030)
                     /locus_tag="CNE_RS19190"
                     /old_locus_tag="CNE_2c02170"
     CDS             complement(241722..242030)
                     /locus_tag="CNE_RS19190"
                     /old_locus_tag="CNE_2c02170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008645358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_010809859.1"
                     /db_xref="GI:498509388"
                     /translation="MATYQEIVQKISELQKQAEEIKAREQATVIADIREKIEQYGLTA
                     EDLGFGAKVPAGKKAVNRKVPVRYRDSAGNTWTGRGKRPGWLTQALAQGKAVEDFLIR
                     "
     gene            242558..244264
                     /locus_tag="CNE_RS19195"
                     /old_locus_tag="CNE_2c02180"
     CDS             242558..244264
                     /locus_tag="CNE_RS19195"
                     /old_locus_tag="CNE_2c02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951930.1"
                     /db_xref="GI:503717854"
                     /translation="MSFHNNIQIKTLLRGAMGMLSLLLLLVGGAGLHGISQSNDALRE
                     TYANQLGSTVALSEAMQATTRMRLALDRNVMQGEQDDPKVHVDRSRVFVEASEAAWKR
                     YMSLPQNPEEKALAAELGKQRQVFMEQGVLPLQAASLAGNQEEALRLAKKVLPDLQRS
                     MSGVHEKLQKFQMTAGQANFDAAQASFARIRMLSIVLIVLGLAVAVLCTVTLNRAIVT
                     PVQEALAVFERIARGDLTSRIASVSKNEIGRMMQALAAMQASLSGIVAEVRTGADSMA
                     SATQQISTGNLDLSQRTEEQASSLEQTAASMEELTTVVRQNADNARQAGVLANEASQI
                     ALKGGDVVGRVVDTMNEINGASRKVVEIISVIEGIAFQTNILALNAAVEAARAGEQGR
                     GFAVVAGEVRSLAQRSASAAKEIEALIGESGQRVESGTRLVAEAGQTMGEIVQAVRRV
                     TDIMNEIGAASQEQTSGIEQVNQAVTQMDEVTQQNAALVEEAAAAAGALEVQAQKLKN
                     VVSVFNLGTGTGVGAGAAATAVAGRTARTMSVRPAALPAGRPAARPALAVAGADDDWS
                     AF"
     gene            244378..246348
                     /locus_tag="CNE_RS19200"
                     /old_locus_tag="CNE_2c02190"
     CDS             244378..246348
                     /locus_tag="CNE_RS19200"
                     /old_locus_tag="CNE_2c02190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheX"
                     /protein_id="WP_013951931.1"
                     /db_xref="GI:503717855"
                     /translation="MIALSSVLLLLAALLGVAAALGVRAGRADQSAGGRSLRTLTWSA
                     ALLSQLSVSVPVLVVMLSGSVPAANDTAQMAASFAAAAAATAAAKLLVQWLRQGTRLW
                     RGAAIMAVVAGAGLVAAAGTHLGRACGAGSASARACIDAAGLPHPAWLAGGLTALCAL
                     MFAVHRAQSRGLLPAHHEAGLADELADEAHGLPRGHEPRLARRGARIPGRPGRLTVRA
                     AARGQGTVGEYSVATTMPDRVAFGRWLDQAIAQARLAETGCAVLLIHIADYREVDEVF
                     EIRADDILAQDAGALAQAVLEPHDFLARLARDEFAVGVPELVHHGRAQELGSRMLGSL
                     AEFIAARGLQMQIGVNIGIAIYPRDAQTSEALMQAARVSLAEARQSGSNQVRLFNSAA
                     GERARRTRVIRRDLWLAIQDDALSLQFQPKYDARRRTLVGAEALCRWRHPALGQVSPA
                     EFITVAEQSGQIDKLDDWVLTSVCRQVRQWRDAGVPTVPVAINVSGLRFASRNFPQYL
                     LEQIHQHDIPPSAITLEITETAAMKDIGKSLETLAELQSLGIQVALDDFGSGYSSLGY
                     LKRLRVGTLKIDRTLIGGLDTDAQGRAIVGSMVALAHELRMKVVAEGVESASQLEILN
                     EMGCDEVQGYLLSLPLDAAGFADALREQGGGA"
     gene            246501..246893
                     /locus_tag="CNE_RS19205"
                     /old_locus_tag="CNE_2c02200"
     CDS             246501..246893
                     /locus_tag="CNE_RS19205"
                     /old_locus_tag="CNE_2c02200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013951932.1"
                     /db_xref="GI:503717856"
                     /translation="MSSPSILVVDDSPSLRRMIGACLRAGGFDVTEAADGDQAHALAA
                     GASFGMLVTDQVMPGMDGLTLIRSLRATERYACIPILMLTTEQDGSIREQARAAGASG
                     FLPKPFDPDQLMQAVTALLSTAPPTSEG"
     gene            247035..247511
                     /locus_tag="CNE_RS19210"
                     /old_locus_tag="CNE_2c02210"
     CDS             247035..247511
                     /locus_tag="CNE_RS19210"
                     /old_locus_tag="CNE_2c02210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine-binding chemotaxis protein"
                     /protein_id="WP_013951933.1"
                     /db_xref="GI:503717857"
                     /translation="MKHIDKADGAGEEFLAFTLGREEYGVDILKVQEIRGYESVTQIA
                     NAPDYIKGVINLRGIIVPIIDLRIKFRQQNVSYDQYTVVIIVDLNDRTTGIVVDGVSD
                     VLTLAAEQIKPTPHFSGELATDYIRGLGSVEQRMLILVDIEKLLNTEELAALDAVA"
     gene            247615..249264
                     /locus_tag="CNE_RS19215"
                     /old_locus_tag="CNE_2c02220"
     CDS             247615..249264
                     /locus_tag="CNE_RS19215"
                     /old_locus_tag="CNE_2c02220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_013951934.1"
                     /db_xref="GI:503717858"
                     /translation="MRNNQPVTQREYKLSPSDYLISRTDLKGRITFANRTFIEASGFA
                     AEELLGAAHNLVRHPDMPPEAFADLWQDLQAGRTWMGVVKNRRKNGDFYWVNAAVTPT
                     RVDGSVVGYTSVRSMATREQVEAAGAAYARLRAGRAEGLAIRHGAVVRTGLRGLVQGL
                     LRLNLKRRILWAQAGGMVWFLAALVAVEALGGAGVAAVRPWLWGGFALALASSFAAGT
                     MLLARVHRPVRHMLDFALRMGAGDLTTRFEHRSADEIGALAQAMQTMQRSLQSVVHEI
                     QEGMASISTATRQVAAGYNDLSQRTEQQAAALEQTASSMEELTSTVRQNADNARQASG
                     LAANASETALRGGEVVGRVVQTMDEINDASKKIVDIIGVIEGIAFQTNILALNAAVEA
                     ARAGEQGRGFAVVAGEVRSLAQRSANAAKEIKGLIGDTVERVDNGSALVGQAGKTMDE
                     IVQAVERVTDIMGEISAASAEQSAGIEQVNQAVAQMDEGTQQNAALVEEAAAAAGSLE
                     EQAMRLRDAIATFRVSMQAEVRPQRLPAHARADAAQSLAQA"
     gene            249385..251244
                     /locus_tag="CNE_RS19220"
                     /old_locus_tag="CNE_2c02230"
     CDS             249385..251244
                     /locus_tag="CNE_RS19220"
                     /old_locus_tag="CNE_2c02230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013951935.1"
                     /db_xref="GI:503717859"
                     /translation="MHWFNQLRVTTRLVAGFLVVAVIGAVMGLLGVVNMGRMADWTGK
                     IYNGDLQALKAVQDANINLVYASRAQIALLSASTMGERSAEKEQIVKSLGAMDERIRQ
                     VAGVFDKPEGKALVKQYQELSPAFRARMEKYVELVSKQPLDTSQFESQVFSESADLLK
                     DSHALEAVMFQMVKRRDDRARNNMEEARSVYNASRLWMLGLVLGGLALSVLLGVLLAR
                     ALSRQLGGEPAYAAAIAARIAEGDFSSPVTTRAGDKSSLVYAMQQMQQQLSRMVRDFK
                     VSAESIGSASREIAAGNNDLSQRTEQQAAALEQTASSMEELTSTVRQNADNARQASGL
                     AANASETALRGGEVVGRVVQTMDEINDASKKIVDIIGVIEGIAFQTNILALNAAVEAA
                     RAGEQGRGFAVVAGEVRSLAQRSANAAKEIKGLIGDTVERVDNGSALVGQAGKTMDEI
                     VQAVKRVTDIMGEISAASAEQSAGIEQVNQAVAQMDEGTQQNAALVEEAAAAAGALEE
                     QASRLQAAVATFRLAAEDARAGSFAAQPLPAATALPARASRAAGAVRAIAAGKRVAKA
                     LPASTKAAAVPAADHAAAPEAADAVAAQPARLVAGRTARPALAAADNGDWSAF"
     gene            251289..252023
                     /locus_tag="CNE_RS19225"
                     /old_locus_tag="CNE_2c02240"
     CDS             251289..252023
                     /locus_tag="CNE_RS19225"
                     /old_locus_tag="CNE_2c02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951936.1"
                     /db_xref="GI:503717860"
                     /translation="MTTEINLALPHDDAARLRKEFEQFVGVSTGLDREFLPPDFQEFL
                     RARLLQHNGPLTERAVSRLLSGGEYGWARRVFDKQLPNALAALMRDAQRFGFGLAVQP
                     DWTPDQRLAHAREWAAQVLSECGADAAFTEALATQVAASAEDVRVLEERMRTPAWRLA
                     ESLRQRAYDLMYALQTEDSEAAGRARVGELRGMLGLALEYGSVRPEEASRVLEQVERM
                     RPALFREAPDDVFARLAAWLRRMFGH"
     gene            252509..252826
                     /locus_tag="CNE_RS19230"
                     /old_locus_tag="CNE_2c02250"
     CDS             252509..252826
                     /locus_tag="CNE_RS19230"
                     /old_locus_tag="CNE_2c02250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008647543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar transcriptional regulator FlhD"
                     /protein_id="WP_010812713.1"
                     /db_xref="GI:498512267"
                     /translation="MESSEVLQEIREVNLAYLLLAQRLVRENQVEAMFRLGVSKEIAD
                     ILAKLTSAQLVKLAASNMVLCRFRFDDHALLSTLTHTAKSHDMQQIHAAILLARQPVE
                     SLN"
     gene            252823..253428
                     /locus_tag="CNE_RS19235"
                     /old_locus_tag="CNE_2c02260"
     CDS             252823..253428
                     /locus_tag="CNE_RS19235"
                     /old_locus_tag="CNE_2c02260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013951937.1"
                     /db_xref="GI:503717861"
                     /translation="MTALLQAEPTRSYTATSVPSRKSVLQDANQTQLAIELIGLGARL
                     QVLEAETTLSRDRLIRLYKELRGVSPPKGMLPFSTDWFTTWLPNIHSSLFFSAYQFMV
                     QEGETVGIRAVVAAYRLYLEHVSLLGGEIVLSFTRAWTLVRFFESNMLQLSRCTCCGG
                     QFVTHAYEPHANFVCSLCRPPSRAGKVKKLSKDAAAVQTNT"
     gene            253548..254411
                     /locus_tag="CNE_RS19240"
                     /old_locus_tag="CNE_2c02270"
     CDS             253548..254411
                     /locus_tag="CNE_RS19240"
                     /old_locus_tag="CNE_2c02270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355101.1"
                     /note="With MotB forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_013951938.1"
                     /db_xref="GI:503717862"
                     /translation="MLVVLGYVVVVVAVLGGYAMTGGHMGALYQPAEFVIIGGAAFGA
                     FIATNTAKAIKATARALPGLFKSSKYKKELYLDVMSLLYVLLSKARREGILFLEKEIA
                     DPAASSVFSQYPRILSDPVVMEFLTDYLRMMVNGNMNAFEIEALMDHEIETFRHEAEI
                     PAHALSRVGDALPAFGIVAAVMGVVHALGSADLPPAELGALIAHAMVGTFLGILLAYG
                     FVSPLAARIELQVSENVKVYECIKVVLLASLNGYAPLVAVEFGRKVLYSTVRPSFLEL
                     DDHVREVKSLN"
     gene            254439..255404
                     /gene="motB"
                     /locus_tag="CNE_RS19245"
                     /old_locus_tag="CNE_2c02280"
     CDS             254439..255404
                     /gene="motB"
                     /locus_tag="CNE_RS19245"
                     /old_locus_tag="CNE_2c02280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812710.1"
                     /note="with MotA forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_013951939.1"
                     /db_xref="GI:503717863"
                     /translation="MSSAHDMRPIIVRRAKSHAKPHGNHSWKIAYADFMTAMMALFLV
                     LWLLSSANKKTLEGIAEYFRMPLKVAVVGGERSSQTPSVIPGGGQDALRKDGDTMRAR
                     ANEPSDEQRRNEQQEAQRLRALKQRLEQIIENNPVLRQFRPQLLLDITSEGLRIQILD
                     TQNRPMFRTGSATVETYMRTILREIGPVLNELPNKVSLSGHTDAANYSNGERTYSNWE
                     LSGDRANASRRELIAGGMQEGKVLRVLGLAATMPLDKEDLLAPVNRRISIVVLNHKAQ
                     ARFEAENASAAEVSVAAQAGKAVQEMQAGLAAASAPAPAPTGSKP"
     gene            255457..257472
                     /locus_tag="CNE_RS19250"
                     /old_locus_tag="CNE_2c02290"
     CDS             255457..257472
                     /locus_tag="CNE_RS19250"
                     /old_locus_tag="CNE_2c02290"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="WP_013951940.1"
                     /db_xref="GI:503717864"
                     /translation="MSVDIDITQFYQTFFEEAEELLVEMEQLLLGLDIESPDPEHLNA
                     IFRAAHSIKGGAATFGFAALTETTHIFENLLDRTRRQELALTRTIIDTFLETKDVLQD
                     QLNAYRNGTEPDPETLARICAVLQQLAQEAAGDAGATAAPAPAPAPVAAMTPAAAATG
                     GGLKIRLIRVSASDQALLREELANLGEITGQQEVNGELVVWLNTQCSADDIIAVCCFV
                     IDLDQIVIEAEAEAPAAAPAVVEAPVPAPVPVAAAPVAAAAAPAAAREKAKPQASAAH
                     GEGSIRVPTEKVDQIINLVGELVITQSMLAQTASALDPVLFDRLFSGMGQLERNARDL
                     QEAVMSIRMMPMDYVFSRFPRLVRDLASKLGKQIDLVTFGKATELDKSLIERIIDPLT
                     HLVRNSLDHGIETPDKRVAAGKDATGQLILSAQHHGGNIVIEVSDDGGGLNRERILAK
                     AIQNGLPVSEAITDEEVWQLIFAPGFSTAEVVTDVSGRGVGMDVVKRNIQEMGGHVQI
                     SSRPGLGTTIRIVLPLTLAILDGMSVKVGEETFILPLNCVMESLQPKAEDVHTAANSD
                     RVMHVRGEYLPLLEMHRVFNVAGALQEPTQGIAVILQAEGKRFALLVDQLIGQHQVVL
                     KNLETNYRKVPCISAATILGDGSVALIVDVGALQRTGVRRQEPALAQ"
     gene            257515..258009
                     /locus_tag="CNE_RS19255"
                     /old_locus_tag="CNE_2c02300"
     CDS             257515..258009
                     /locus_tag="CNE_RS19255"
                     /old_locus_tag="CNE_2c02300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018004716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine-binding chemotaxis protein"
                     /protein_id="WP_010812708.1"
                     /db_xref="GI:498512262"
                     /translation="MAGIGHIDTPGSDASGQEFLVFTLGSEEYGIDILKVQEIRSYET
                     VTRISSAPDFIKGVTNLRGVIVPIVDLRLKFRLGNVRYDHQTVVIILNVAGRVVGIVV
                     DGVSDVLTLTGDAIKPAPEFGVSISTEHLTGLGTIDGRMLVLIDIERLMTSAEMALVE
                     AELA"
     gene            258040..258951
                     /locus_tag="CNE_RS19260"
                     /old_locus_tag="CNE_2c02310"
     CDS             258040..258951
                     /locus_tag="CNE_RS19260"
                     /old_locus_tag="CNE_2c02310"
                     /EC_number="2.1.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="WP_013951941.1"
                     /db_xref="GI:503717865"
                     /translation="MTPFRTAASVPGQTGSVLAPGAILRRDDARDFLLTERDFEKIRA
                     LIHRRAGISLGSHKREMVYSRLVRRLRALQLSDFASYLALLDADDRSSEWEFFTNALT
                     TNLTSFFREAHHFPLLAEHAKKTGRPYSVWCSAASTGEEPYSIAITLAEALGDRAGTV
                     LATDIDTQVLAKARGGVYSAEQVARLSPERLKRFFLKGTGPRTGSVKVKPELAATIAF
                     EPLNLLAPDWGMREQFDAIFCRNVMIYFDKPTQGRILERFVPLLKPHGLLFAGHSENF
                     SYVTRAFQLRGQTVYELAPDAARAGRP"
     gene            258951..259601
                     /locus_tag="CNE_RS19265"
                     /old_locus_tag="CNE_2c02320"
     CDS             258951..259601
                     /locus_tag="CNE_RS19265"
                     /old_locus_tag="CNE_2c02320"
                     /EC_number="3.5.1.44"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951942.1"
                     /note="catalyzes the conversion of glutamine residues to
                     glutamate on methyl-accepting chemotaxis receptors;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheD"
                     /protein_id="WP_013951942.1"
                     /db_xref="GI:503717866"
                     /translation="MRTPHLPEALATRTYFDREFGKQAIKLLPNEYYVTREDVVLTTV
                     LGSCVAACIRDESAGVGGMNHFMLPDDDGSADRMLSASMRYGSYALEVLINELLKMGA
                     RRERLEAKVFGGGAVLANMTTLNIGDRNADFVLRYLKTEEIRVAAQDLRGPHARRVSY
                     FPVGGLALVRRLTRQDDQVSVARDERALARAIATSARAPAQSPELFARQSFARQLP"
     gene            259625..260707
                     /locus_tag="CNE_RS19270"
                     /old_locus_tag="CNE_2c02330"
     CDS             259625..260707
                     /locus_tag="CNE_RS19270"
                     /old_locus_tag="CNE_2c02330"
                     /EC_number="3.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013951943.1"
                     /db_xref="GI:503717867"
                     /translation="MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVAR
                     DLIKRLNPDVLTLDVEMPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELG
                     AVDFVTKPKLGIRDGLLEYTHTIADKLRAASRARVRAAAQPAAPTAAGAEPVPMLRSP
                     LLSTEKLIILGASTGGTEAIKEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRI
                     TVKEAVHGERVLPGHAYIAPGDSHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSA
                     AQHGGKNVIGVILTGMGKDGARGMLRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVH
                     EVVPLPAMTQRVMARLATYGTRAQRV"
     gene            260796..261182
                     /locus_tag="CNE_RS19275"
                     /old_locus_tag="CNE_2c02340"
     CDS             260796..261182
                     /locus_tag="CNE_RS19275"
                     /old_locus_tag="CNE_2c02340"
                     /function="Cell motility and secretion / Signal
                     transduction mechanisms"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315505.1"
                     /note="chemotaxis regulator that, when phosphorylated,
                     interacts with the flagellar motor causing the flagella to
                     spin clockwise which causes the cell to tumble; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011616433.1"
                     /db_xref="GI:499935699"
                     /translation="MDKSIKILVVDDFPTMRRIIRNLLKELGFVNVEEAEDGAAGLEK
                     AKDGSFQFVISDWNMPNMDGLTMLQAIRADANIGKIPVLMVTAEAKKENIIAAAQAGA
                     NGYVVKPFTAATLDEKITKIFEKLGG"
     gene            261200..261832
                     /locus_tag="CNE_RS19280"
                     /old_locus_tag="CNE_2c02350"
     CDS             261200..261832
                     /locus_tag="CNE_RS19280"
                     /old_locus_tag="CNE_2c02350"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheZ"
                     /protein_id="WP_013951944.1"
                     /db_xref="GI:503717868"
                     /translation="MTPTLSNDSAEQLILRIGNLTRMLRDNMRELGLDKEIERAAQAI
                     PDARDRLNYIAAMTEQAAERTLNAVELAQPIQSGIEQQAETLDKRWDAWFEQPVELAD
                     ARSLVLDTRAFLSEVPAQARATNSHLLDIMMAQDFQDLTGQVIKKMMDMIRALEQELL
                     QVLIDNVPSERRVEAPAATLLNGPQISPEGKPDVVSDQAQVDDLLASLGF"
     gene            262396..263076
                     /locus_tag="CNE_RS19285"
                     /old_locus_tag="CNE_2c02360"
     CDS             262396..263076
                     /locus_tag="CNE_RS19285"
                     /old_locus_tag="CNE_2c02360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="curli production assembly protein CsgG"
                     /protein_id="WP_013951945.1"
                     /db_xref="GI:503717869"
                     /translation="MNKVTAISLVAAAGLLAMLGGCATESSTALPVQKVESASRPYAG
                     VRTPISVGKFDNRSSYMRGVFSDGVDRLGGQAKTVLITHLQQTNRFNVLDRDNMDEIK
                     REAAIKSQAQRLKGADYVITGDVTEFGRKETGDHQLFGILGRGKSQVAYAKVALNVVN
                     IATSEVVFTAQGAGEYSLSSREVVGFGGTSSYDSTLNGKVLDLAMREAVTNLVSGIES
                     GAWKPVTP"
     gene            263113..263478
                     /locus_tag="CNE_RS19290"
                     /old_locus_tag="CNE_2c02370"
     CDS             263113..263478
                     /locus_tag="CNE_RS19290"
                     /old_locus_tag="CNE_2c02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_041228770.1"
                     /db_xref="GI:752557538"
                     /translation="MFQPQRLAVPALVASALLTGCAAPAKPLYQWEGYQPQVYQYFKG
                     EPKQALIEVLERDLQKIMAAGNTPPPGYHAHLGMLYVDIGKDDEMVREFQTEKALFPE
                     SGAYVDFLLKNVKRKGEKK"
     gene            263475..264134
                     /locus_tag="CNE_RS19295"
                     /old_locus_tag="CNE_2c02380"
     CDS             263475..264134
                     /locus_tag="CNE_RS19295"
                     /old_locus_tag="CNE_2c02380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951947.1"
                     /db_xref="GI:503717871"
                     /translation="MSKLFHRVLMLLGVAMLAAGCAAPTKNVDYAAFKESHPRSIVVL
                     PPLNNSPDVKATYAMLSQATQPLAESGYYVLPVALVDETFRQNGLTIPGDIHAVAPAK
                     LREIFGADTALYITVTDYGPKFQVVSSTTVVAAEAKLLDLRTGKTLWTGQASAANNQS
                     GNAGGGLIGALIGTAIAHAISSVSDAAYGVAGRTSQQLLSAGTPGGILYGPRSPKYGT
                     D"
     gene            264374..265516
                     /locus_tag="CNE_RS19300"
                     /old_locus_tag="CNE_2c02390"
     CDS             264374..265516
                     /locus_tag="CNE_RS19300"
                     /old_locus_tag="CNE_2c02390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_013951948.1"
                     /db_xref="GI:503717872"
                     /translation="MSEESDLEKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVT
                     GLWTLGGHLGRSLNQVMQGALRFEPATAFDTSRMLSRFSMMVWDSLLAFLPLLFLFGV
                     AALAAPLLLGGWVFSGKSFAPQFSRLSPLAGLGRMFSAHSLVELLKAVAKSLLVGSVG
                     AWVLWRRLPEAIALMNAPVQEALLHMVDLVMNCCLVVSLSLLVVAAIDVPWQYWEYFK
                     KLRMTKEEVKQEFKESEGDPHIKGRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVA
                     LRYEEGRMGAPRVVAKGTGDIAARIRELAAEHRVPLMSAPPLARALHRHVELGQEIPA
                     GLYTAVAEVLAWVYQLKHWHYSQGPQPQAPADLPVPDELAVPEMRE"
     gene            265513..267594
                     /locus_tag="CNE_RS19305"
                     /old_locus_tag="CNE_2c02400"
     CDS             265513..267594
                     /locus_tag="CNE_RS19305"
                     /old_locus_tag="CNE_2c02400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="WP_013951949.1"
                     /db_xref="GI:503717873"
                     /translation="MNALSNLFNLPGLRSAGQLKAMTGPLLIIMILGMMILPLPAFVL
                     DLLFTFNIALAIMVLLVSMYTQKPLDFAAFPAVLLFTTLLRLSLNVASTRVVLLEGHT
                     GPDAAGKVVEAFGHFLVGGNFAVGIVVFAILVVINFMVITKGAGRIAEVGARFMLDSM
                     PGKQMSIDADLNAGLIDEAAAKKRRAEVAQESDFYGAMDGASKFVRGDAVAGLLIMFI
                     NVAAGMVVGMVQHDLDFGTAVHNYTLLTIGDGLVAQIPALVISTAAGVIVSRVSNEQD
                     VGEQLTGQLFANPRVLYLTAGIIGLMGIIPGMPHFAFLLLAGVLVWMGRYMSRRAATQ
                     EQVKQREERTPAVAQESTEASWDDVTLVDPLGMEVGYRLITLVDRAQDGELLGRIKSI
                     RKKVAQEIGFLVPVVHIRDNLELKPNAYRITLKGVEIGRGEAMPGQWMAINPGQVSGT
                     LPGAATRDPAFGLPAVWIDAGIKEQAQSYGYTVVDASTVVATHLNHLIHMHAAELLGR
                     QEVQALLDRIAKDSPKLTEDLVPKAISLTALQKILQNLLDEGVPIRDMRTILDVVAEH
                     APKISDPNELTAMVRVALGRAITQQLFPNNADLQVIGLDAGLERVLSQALTNGGGIEP
                     GLADALLQQTQGAVTRQEQMGMDPVLLVPSQLRPLMARFLRRTMPQLRVLSHAEVPDN
                     RNIRITAMIGA"
     gene            267605..269935
                     /gene="flhF"
                     /locus_tag="CNE_RS19310"
                     /old_locus_tag="CNE_2c02410"
     CDS             267605..269935
                     /gene="flhF"
                     /locus_tag="CNE_RS19310"
                     /old_locus_tag="CNE_2c02410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616443.1"
                     /note="positive regulator of class III flagellar genes;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="WP_013951950.1"
                     /db_xref="GI:503717874"
                     /translation="MSVAKFVAANGREAMRQVREAMGPDAVVLSNRTIEGGVEIVAMR
                     DTDLGSVQATAQVYVPPAPVVEPAAISDLRGELQSMRAMLERQLAGINPAPSAVASAA
                     AHGVAASDPLRESLFEWMVGAGFSGQLARTLLARLPLGYDRPAAMGWIRTELASKLPV
                     LGDEDSLFAQGGVLALVGPTGVGKTTTTAKLAARFVLRHGADKLALLTTDSFRIGAHE
                     QLRIYGDILGVPVHAVKDAADLRFALAAMKDKHLVIIDTVGMSQRDRSLSEQIAMLAG
                     VPAPVQRVLLLNGASHGDTLNEVVHAYRHDAAPDGGGIDGCIISKLDEATHLGSVLDV
                     VIRHRLPVFYASTGQRVPEHLELANSTALVERAFLTPRRGSVFADADAARRRSAGTDD
                     EVPARGGADEVLRSLTDSADALSQCVAELNGAGLGLDLARSLWQQRGADAPALRAMSQ
                     QVREAVCRDVTRQCEQYVLASAATLQVAVPGRRTPQPMQHTLWFADRDGMPLAATVTP
                     TGRAGHPLGEAESDAASLRAAMSAARKVVNLIDAIPSAAMLARWQQAGERWVASARKT
                     ARVVSAGAAWKLDALADTLTFHAVGEDTVREREAVRWLASAEVRVPDSPVRGKGTPEG
                     GIDACLVVARLADRATGELLDTRYLLCDPALAQDAAQVARWALWTDAADARLRTLRHA
                     IDHFAQDAESGHAAGAALAALQLGLSVLRLEHAPTAAAPAFLARLAGRTARQGAPVPG
                     TVLNEGMGRMLALLDVLENYPGRGTAVSAEAMEVLQ"
     gene            269947..270741
                     /locus_tag="CNE_RS19315"
                     /old_locus_tag="CNE_2c02420"
     CDS             269947..270741
                     /locus_tag="CNE_RS19315"
                     /old_locus_tag="CNE_2c02420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar synthesis regulator MotR"
                     /protein_id="WP_013951951.1"
                     /db_xref="GI:503717875"
                     /translation="MDQAESLRRMLAPRTTRRIAVVASEGGAGATTVALGLSHALAMQ
                     GERVLLVDEDAAAARATRLSGARPAGTLADVSAGRLPLEAAAGTGPGGVLSVLPAGRP
                     VPGSALSAAAASGFRSVLVDAGVDADGALSPLAGGAHNVLIVMRPELASITAAYACIK
                     RLHHLYAWRQFHLIVNMAASEATVQAILRNLARTASQYLGVEALCAGWLPSDPLVARG
                     VQLGRCVVEAFPAAPATTALRRTAGSIGAWPLRADASAPVPAAAMA"
     gene            270838..271554
                     /locus_tag="CNE_RS19320"
                     /old_locus_tag="CNE_2c02430"
     CDS             270838..271554
                     /locus_tag="CNE_RS19320"
                     /old_locus_tag="CNE_2c02430"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020205581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma70"
                     /protein_id="WP_013951952.1"
                     /db_xref="GI:503717876"
                     /translation="MYTIQGKLEQADVVKAHAQLVRRIALQLAARLPASVQIDDLIQA
                     GMIGLLDAAKRYEDTHGARFETYASQRIRGAMLDEVRANDWQSRSLRQFTRRIERTQR
                     GLEQKLGRAPVDSEVAEAMEMALDEYQLLLNEVYGCQLLHYEDFERSGEEDFLDRHLG
                     GSDDGNPLTVLMESGMREALIRAIDRLPEREKLVLSLCYDQELNLREIGAVLDVTESR
                     VCQIRGQAITRLRNQLRGLL"
     gene            271554..271991
                     /locus_tag="CNE_RS19325"
                     /old_locus_tag="CNE_2c02440"
     CDS             271554..271991
                     /locus_tag="CNE_RS19325"
                     /old_locus_tag="CNE_2c02440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhE"
                     /protein_id="WP_041228771.1"
                     /db_xref="GI:752557539"
                     /translation="MQRMGRAARGACCLLAAVSACAWAAIEGGTRHAWTGSVNGPALY
                     GRGQRAVSPPILPIGVLPQSEGVITSVRWRYSFAKTPPLELQAYLCNAQRCVLLPQAE
                     GKTDAFFGDDATKGFVFAFRVPGQGSLVPVLQGRSNELVVGFR"
     gene            complement(272019..272480)
                     /locus_tag="CNE_RS19330"
                     /old_locus_tag="CNE_2c02450"
     CDS             complement(272019..272480)
                     /locus_tag="CNE_RS19330"
                     /old_locus_tag="CNE_2c02450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlgN"
                     /protein_id="WP_013951954.1"
                     /db_xref="GI:503717878"
                     /translation="MNQSLIQSLQRETEGIQAFGQLLAEERDALKRGDFQSLSGLLTR
                     KVELGQALSRQLKAREAQMGTLGLRAGPEGQLLGRQVDPAVADAWRQLIFAARTARDG
                     NALNGAVVNAHLDFTREAIQALRQHSGGDAGLYGKDGKAAAGAGGVSLAAG"
     gene            complement(272486..272794)
                     /locus_tag="CNE_RS19335"
                     /old_locus_tag="CNE_2c02460"
     CDS             complement(272486..272794)
                     /locus_tag="CNE_RS19335"
                     /old_locus_tag="CNE_2c02460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="negative regulator of flagellin synthesis"
                     /protein_id="WP_013951955.1"
                     /db_xref="GI:503717879"
                     /translation="MKINHTASSRPADAPAGDAAARPQAAPASAAAPSAGLSVSPLAA
                     QVRDISARLMQPTDDDIDTAKVEEIRQAIAEGRIRIDPGKIADGLLATLRELGQAEPR
                     "
     gene            complement(272956..273771)
                     /locus_tag="CNE_RS19340"
                     /old_locus_tag="CNE_2c02470"
     CDS             complement(272956..273771)
                     /locus_tag="CNE_RS19340"
                     /old_locus_tag="CNE_2c02470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring biosynthesis protein
                     FlgA"
                     /protein_id="WP_013951956.1"
                     /db_xref="GI:503717880"
                     /translation="MKQNRRNARSLAQDLLAACLLGPAAAGAAPAQVMSVAMQAPAAH
                     GQQQAAYAGNPAANPAANPAASPFAEDPARVAVERFLLQQTAGLPGKVSVQVAPPSGG
                     RAPDCLAPDPFLPAGTSTWGRVSVGVRCGGERPWVRYMQARVSVLTDYYVAARALGPG
                     EPVSQADIEVRQGDLGTLPRAVITDPAQLAGAVTANRIAAGSPIRADLLRKAIAVRQG
                     QTVTVAVEGDAFQITSEGKVLADAATGNTVQVRLRSGQVVNGLVRSGDTVVLQ"
     gene            274016..274423
                     /locus_tag="CNE_RS19345"
                     /old_locus_tag="CNE_2c02480"
     CDS             274016..274423
                     /locus_tag="CNE_RS19345"
                     /old_locus_tag="CNE_2c02480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlgB"
                     /protein_id="WP_013951957.1"
                     /db_xref="GI:503717881"
                     /translation="MIDRLDAALRFQQEALSLRNQRQSVIASNIAHADTPGYKARDFD
                     FSSTLAQSVERGHRNEGMSLSTTSIRHLPAQAPGREEFDLAYRIPLQSSVDGNTVEMD
                     TERVAFADNAVHFESGLTVMNSKIKTMLAAIQQ"
     gene            274448..274855
                     /gene="flgC"
                     /locus_tag="CNE_RS19350"
                     /old_locus_tag="CNE_2c02490"
     CDS             274448..274855
                     /gene="flgC"
                     /locus_tag="CNE_RS19350"
                     /old_locus_tag="CNE_2c02490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018006607.1"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="WP_010812667.1"
                     /db_xref="GI:498512221"
                     /translation="MPAMNIFDVAGSAMAAQSQRMNVTASNLANADSVVSPDGQAYRA
                     KQVVFGMAPTPGQTDIGGVQVRGVSEDPSPPRMVHNPTHPMANAQGYVVMPNVNPVEE
                     MVNMISASRSYQANVEVLNTAKNMMLKTLTIGQ"
     gene            274911..275582
                     /locus_tag="CNE_RS19355"
                     /old_locus_tag="CNE_2c02500"
     CDS             274911..275582
                     /locus_tag="CNE_RS19355"
                     /old_locus_tag="CNE_2c02500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod modification protein
                     FlgD"
                     /protein_id="WP_013951958.1"
                     /db_xref="GI:503717882"
                     /translation="MTTTSAVGSNSNTQGINDALKSGSASASELQNNFLTMLVTQMNN
                     QDPLNPMDNAQLTSQLAQISTVSGMQTMNATLSQLLSQVSASRAMDSAALIGHTVMVP
                     GKQVSVAGGVPGKFGLDLPSTADAVTVDVLDKDGNVVRTIDMKGQTAGVHNVAWDGKN
                     NAGAAVADGDYTFKVTATANGTSVQPVALVYGKVQSISGDASGVLVDLGDGQTANVDD
                     VRRIL"
     gene            275651..276892
                     /gene="flgE"
                     /locus_tag="CNE_RS19360"
                     /old_locus_tag="CNE_2c02510"
     CDS             275651..276892
                     /gene="flgE"
                     /locus_tag="CNE_RS19360"
                     /old_locus_tag="CNE_2c02510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951959.1"
                     /note="the hook connects flagellar basal body to the
                     flagellar filament; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="WP_013951959.1"
                     /db_xref="GI:503717883"
                     /translation="MGFGQGVSGLNAAASNLDVIGNNIANANTVGYKQSAAQFADIYA
                     GTKIGLGVRVNSVVQSFNQGNIEASGRALDVAITNGNGFFRLTSPEGAVYYSRNGQFQ
                     RQEDGRITNMQGLQVTGYPAGVAGGAGVQPQPLVVSNAQMEPKATSNITAKFQLDSRS
                     KVPANPFPTAAVPPATTPAPDSSMFNYSTAINVYDSLGNKQQLMAYFAKSGGAPTVGG
                     GTDWKMYVTDVNGNPVGGAPLTLAFDNAGALKSPAANAVTLTQPAANGAQAMTMALDL
                     TGTTQFGADNDVKQLSQNGYTSGSLLGFSVNGDGTITGSYSNEQTKPLGQIVMAAFGN
                     VEGLKPEGDNVWSATGASGQALVGTAGGSMGTLRSNAVEASNVDLSGQLVNLIVAQRN
                     YQANAQTIKAQDTVMQTLVNL"
     gene            276919..277662
                     /gene="flgF"
                     /locus_tag="CNE_RS19365"
                     /old_locus_tag="CNE_2c02520"
     CDS             276919..277662
                     /gene="flgF"
                     /locus_tag="CNE_RS19365"
                     /old_locus_tag="CNE_2c02520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951960.1"
                     /note="FlgF, with FlgB and C, makes up the proximal
                     portion of the flagellar basal body rod; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="WP_013951960.1"
                     /db_xref="GI:503717884"
                     /translation="MDRMIYTALSGAKQILDQQAAVSNNLANVSTPAFRAQVNLYRAV
                     PVVGPEAGTRAFTLASTPGADMRAGPLTYTGRTLDVALQGNGWLVVQAPDGTEAYTRA
                     GALQVAQDGQVQTISGLPVMGDGGPLAVPPGSQVTIGTDGTITARGPGEASAGLAPVG
                     RLRVVNPPNDAIARGDDGLFRLRPGAQPLEADPTVRVISGALEGSNVNPTEAMVEMIA
                     NARRFEMQMKMIQGADGNEQRANQLLSTN"
     gene            277717..278502
                     /gene="flgG"
                     /locus_tag="CNE_RS19370"
                     /old_locus_tag="CNE_2c02530"
     CDS             277717..278502
                     /gene="flgG"
                     /locus_tag="CNE_RS19370"
                     /old_locus_tag="CNE_2c02530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312211.1"
                     /note="makes up the distal portion of the flagellar basal
                     body rod; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgG"
                     /protein_id="WP_010812663.1"
                     /db_xref="GI:498512217"
                     /translation="MIRSLWIAKTGLDAQQTQMDVISNNLANVSTNGFKRGRAVFEEL
                     MYQTIRQPGALSSDQTTLPSGMQLGTGVRPVATERIHTQGNPQQTGNAKDVAILGQGF
                     FQVALPDGTTAYTRDGSFQVDQNGQLVTSSGFVIQPAITIPANTLSMTIARDGTVSVT
                     QPGSSANVQVGQLQLATFMNPAGLESMGENLYVQTDASGAPNTTVPGLNGAGVVQQNY
                     VEASNVNVVEELVSMIQTQRAYEINSKAVQASDQMLQRLSQLG"
     gene            278514..279212
                     /locus_tag="CNE_RS19375"
                     /old_locus_tag="CNE_2c02540"
     CDS             278514..279212
                     /locus_tag="CNE_RS19375"
                     /old_locus_tag="CNE_2c02540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein"
                     /protein_id="WP_013951961.1"
                     /db_xref="GI:503717885"
                     /translation="MATLLSRLGAHALVCLAGVAMLASGGCALMPREPLVQLPTTARA
                     EPRPMGPASGSIYQSSYAGNPLFEDRRPRYVGDILTILITENVNASKNSGTNASRTGN
                     TALAFDAVPRALSGLFNSSSNASINGANTMKASGGASAANTFNGTITVTVLEVLTNGN
                     LVVSGEKQMAINQGAEFIRFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQN
                     MGWLQRFFLNVSPF"
     gene            279196..280365
                     /locus_tag="CNE_RS19380"
                     /old_locus_tag="CNE_2c02550"
     CDS             279196..280365
                     /locus_tag="CNE_RS19380"
                     /old_locus_tag="CNE_2c02550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar P-ring protein FlgI"
                     /protein_id="WP_013951962.1"
                     /db_xref="GI:503717886"
                     /translation="MFLRSDRAMSAPMLARFLSRLLRLSVISLALGVAFGAFATVAKA
                     ERLKNLATFQGVRENPLVGYGLVVGLDNTGDQTMQTPFTTQSLTNMLSQLGITLPAGK
                     NMQLKNVAAVMVTASLPAFAQPGSQLDIVVSSMGNAKSLRGGTLLMTPLKGADGQVYA
                     IAQGNMLVGGAGASANGSKVQINQLAVGRIANGAIVERAVAPFQPDGGVLNLELKDTD
                     FGTAERVVEAINRSMGGGVAAALDGRVVQVRAPASAAARVGFLARIENIDVTPAKAAA
                     KVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPFSEGRTVVAPVSQI
                     DMKQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEVI"
     gene            280368..281411
                     /gene="flgJ"
                     /locus_tag="CNE_RS19385"
                     /old_locus_tag="CNE_2c02560"
     CDS             280368..281411
                     /gene="flgJ"
                     /locus_tag="CNE_RS19385"
                     /old_locus_tag="CNE_2c02560"
                     /EC_number="3.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616449.1"
                     /note="Flagellum-specific muramidase which hydrolyzes the
                     peptidoglycan layer to assemble the rod structure in the
                     periplasmic space; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan hydrolase"
                     /protein_id="WP_013951963.1"
                     /db_xref="GI:503717887"
                     /translation="MNTARPPQAAELTQRFALDTQGFEALKRSARGGADANTLQAVAK
                     QFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYMSMMDQQLAQQMSSRGIGLADVMVRQ
                     LARATGTAMPAGMSAMSPAESGKAADAEMARLLDSRGAGAVPADAGEQADLPALGTIV
                     PGQNWNPTAGLRQYQPQWYADRGQGEDKLGRLPDDAPAHVSAFVARMAGPAEAAARAS
                     GVPARLIVGQAALESGWGQREITHADGSTTFNVFGIKAGASWKGRVAEITTTEYVDGQ
                     PQKVRAKFRAYGSYDEACADYARLLTNNPRYAGVVSAASAEEAAHGLQRAGYATDPAY
                     GHKLVKIMKKVAA"
     gene            complement(281861..282343)
                     /locus_tag="CNE_RS19390"
     CDS             complement(281861..282343)
                     /locus_tag="CNE_RS19390"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228518.1"
                     /db_xref="GI:752557286"
                     /translation="MAAQPVGDLALYFQDLLILTPDFIQLPGQGRPQHRRHGVLNFFP
                     TGAYFGQPGVATCGEVQPEFAQQSAKLIDSPCTRVDQLGANPVRAQQSLLGLSLYRHA
                     GHPRLECSRPYGTRIGSISLVGAYERADIARIEQGGLIPKLWILRAHQCEPPQASRAK
                     "
     gene            282933..284858
                     /locus_tag="CNE_RS19395"
                     /old_locus_tag="CNE_2c02580"
     CDS             282933..284858
                     /locus_tag="CNE_RS19395"
                     /old_locus_tag="CNE_2c02580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="WP_013951965.1"
                     /db_xref="GI:503717889"
                     /translation="MSLFSIGLSGLNTAQNALTTTGHNFANSATEGYSRQNTIVASAG
                     GQYTSQGFYGFGSNTTTVTRVYDEFLTGQLRGATSASASLAAYSDQIAQIDNLLADQK
                     GGLAPLMQKFFAAVQAVADTPADPAARQGMLSAGQALVGQVRSASNYFKQLQAGVNEQ
                     VGTAVTQVNAYTKQIANLNQEITRLKAASGGQPPNDLLDQRDQAVAELTKLVGAKVVV
                     QDSGTYNVFVGNGQPLVMGNDAYALKAVASAADPNRTVVAYTLPNGNVFESEPGAITG
                     GSLGGLLQFRTESLDAAQSAIGRLSLAIGQSFNAQHELGIDLNGAIGTDMFALGGATA
                     IPNANNTVKTTVATAKIANASALTTSDYKLQFDGTNYTLTRLSDNQQVVAPVPAGGAS
                     YPLQFSADGFTVEINAAMGTNDSFTIQPTRNAATGFDMAISDPARIAAASPAHVEAGA
                     LNKGSGTASLSNVAPGFTLPAANITAEFDGSLNKYVFKVGGTAMAPQPVGVANGSNTD
                     FTLNGLTFSFGGTPKAGDTFTLVSNAGAVKDNGNMLALAKLQNAKTIGGVSSFSEGYA
                     QLVNDVGTRAKSVKIASASQDSITTQIKTAQQSVSGVNMDEETVSMLRFQQLYQANAR
                     VIQTAGTLFDTIIGIGR"
     gene            284905..286134
                     /locus_tag="CNE_RS19400"
                     /old_locus_tag="CNE_2c02590"
     CDS             284905..286134
                     /locus_tag="CNE_RS19400"
                     /old_locus_tag="CNE_2c02590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018006599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="WP_013951966.1"
                     /db_xref="GI:503717890"
                     /translation="MRVASSTLYQQGLASMNYQQGSLLHIQQQLGTGRSILTPSDDPV
                     GATRALGVSQAQAVNGQYATSRKQANIALAAEENALQSVTTVTQNIQTLLVQAGNGTM
                     SDADRGSLATALEGLYNQLAGLANSDDGNGQYLFGGTRSGSAPFTQSTGPGTYIGDNG
                     QQLLQVDVARQMPAGNTGREVFMSVTGGAGYVVKGNANNTGSATFGTVSTTNPSDPNY
                     GLSMEVKFATNASGQMEYTITDLSAGTTPAPVVKGPVAYTSPAHIDVAGVSFNVTGDP
                     KDGDTMTMDPASKAGTDMFANLQTVIDTLRQPTPNNSDRAHLGNVISTATRQFSNSLD
                     NVLTVRASVGSRMNELDALDDVGSNRDLTYAQTLSGLQDLDYAKAITEYYQRQTALQG
                     AQQSFMQIQGMNLFKYL"
     gene            286728..287171
                     /locus_tag="CNE_RS19405"
     CDS             286728..287171
                     /locus_tag="CNE_RS19405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="WP_041228519.1"
                     /db_xref="GI:752557287"
                     /translation="MIKDMRIRAAVPADMQAVSQVLHSCGLPISDMDHLSRLFSLAVL
                     GEKVIGCACGEIYGETVIIQSVAVLAECRGHQVATHLVGAVLMRARAHGCTKAAVLTS
                     EYPAFFARFGFTLTAVGEMPQEMQLSKEFVRRFGARTHCMCRRLD"
     gene            complement(287460..287669)
                     /locus_tag="CNE_RS19410"
     CDS             complement(287460..287669)
                     /locus_tag="CNE_RS19410"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228520.1"
                     /db_xref="GI:752557288"
                     /translation="MSTEMSHEPDNLGRSIQINSLLGHASNEANQVLISQNQRRTFGN
                     CSRQLSTISFDGLFTRRLYKTTAEM"
     gene            complement(288975..289214)
                     /locus_tag="CNE_RS19415"
                     /old_locus_tag="CNE_2c02640"
     CDS             complement(288975..289214)
                     /locus_tag="CNE_RS19415"
                     /old_locus_tag="CNE_2c02640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951971.1"
                     /db_xref="GI:503717895"
                     /translation="MDTPFHQFSDLFAQLGLPSSKADILAFIAKHSPLPQDINLWEAP
                     FWTPAQAALLRDEFDEDADWAQAVDQLNLALRTTA"
     gene            complement(289282..289476)
                     /locus_tag="CNE_RS19420"
     CDS             complement(289282..289476)
                     /locus_tag="CNE_RS19420"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228521.1"
                     /db_xref="GI:752557289"
                     /translation="MTHDKKIATKWEMAAFAFLTGFNAHAHTSSSLGVVSGTLAVCAL
                     IARAMHSWAEQPFNASAAPW"
     gene            complement(289562..290260)
                     /locus_tag="CNE_RS19425"
                     /old_locus_tag="CNE_2c02650"
     CDS             complement(289562..290260)
                     /locus_tag="CNE_RS19425"
                     /old_locus_tag="CNE_2c02650"
                     /EC_number="3.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013951972.1"
                     /db_xref="GI:503717896"
                     /translation="MSNAKLEVLTPHNSQLIIIDHQPQMAFGVQSMDRQTMKNNVVGL
                     AKAAKIFDVPTTITTVESESFSGYTYPEILDVFPGKETLERTSMNSWDDQKVRDALAA
                     DGRKKIVVAGLWTEVCNTTFALSAMLEGDYEIYMVADASGGTTKEAHDYAMQRMIQAG
                     VVPVTWQQVLLEWQRDWAHRDTYDAVMKLVKEHSGAYGMGVDYAYTMVHKAAQRTATT
                     HESIAPVHAPVIEN"
     gene            complement(290871..291110)
                     /locus_tag="CNE_RS19430"
                     /old_locus_tag="CNE_2c02660"
     CDS             complement(290871..291110)
                     /locus_tag="CNE_RS19430"
                     /old_locus_tag="CNE_2c02660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013092661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951973.1"
                     /db_xref="GI:503717897"
                     /translation="MNGNICLKTAQLQAAAHANEQDATLWRWFSDQMEDQMMSCERKR
                     GDWIICVAGRELARDPSFDLAVRAAHFLCRALKAL"
     gene            291492..292412
                     /locus_tag="CNE_RS19435"
                     /old_locus_tag="CNE_2c02670"
     CDS             291492..292412
                     /locus_tag="CNE_RS19435"
                     /old_locus_tag="CNE_2c02670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_041228522.1"
                     /db_xref="GI:752557290"
                     /translation="MRLSTSTHESAKPAIQRDSLGCLSEALRYDQALAAGDLNFYRKS
                     SVIERMSQVVTPASARGFLVGVSLMEGHRRRIFRPNQANMHAFEAGSIYLRNFQDDYK
                     ADMYGTFDFVLIELPRPFMERTALELGCPAGLELRHAAAQTDAVLAHLAQALLPALAR
                     PEGASRLFIDQLGHVIGTYLVEHYGGVNRGRIPSIGRLSPRILARAQEFLAARLDDGN
                     VSIAEVADACQLSRSHFSRAFRQSTGKTPHEWLLERRLERAAALLRTTDLPIAGIAAS
                     CGFADQSHLTRSFSKKLGLTPGDWRSGRQD"
     gene            292622..293332
                     /locus_tag="CNE_RS19440"
                     /old_locus_tag="CNE_2c02680"
     CDS             292622..293332
                     /locus_tag="CNE_RS19440"
                     /old_locus_tag="CNE_2c02680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_013951975.1"
                     /db_xref="GI:503717899"
                     /translation="MRAESAPQDDAVVLVVDDDLQVRNALGSLFRSVGIQAVLLGSAA
                     ELFAFGFPDAPCCLVLDVRLKGQSGLDVQARMAELGIHIPIIFMTGYGDIPMTVAAMK
                     AGAEHFLSKPFREQELLDAVTEALQKEGSRRERLCRLAAVRDCFRSLTPRESEVMAHA
                     ASGLTNKEIAAAMCISVVTVKVHRCQAMRKMRARSFADLVLLAQTLGLVLLPSESEAD
                     EQPAIRLQPRQLGTATIA"
     gene            complement(293405..293797)
                     /locus_tag="CNE_RS19445"
                     /old_locus_tag="CNE_2c02690"
     CDS             complement(293405..293797)
                     /locus_tag="CNE_RS19445"
                     /old_locus_tag="CNE_2c02690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041228523.1"
                     /db_xref="GI:752557291"
                     /translation="MIARPTIAIVDDDVAVRNAMGGLLRSLDFGVQLFGGGQELLRCT
                     SLPCMSCVITDAQMPGMDGFALIEALRARNLDMPVIFMTAFAHEGFDQRAKAMGATCV
                     LYKPFQDTDMIRCIEKAIRPRKTDSPPS"
     gene            complement(294553..295281)
                     /locus_tag="CNE_RS19450"
                     /old_locus_tag="CNE_2c02700"
     CDS             complement(294553..295281)
                     /locus_tag="CNE_RS19450"
                     /old_locus_tag="CNE_2c02700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_013951977.1"
                     /db_xref="GI:503717901"
                     /translation="MTPTQLPDAGRRADLSGPAFGCILAFVAGYVDVVGFISLFGLFT
                     AHVTGNFVMIGVDIAGDSPGLLAKLLALPTFALAVAAARLTESRIVRDKQSAPSLLLF
                     AEALALVLFIVAGFHASPISDPSTPAAVGAGMLAVVAMGIQNSLSRTSLSDLGPTTIM
                     TGNTTQIIIDLVDLPSASEADGKAIRGRLKKMVPALAGFASGAALGALGYSMLSLWCV
                     MLPAVLLTALSFLTWRNGANSLQK"
     gene            complement(295315..296412)
                     /locus_tag="CNE_RS19455"
                     /old_locus_tag="CNE_2c02710"
     CDS             complement(295315..296412)
                     /locus_tag="CNE_RS19455"
                     /old_locus_tag="CNE_2c02710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_041228773.1"
                     /db_xref="GI:752557541"
                     /translation="MAPRRIHVALAASLSAAAAPAVADNNVAIYGRLNTAIEYVTVTT
                     ATDGTRLGNTARLTNNRSVFGMRGEEQLANGIKAIWQIESALSVDNGAGQIAARDTRL
                     GLQSPYGTLFMGNWDTPYTSATKSYDPYYATTAGYMALIGNGAASTSDNVQNTSSFDR
                     RQKNSLHYQSPTWHGLSGAIAWGLPEEKTTVPRNPALYSFATAYGHGNLNLTLAYEIH
                     QHYQTSGRNDDAIKAGVSYQFPSTRISALYERLHYRTATGDLTRNGYYVSLIQEFGPG
                     SIRAGFAFVGDGTGTAMETIGSVRSGSDTGAFQVTVGYDYPLSKRTALYAYYSRINNR
                     SNANYDFAINNLGIKAGADPQTFAIAMRHSF"
     gene            complement(296468..296761)
                     /locus_tag="CNE_RS19460"
                     /old_locus_tag="CNE_2c02720"
     CDS             complement(296468..296761)
                     /locus_tag="CNE_RS19460"
                     /old_locus_tag="CNE_2c02720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013951979.1"
                     /db_xref="GI:503717903"
                     /translation="MKLYLISLGAGILVGIIYALMQVRSPAPPAIALIGLLGMLIGEQ
                     VVPPVKRMLAGEPVTIAWFRGECVPKITGTPPNADTAVEPSASLPARSKEGNQ"
     gene            complement(296799..298412)
                     /locus_tag="CNE_RS19465"
                     /old_locus_tag="CNE_2c02730"
     CDS             complement(296799..298412)
                     /locus_tag="CNE_RS19465"
                     /old_locus_tag="CNE_2c02730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013951980.1"
                     /db_xref="GI:503717904"
                     /translation="MTQSAISAAKPASGGTFAPLAQPTFAVLWVATILGNIGSFMRDV
                     ASAWLATDLSTSPAAVATIQAAATLPVFLLAIPAGVLSDILDRRRFLIVIQIGLAMVS
                     GTLMLLAWRQALTIEVLIALAFVGGVGAAMMGPTWQSIVPELVPPSTLRQAVALNSLG
                     VNVARAIGPATGGLLLAAFGAAATYSADLLSYVFVIAALIWWKRPEKPSDPLREHFFS
                     AFRAGLRFTRAHSKLHVVLARAAVHFAFGSGVWALLPLVARQLLHGGAGLYGVLLGAV
                     GAGAILGALTMSRLQQRLDADGMVLLSAIVTAVVMAALSSAPPIWLALPLLLLLGAAW
                     IMALTTLGGAAQAILPNWVRGRALAVYQMVFNGALAGGSLVWGFVAQALGTPHALLIA
                     AAGLVVTALILHRMRLPGGDEDLGPARHWPEPEMAGEIAQDRGPVMILIEYCIPPANR
                     DAFLHAVHKLSEERLRDGAFSWGVMEDPANPELLTEWFLVESWAEHLRQHQRVPHADA
                     DVQRDVASFHVGAEPPHVRHLLGLGLPPA"
     gene            complement(298409..298843)
                     /locus_tag="CNE_RS19470"
                     /old_locus_tag="CNE_2c02740"
     CDS             complement(298409..298843)
                     /locus_tag="CNE_RS19470"
                     /old_locus_tag="CNE_2c02740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951981.1"
                     /db_xref="GI:503717905"
                     /translation="MTISTPPLATAGNNTHRLPRWLRWIALLLLCAAYLQGGLVKLFD
                     FSSAVTEMQHFGLSPAVPLAAATIALELGASAMILTGFWRWLGALALAAFTLMATFLA
                     NRFWSAPPEAQFMMANAFFEHLGLVGGFLLVAWDDLRTRRQP"
     gene            complement(298872..300818)
                     /locus_tag="CNE_RS19475"
                     /old_locus_tag="CNE_2c02750"
     CDS             complement(298872..300818)
                     /locus_tag="CNE_RS19475"
                     /old_locus_tag="CNE_2c02750"
                     /EC_number="3.5.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013951982.1"
                     /db_xref="GI:503717906"
                     /translation="MSITRRHFIASAAALGAAASSELFAMSPNPTPDLILVNGKFATL
                     DRANPQADAVAIQDGRFVGVGTRQDIMKLAGTQTRVIDLNGRRAIPGLIDSHMHIIRG
                     GLNYNMELRWDGVRSLADAMRMLKDQVARTPAPQWVRVVGGFTEHQFAEKRLPTIDEL
                     NAVAPDTPVFILHLYDRAILNGAALRAVGYTKDTPNPPGGEIVRDARGNPTGLLLAKP
                     NATILYATLAKGPKLPPEYQKNSTRHFMREVNRLGVTGVIDAGGGYQNYPEDYSIIEE
                     LHKEGHLTVRLAYNLFTQKPKEELSDFKTWTSTVKPGQGDDLYRHNGAGEMLVYTAAD
                     FEDFRVERPDMAPSMEADLEPVIRLLAEKRWPWRLHATYDQTITRALDVYEKVAKDIP
                     FNGLNWFFDHAETISDRNIDRIAALGGGIAVQHRMAYQGEYFVERYGARAAEATPPVK
                     KMLERGVKVGAGTDATRVASYNPWVSLYWLTTGKTVGGMSMYPQANLLDRETALRLWT
                     EANTWFSSEVGKKGQIKVGQLADLAVLSADYYSVPGDDIQDITSVLTVLGGKVVYGDS
                     EFGKHSPDIPPAMPDWSPARHGSQYQPRPQAQARALALNTACGCASSCGVHGHAHANA
                     WTSSVPTSDESTFWGALGCSCWAF"
     gene            complement(300825..301613)
                     /locus_tag="CNE_RS19480"
     CDS             complement(300825..301613)
                     /locus_tag="CNE_RS19480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011519716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035825135.1"
                     /db_xref="GI:737857975"
                     /translation="MFYKDWGTGSPVVFSHGWPLNADAWDAQMLFLVQKGFRVIAHDR
                     RGHGRSDQPAQGNNMDTYADDLAALLDALDIKGATLVGHSTGGGEVAHYIGRHGTKRV
                     AKAVLIGAVPPIMLKTAANPNGLPMEVFDGIRKGVAENRSQFYKDLTTPFFGFNRPGA
                     KVSQGTIDAFWAQGMTGGLLGQYACIKEFSEVDYTGDLKKITVPTLILHGDDDQIVPI
                     DNSARLSAKIVKNATLKVYPGASHGMCVINADQVNADLLAFLNA"
     gene            complement(301931..302617)
                     /locus_tag="CNE_RS19485"
                     /old_locus_tag="CNE_2c02770"
     CDS             complement(301931..302617)
                     /locus_tag="CNE_RS19485"
                     /old_locus_tag="CNE_2c02770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="WP_013951984.1"
                     /db_xref="GI:503717908"
                     /translation="MSNPKLEVLTPQNSQLIFIDHQPQMAFGVQSMDRQAMKNNVVGL
                     AKAAKIFNIPTTITTVESESFSGFTYPELLDVFPDQKTLERTSMNSWDDQKVRDALKA
                     NGRNKVIVAGLWTEVCNTTFALCAMLEGNYEIYMVADASGGTSKEAHDYAMQRMVQAG
                     AVPVTWQQVLLEWQRDWAHRDTYDAVMKLVKEHSGAYGMGVDYAYTMVHKAAQRTATG
                     HESIAPVPAR"
     gene            303094..303756
                     /locus_tag="CNE_RS19490"
                     /old_locus_tag="CNE_2c02790"
     CDS             303094..303756
                     /locus_tag="CNE_RS19490"
                     /old_locus_tag="CNE_2c02790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_013951986.1"
                     /db_xref="GI:503717910"
                     /translation="MTINSFVTADTSGASDEAMVLIVDDDAMLRGALENLFRSVGMRV
                     ALFASAAELLAFAFPDAPTCLLLDVRLRGQSGLDLQTRLSQMGIQVPIIFMTGYGDIP
                     MTVAAMKAGAEDFLAKPFREQDLLDAVAAALQKDQHRRHGMRKLDELRASYQSLTPRE
                     AEVMRMVVAGLLNKQIASELSISEVTVKIHRGQAMRKMKARTFAELVLMAQQLGICEA
                     PH"
     gene            complement(303778..309285)
                     /locus_tag="CNE_RS19495"
                     /old_locus_tag="CNE_2c02800"
     CDS             complement(303778..309285)
                     /locus_tag="CNE_RS19495"
                     /old_locus_tag="CNE_2c02800"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_013951987.1"
                     /db_xref="GI:503717911"
                     /translation="MNSLFSFGTETGVGFQVAWEDGDRVVGRGWLLGPEGEPKAVLAV
                     WPAAEHPPPSTLARLAHEYGLKGELDGSWAVRPLALVGEHGRTVLLLEDPGGEPLAGL
                     LGAPMEGGRFLRQAISIAAALDQLHQRGLIHKDLKPAHILVNDALGEARLTGFGIATR
                     LSRERQGLAPPEEIAGTLAYMAPEQTGRMNRPIDARSDLYSLGVTLYQMLTGVLPFAT
                     DDPMDLLHSHLARQPVPPAERIPSIPALLSAIVMKLLAKTAEERYQTAAGLEADLRRS
                     LTAWESLGRVDTFPLGEHDLPDRPLIPERLYGREREIETLLAAFDRVVTQGTPEIVLV
                     SGYAGIGKTSVVFALRSALALRNGLFASGKFDQYKRDIPYATLAQAFQNLIRPLLGKS
                     EADLAPWRATLAQALGPNGGLMVPLIPELGLILGPQAPVPELPPRDEQHRFQMVFQRL
                     LAVFAQPAHPLALFLDDLQWLDAATLDLLEYLATQPEVRHVLLIGAYRNDDVKPGHPL
                     LLRLSAIRQAGGRVNDIALSPLGFEDVSRLIVDALHCAPGDAAPLARLVQEKTGGNPF
                     FAIQFLTALTEEGLLVFDHRGARWSWDLEQIRSKGFTDNVVDLMLAKLRRLPAATRSA
                     LKQLACLGNDAAIATLAMVQDASEAVLDAALWPAVRAGLVLHLGNTYRFQHDRIQEAA
                     YALIPEDARPAAHLAIGRRLAAGTPPEAIAERVFEIVGQLNRGADLITAAEEREQVAE
                     LNLLAGQRAKASTAYASALTYLTAGEALMQGDAWKRRPKFAFALEFHLAECEFLTGAP
                     AAADARLAELACRAASLPDLASVTQLRLELFLALGQRERAVEVGLDYLYRAGVQCSAH
                     PTDEEVLQEYDRMWRQLGDRPIEALLDLPMMTNAVACETMDVLTALMLPAWYTDVNLG
                     SLIIGRMANLSLEHGNSDASCLAYTWLGMLLGPRSGDYKAAFRFGQLGLNLVEQRGLD
                     RFRARVYQAFGGHVMQWTQPIRAARSLVRRAFDVASKLGDLTYASFARNNLITQLLAC
                     GDPLAEVQNEAEATIGFARRASFGLAVDRVTPQLQLARTLRGLTPVFGVFDDDDFNEE
                     QFERYLDEAPGPALATCWYWIRKLQARFLADDHAAAITAADRAESLLWTSPSFFEQAE
                     YHLYAALARAACCGTAAAPERTRHLEALAAHHRQLLVWSEHCPENFENRAALVGAEIA
                     RLDGREVDAMRLYEQAIRSAQDNDFIHNQALANELAARFYAARGFEKVARVYLQDARH
                     GYLRWGAGGKVRQLDALYPHLWGEERAPAPTTTIGAPVEHLDLATVIAVSQAVSGEIV
                     LDKLLDTLMRTAIEQAGAVRGLLILPRGAEQRIAAEATTSGDIVTVQLRDESVTATAL
                     PVSMLHYVLRTRENIILDNAATQNPFSADPYILQHHARSILCLPLLTQAKLIGVLYLE
                     NNLSPRVFAPSRTAVLKMLASQAAIALEITCLYRDLAQREAKIQRLVEANIIGICIWH
                     LDGRILEANDAFLRMLGYDREDLASAPLRWTDLTPPDWRERDARLLQDLRISGTLPPF
                     EKEFFRKDGSRVLVLLGCATFEEGGDQGVSYILDLTERKRAEEALHQAQAELAHVTRV
                     TTLNALTASIAHEVNQPLAAIVTNANAALRWLARQPPDLAEVRETLGRIVQDGHRAGA
                     VIGGMRALLKKTAAVTARLDMNTLIEDTIALIQGEVGRHQVLPRTELAPDLPPVVGDR
                     VQLQQVLLNLMMNSIEAMKEVAERPRELLIRSRLDASGAVLVAVQDAGIGLEPQDLER
                     VFQTFFTTKAEGLGMGLAICRLIVEAHGGRLWASPNVPCGAVFQFTLPPQD"
     gene            complement(309754..310866)
                     /locus_tag="CNE_RS19500"
                     /old_locus_tag="CNE_2c02810"
     CDS             complement(309754..310866)
                     /locus_tag="CNE_RS19500"
                     /old_locus_tag="CNE_2c02810"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase"
                     /protein_id="WP_013951988.1"
                     /db_xref="GI:503717912"
                     /translation="MTKHLMTPVHIGNHTLSHRVAMAPLTRSRAGQPGNVPTAMNVEY
                     YRQRASAALIVTEATQISQQGQGYAWTPGIHSGEQVQGWRAISDAVHEGGGTIFLQLW
                     HVGRVSHPVFQPDGALPVAPSALPVPGKTFILDESGNGVWGDVPVPQPLTTSGIRDIV
                     EDYRRSARNAIRAGMDGVEIHAGNGYLLDQFINSNSNARTDAYGGSIENRSRLLLEVV
                     DAVIAEIGASRVAVRLTPMGRFMGMGDDTPEATFGHIVRALSERRMAYLHLVEPAMVG
                     TDKDDDTDPRWDAIIRQLRTEYRGVLMLAGGYDRDSAEQALADGRADIIAFGRPFIAN
                     PDLPARFRNGLPLNTPDTASFFGGGASGYIDYPSAT"
     gene            complement(311156..312079)
                     /locus_tag="CNE_RS19505"
                     /old_locus_tag="CNE_2c02820"
     CDS             complement(311156..312079)
                     /locus_tag="CNE_RS19505"
                     /old_locus_tag="CNE_2c02820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013951989.1"
                     /db_xref="GI:503717913"
                     /translation="MDKLLALRVFVETVDAKGFSSAARRLSLATSSVTRMMDSLEEDL
                     GAVLLNRSTRQVTVSAAGAAYYQRARKILDAVAEADAQIADRGDTPVGQLRVSLPVAF
                     GRRCIAPFLGGLLARYPKLELEVTLTDEIVDLLSERIDLSIRLGSAASLDDVVARQIG
                     TFRRKVVASPAYLLRHSLPAAPLDLAGHECLRFSYGVGQQVWTFVRDGEEVQVPVRGN
                     FRSNNSEVLRELVMSETGIALLPDWLVAEDIQRGNLTSLFDDWSVNPNRATSAISALF
                     LPNQRGSRRIGAFLDFLGEIPGPTYRGDTAR"
     gene            complement(312081..312662)
                     /locus_tag="CNE_RS19510"
                     /old_locus_tag="CNE_2c02830"
     CDS             complement(312081..312662)
                     /locus_tag="CNE_RS19510"
                     /old_locus_tag="CNE_2c02830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041228775.1"
                     /db_xref="GI:752557543"
                     /translation="MVQKAIEHFTRNGFSGSTRELAKQIGVTQPLLYRYFESKDALIE
                     RVYNEVFQWRPDWERQIADRSTPLAQRLYAFYLDYASVILREEWIRIFIFAGLTREGI
                     NNKYLSKLRSKVFLPVLAEVRAEYGIPEPRSAAELDAEVEMIWSLHAAIFYLGVRKWV
                     YGLKVPADLGGVVRQKVDMFLQGAPAVMRSLRL"
     gene            complement(312912..314543)
                     /gene="actP"
                     /locus_tag="CNE_RS19515"
                     /old_locus_tag="CNE_2c02840"
     CDS             complement(312912..314543)
                     /gene="actP"
                     /locus_tag="CNE_RS19515"
                     /old_locus_tag="CNE_2c02840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951991.1"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="actetate permease"
                     /protein_id="WP_013951991.1"
                     /db_xref="GI:503717915"
                     /translation="MKRLSLFIALFSATLPAIAATPTVGQGLNVIAIVMFLVFVASTL
                     LITRWAARNTHSVADHYAAGGKITAMQNGWAIAGDYMSAASLLGISALVFTSGYDGLI
                     YSIGFLASWPIILFLIAEPLRNLGRFTLADVVSYRLQQRPIRAFSASSSIVIVLLYLV
                     SQMVGAGKLVELLFGFNYTAAVVLVGVLMVIYVFFGGMLATTWIQIIKAVLLLAGAGF
                     MAFMVLGRFGFSLNTLFAEAIAAHGKHTAIMSPGGLVSDPVSAVSLGLALIFGTAGLP
                     HILMRFFTVADVKAARKSILYATGIVGSGYALIIIIGFGTIALVANDPLYHNASGAVI
                     GGVNMVAVHLAHAVGGNVFLGFICAVAFSTILAVVAGLTLAGSSAISHDLYAKVLRQG
                     TATDKDEMRVSRMTTLVLGVLSILLGILFEKQTIAFIVSLTFSIAASSNFPVLLLSIY
                     WRGLTTRGAVVGGSLGLLTAVLLTVLSPTVWVQVLGHAKAIYPYEYPALFSMLVAFAG
                     IYVFSVTDKSARGARERGAFRNQLVDCELGLIKRQ"
     gene            complement(314540..314902)
                     /locus_tag="CNE_RS19520"
                     /old_locus_tag="CNE_2c02850"
     CDS             complement(314540..314902)
                     /locus_tag="CNE_RS19520"
                     /old_locus_tag="CNE_2c02850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013951992.1"
                     /db_xref="GI:503717916"
                     /translation="MEHLAATYPPSGDEATSTPLPPPNPVLSNPAFQALVRARRSFAY
                     TLTTLMLAVYFGYILTLAFNPALLGRPLTPGQPMSIGIPIGFGMFAITFFLVALYVHR
                     ANTVHDAMIHAIREGAAK"
     gene            complement(315000..316223)
                     /locus_tag="CNE_RS19525"
                     /old_locus_tag="CNE_2c02860"
     CDS             complement(315000..316223)
                     /locus_tag="CNE_RS19525"
                     /old_locus_tag="CNE_2c02860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase FAD-binding protein"
                     /protein_id="WP_013951993.1"
                     /db_xref="GI:503717917"
                     /translation="MTVFSRQPKAIVVGGSLGGLFAANLLSRDGWDVEVFERVPEALA
                     GRGAGIVTHPELFEALAAAGVQVDDSIGVRVQSRLTLSQDGSVLSQREMPQMLTAWGK
                     MYQVLRAAFHLGCYRPGGSVVSVESEPGRAVVTLDDGSTHSADLVIAADGFRSALRER
                     LLPDVQLQYAGYIAWRGLVDEMALSESTRDALFEKFGFCLPPHEQILGYPVAGQDNST
                     QPGERRYNFVWYRATSEDIDLPNLLTDASGKRWSGGIPPTLIRPDVLADMEEAALTLL
                     APQFGEVVTKAAQPLFQPIFDLEVPRMAFDRVALLGDAAFVARPHCGMGVTKAAGDAM
                     ALVKALRAHDTVPAALEGYSAERVQVGAAIVQHARHLGAYMQAQLKDETDRQMAERYR
                     TPEAVMRETAVSTRF"
     gene            complement(316226..316714)
                     /locus_tag="CNE_RS19530"
                     /old_locus_tag="CNE_2c02870"
     CDS             complement(316226..316714)
                     /locus_tag="CNE_RS19530"
                     /old_locus_tag="CNE_2c02870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013951994.1"
                     /db_xref="GI:503717918"
                     /translation="MAIMKLAHYSIRTTDLDRSCAFYQRILGFRQGYRPPFDFPGAWL
                     YLGDDESEFGVVHIIGVDPDNLFGLSAYLGDRLLPVSGTGTVDHIAFLATGVQEMWAK
                     LKAEGVAWRDRTVPSLGLHQVFIEDPSGVTIELNYPAAEVAGLDIPGGSATAHSMAVT
                     GE"
     gene            317121..318236
                     /locus_tag="CNE_RS19535"
                     /old_locus_tag="CNE_2c02880"
     CDS             317121..318236
                     /locus_tag="CNE_RS19535"
                     /old_locus_tag="CNE_2c02880"
                     /EC_number="4.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminocarboxymuconate-semialdehyde decarboxylase"
                     /protein_id="WP_013951995.1"
                     /db_xref="GI:503717919"
                     /translation="MDCPCCVSPKRRRLLGSVSAIAAGMMAGLPALAAQPSTAAAGTG
                     KPLSIDIHAHYYSESFLGLLGGEGKQFGGHFFRNDDSFTFQTPAGGLGPLPMKFIDVE
                     QRVRDMDNSGVDVQAISLSVPMVYWADRTLNAKLARAWNTAASDVHRKHPTRFVVLAT
                     LPMLNANDAIDELEFAAGLPGVRGIYMGTNINNRDLDDPLFSPIFKRIEQLNLPIFLH
                     PQQTVGGARLADFYLSNLLGNPFDTAIAASHLILGGVLDKYPALHFSLPHAGGALPIL
                     VGRIDAGWSMRSETKRVAQKPSSYLRRFSYDTISHSGPTLDFLIRNIGADRLVLGSDY
                     CFDMGYEQPVRFLDRLALPDDQKRMVVGGNAARLLNL"
     gene            complement(318335..319447)
                     /locus_tag="CNE_RS19540"
                     /old_locus_tag="CNE_2c02890"
     CDS             complement(318335..319447)
                     /locus_tag="CNE_RS19540"
                     /old_locus_tag="CNE_2c02890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013951996.1"
                     /db_xref="GI:503717920"
                     /translation="MPRDHLIGDLYEAAVREDGFLEVFQTVAESLGANVFHMFSWDAL
                     RNAPRLSIYTPDRDWDAIVESYDQYYGALDPRRSFVEAAALGEFVCCQDRLTEQDVAR
                     SEFFQDYQLPSGLRYLQGVRLARAGSDDILLGLLRAKDRPPYTLEERAAAAGLVGHLQ
                     RSINLWQDARTLHRDAALGNELMEQLGLAVFTLDRRFRLVFANQAAEAMLRASACLKL
                     EHERLAATTAAENDGLQAAMARVGKTRKGESLALRAASGATPEIFLNIARVPGRDTRA
                     AFGDATLLVTARRRGTAPLVTARQLQGAFRLSAAEAAVAEALICGKTPDEYAASARVS
                     LATVRTQLRAIFDKTNTRSQAEAVGAMLWVLSQAGG"
     gene            319715..321313
                     /locus_tag="CNE_RS19545"
                     /old_locus_tag="CNE_2c02900"
     CDS             319715..321313
                     /locus_tag="CNE_RS19545"
                     /old_locus_tag="CNE_2c02900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951997.1"
                     /db_xref="GI:503717921"
                     /translation="MKIRLLISAIAAAALTACGGGSSDTQSSAPSTPSTPGTPATTIA
                     GTAAVGSALPNATVQAKCANGSGTATTAADGTFTISIPDATRPCVLSVTTPDGTILHS
                     VVEAGTGTTAAANITPLTELITASIAGGSTQDFFNSFDAQAQAKLTTDGVATAVESVK
                     LILSGTVDLAGVDPLKGTLVAAHGDTPGNALDQKLDTLGAALESSQTSLSQLSAAVAS
                     NSGSAAGVQTILQPASATCATFRSGKYQKVGLTANSVQRFTIDAVKLTQTNDTTGAVE
                     QFQANDTQACRFGNTDARLLVSKSGIGLERRNGPSSLVIPDQTIPLSEITGDWIAMGF
                     ERPEGGGTLAPGLIKFTVDSTGKFASGADCGLSGCSPWPAEDLPVVSVNADGGFNVTD
                     STGTARAFAFKGVDGGVAVVIVHKGGFMIAKRPTPRGLPAVGAVNAYWDAVININGGT
                     EISEYSNTVTSVDTAANTYTRQRNDGRVDLWHNNMPSDGLRYRPAAPNAAEVIGMNVA
                     NTGLTVAISVNPANSFYDISVDRP"
     gene            complement(321461..321955)
                     /locus_tag="CNE_RS19550"
                     /old_locus_tag="CNE_2c02910"
     CDS             complement(321461..321955)
                     /locus_tag="CNE_RS19550"
                     /old_locus_tag="CNE_2c02910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013951998.1"
                     /db_xref="GI:503717922"
                     /translation="MSWTNRGAAAWEQVLGRSREAHAVVIDDMPVYRHGVMRLLGEMP
                     GIGRVELVETDALAARNARLPAPPLLVFGMPPDLADGWHLLRLASLVLKPRRLLLVSD
                     NMWLRLPPGLDGRFARSLSRSASLATVERDVRALLELPSAAEAPPGQDAGSVAFQRPF
                     HVLA"
     gene            322321..322728
                     /locus_tag="CNE_RS19555"
                     /old_locus_tag="CNE_2c02920"
     CDS             322321..322728
                     /locus_tag="CNE_RS19555"
                     /old_locus_tag="CNE_2c02920"
                     /EC_number="2.3.1.157"
                     /EC_number="2.7.7.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013951999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013951999.1"
                     /db_xref="GI:503717923"
                     /translation="MQAHPLRLSPGDDLRAALEDVLSQLKLHAAFVIQGIGSLSVAQL
                     RFAGAEGPTELRGNLEVLTLAGSLSSDGAHLHMSVADSRGRVFGGHVARGCTVRTTAE
                     ILLALLPEHRFAREYDQNSGFMELVVRTEQPME"
     gene            complement(322839..323305)
                     /locus_tag="CNE_RS19560"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            323830..324480
                     /locus_tag="CNE_RS19565"
                     /old_locus_tag="CNE_2c02940"
     CDS             323830..324480
                     /locus_tag="CNE_RS19565"
                     /old_locus_tag="CNE_2c02940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013952001.1"
                     /db_xref="GI:503717925"
                     /translation="MPPRTISAVIADDHPVIQLAVKTTLSEIPNVQVSAMCASGRELF
                     AALEAHRPDLIVTDFTMGRSEESDDGLRLIRRLKQSSPDTPIVVFTMLTNGGLLTRIQ
                     ETGIAGIVGKNEDPGILRQICIDAISGQGLRLSPGVSARMSSAGALAGASASALSPKE
                     IEVVRMFAAGSTVTAIAGYLHRTLATVATQKRSAMRKLNITSNADLVAYARDNGLT"
     gene            324477..327398
                     /locus_tag="CNE_RS19570"
                     /old_locus_tag="CNE_2c02950"
     CDS             324477..327398
                     /locus_tag="CNE_RS19570"
                     /old_locus_tag="CNE_2c02950"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013952002.1"
                     /db_xref="GI:503717926"
                     /translation="MMQGTFEPSPDLRAVERNLQRERRVFSLVIVLLGLLAVAIASTG
                     VFVQLNGSLRAQEQVARLYEQGVVDAVLERRSTLAASNLILELRANGTLALSPGSQGG
                     LCTQVFPSAPADDVLQQSCDQSVGTLIAASQRPSIEMISIASGATYRYESPDASGSAA
                     RSIPPPMPPALITRTILDRFRSRDIDVLQAAREKRVEWLGVPASAAGTDPEMVGASLV
                     AKGDTLYAVVLTRIPLHELLRPAGPNLSIPEPIVFDSLGTPLVAAGARANAQHLNARL
                     EARPDGLFHWVPDYGWAVRRPPLVADFGHLIFALPIGHQIRGMTEELIVIGAITAVLI
                     ALLFAMYRYWNYRFLTGTYAEAARAQRLLHEARLATEAAARARVAFFASMSHEIRTPL
                     ASLLGNMELVAMGPLGPEQRMRVGAMQVSAEGLLQIVNDVLDFSKIDVGALSIEVQPV
                     SVTELLGRIAIAHAPLAAQRGLSFLAVYSSRIPSQLDLDPVRLTQIVNNLLGNAFKFT
                     QAGKIVLRAQWLEGNLEIVIADTGIGIPDEYRDRLFQPFSQVADNRIAQARGTGLGLS
                     ICMRLVERMGGRIMLDSTLGVGTRVTVRLPLGVSDAVPPPVRPGLPPNRTLVLSREPE
                     CIEGLLNHFDWGACQPSARSNLDEPVDADSYDCLLVTEAFDPGHVMAWWPKPASVVWL
                     KQLGPLVATTRPDGGREVSSYSLAGIHAAALAVITGAQPPKRSEEGLVGRPTSPLVGH
                     AVLIAEDNLLNRNLLRDQLRALGARVIVAGNGIEAMAALRGNRMNAVLTDIDMPVMNG
                     FDLLREMRHAGIDIPVYAVSASARPEDVAEGRARGFTGYLTKPVSLAALASVLARGDD
                     GVGHEDVEQTTASPGDDALPELPRIPAGYVEAFLAQTGADLDKYDAIRAGRDMTGLAQ
                     LLHRIAGGLAVVGPSELAELCEDLRDYAADADGWDDEIELQSAYIAQSLRQLCQCLSA
                     G"
     gene            327707..328213
                     /locus_tag="CNE_RS19575"
                     /old_locus_tag="CNE_2c02960"
     CDS             327707..328213
                     /locus_tag="CNE_RS19575"
                     /old_locus_tag="CNE_2c02960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952003.1"
                     /db_xref="GI:503717927"
                     /translation="MSNRPDFALAACTAFVLMSGAVSGTAATARAQTMLQKPYAYPAR
                     GQSAYQQTNDDGACYGWARQQTGINPYRVASTPVPVIVPGGERIRGAAGGAAAGAVAG
                     AIGGDAGKGAAAGAAVGTIAGGVAHRQQRRQAVAASAQAQASNDWAMTSYWQAWRACM
                     TGRGYSVQ"
     gene            complement(328308..328754)
                     /locus_tag="CNE_RS19580"
                     /old_locus_tag="CNE_2c02970"
     CDS             complement(328308..328754)
                     /locus_tag="CNE_RS19580"
                     /old_locus_tag="CNE_2c02970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952004.1"
                     /db_xref="GI:503717928"
                     /translation="MNAVSPIVAGLVAVAAASALSGCAIPTAETLSPFQEPWPWTKLV
                     AVNRTDHDVLAVRAGHCETGPSLRQSQSAPSFCFLGKKPERPIAITWNDAGAGAQHTS
                     TVPLPPLWPEDPRPEDLTGGYLCVLLRNDARVSLTVTASAQACAVL"
     gene            329023..329352
                     /locus_tag="CNE_RS19585"
                     /old_locus_tag="CNE_2c02980"
     CDS             329023..329352
                     /locus_tag="CNE_RS19585"
                     /old_locus_tag="CNE_2c02980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008643472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228524.1"
                     /db_xref="GI:752557292"
                     /translation="MINNCRPAVRAFGIALLIAGAGQAYAQLPRGLESKGLRDQPDAC
                     AQAGLASKPAVCRAAGEPASSKYNLLYADAASADEGEDESPSHRHAGHARDDAYRGGP
                     RNEATGS"
     gene            329406..329900
                     /locus_tag="CNE_RS19590"
                     /old_locus_tag="CNE_2c02990"
     CDS             329406..329900
                     /locus_tag="CNE_RS19590"
                     /old_locus_tag="CNE_2c02990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952006.1"
                     /db_xref="GI:503717930"
                     /translation="MKLRPYLLAGIGLLASSEPAFASVLSGKALETAANAISWVVLFF
                     VPVAGVYLFWMLHIWPEKIAHRKRHPQKEAIHSLCLLSLFFGGLLWPLAWLWAHTKPV
                     FYRAAYGTDKAPEDDDAPGHDKVPSTQVAGHGVSYGPRNIVTLRASTAMDIASGKHAG
                     KEQI"
     gene            329901..331079
                     /locus_tag="CNE_RS19595"
                     /old_locus_tag="CNE_2c03000"
     CDS             329901..331079
                     /locus_tag="CNE_RS19595"
                     /old_locus_tag="CNE_2c03000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008643476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_013952007.1"
                     /db_xref="GI:503717931"
                     /translation="MDALLLGVYALAVWLIFFKFRWLPWNTTSMVIVFTIPVVAMTML
                     VLTLNVVAPSSHDVRVVGKVLQVVPQVRGRIVELPAEGNRRYKKGDVLLRIDPTPYQA
                     SVRQLEGRLMADDAALAEAEASARQLSESVRGAAGRVSTVQARLSLARQRAKEHDALL
                     AAGAGSKFDREDALTRQRELEGELVSAQATEDEARQKLSARSQGEFAAIATARAKRAE
                     TEVMLENARWELEQTVYRAPSDGKVVNLQVRVGTMLVPFPFSPAFSFVEDSQEVVAFY
                     NQNELYNVKEGDRAEIYLPTNPGEIIKAKVNSIVWAQSQGQIAQGGMIPNTGATEVVP
                     NRFAVKLDLRDQSSGLMLPVGAVGAGAIYTEHMEMFHIIRMVFLRVSSKLNYLVFKLH
                     "
     gene            331124..332509
                     /locus_tag="CNE_RS19600"
                     /old_locus_tag="CNE_2c03010"
     CDS             331124..332509
                     /locus_tag="CNE_RS19600"
                     /old_locus_tag="CNE_2c03010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_013952008.1"
                     /db_xref="GI:503717932"
                     /translation="MSSFQLKKTLLLALPVAMLCGCALQTPPEGAALRRQAVPALEGQ
                     ATWANAATAGAAANGWLATFDDAELQRLVREAIAYNGDLRLAAVRVHQAQALVAIQRS
                     GMLPSAGVKGRAGNSETQILSIGASWEIDLWGRIRAQSRAAESQYAATRDDYLWAQRV
                     VAATTARAWFTLIQNATLEDRLRQIAAIQDELVRITGQRVEIGIAPETELLEARNALR
                     AQRDAIGKAELARSQAAQALELLLGRYPAGEIATGPELPAMPPAPAAGLPANLVERRP
                     DLTASAHRVAAAFDMRQSAEAARLPGISISAAITGIRSDVFLLNQAGSPIKGLSGSFF
                     APIFTGGELKARADYYSAEEKAALIAYGNTALQALSEVEAGLQAESGYDERTRQLRER
                     VDESRGLVLREEARAGIGASDTRSVLKQRQALVAAEMDLINVQANHLNQRIALLLALG
                     GDWKDEAGAGA"
     gene            complement(332891..333589)
                     /locus_tag="CNE_RS19605"
                     /old_locus_tag="CNE_2c03020"
     CDS             complement(332891..333589)
                     /locus_tag="CNE_RS19605"
                     /old_locus_tag="CNE_2c03020"
                     /EC_number="3.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013952009.1"
                     /db_xref="GI:503717933"
                     /translation="MSNKPTVVLVHGFWGGAAHWRNVIIELARKGYTSLRAVELPLTS
                     LADDAERTRKMIAQQAGPVLLVGHSYGGAVITQVGDQPNVIGLVYIAAFAPDAGESPG
                     AITQQHLPAAAPNLVPDSDGYLWLNPDKFHESFCRDLSPDEALVMAVTQKAPLASTFG
                     DTITAPAWKKKPSWYQVSSEDRMIAPENQQKMAARLNARKVVTLAASHASLASKAADV
                     AALIDEAASEAIKA"
     gene            complement(333811..334782)
                     /locus_tag="CNE_RS19610"
                     /old_locus_tag="CNE_2c03030"
     CDS             complement(333811..334782)
                     /locus_tag="CNE_RS19610"
                     /old_locus_tag="CNE_2c03030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_013952010.1"
                     /db_xref="GI:503717934"
                     /translation="MSKVALFGAAGAIGQSVAAALRSKGRPYRVVGRSAGSLRTAFGT
                     DPLAEVVTWNPDSPESVQAAASGIETLIYMVGVNYWQFQLHPELMRKTLDGAVAAGVK
                     YFILIGTVYPYGRVQTGNPVREDHPREPHTFKGRMRKAQEDLLMQADASGRIRATVLR
                     LPDFYGPGVQASLLHRAAQAAVNGGTADMIGLLDQPHEFVYVPDVGPVVARLIDTPAA
                     FGKIWHLAGAGVTTQRELVSEMERQTGRTLKLRVAGKTMLRLLGLFNPFMRELVEMHY
                     LMTDPLVMDDSALQRLVGPIRKTPYVEGIRQTLAAVRETQPTAIAAA"
     gene            334897..335793
                     /locus_tag="CNE_RS19615"
                     /old_locus_tag="CNE_2c03040"
     CDS             334897..335793
                     /locus_tag="CNE_RS19615"
                     /old_locus_tag="CNE_2c03040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952011.1"
                     /db_xref="GI:503717935"
                     /translation="MPKREPDWEWYRAFLHVLETGSLSAAGRAMGLTQPTVGRHIDSL
                     EAALGLKLFTRSFDGFAPTDAAHELKPYAAGIAATAAAMRRVASGHGAGVRGTVRLSA
                     SEVIGVEVLPPILAALHNEHPELEIELVLSNQADDLLRRDADIAVRMFRPEQAALVAT
                     RVGGIELGLHAHESYLASHGVPKSLADLSRFAAIGFDQENAFIRRLQARFKAFSRDAL
                     AFRADSDLAQLGAIRAGFGIGVCQSALAARDPRLVRVLPSQFSMTMDTWVAMHEDLRE
                     SARCAVTFAALAAGLRAYAEGA"
     gene            complement(335808..336827)
                     /locus_tag="CNE_RS19620"
                     /old_locus_tag="CNE_2c03050"
     CDS             complement(335808..336827)
                     /locus_tag="CNE_RS19620"
                     /old_locus_tag="CNE_2c03050"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_013952012.1"
                     /db_xref="GI:503717936"
                     /translation="MDRKSELQATVDALAQAGRGLLAADESGPTIAKRFERIGVESSE
                     ENRRAWRNLLLSTPGLGEFISGVILYEETLGQRADDGTPLPELAARQGIVPGIKVDKG
                     KIALALAPGDEVTEGLDGLAKRLAGYRQQGARFAKWRAVYNVSDKLPGWAAVQANAEA
                     LARYAAICQEAGVVPIVEPEVLMDGAHSMARCAEVTEAVLHAVFHALHRHAVVLEHML
                     LKPSMVLPGKDAGHAPPAEVAMQTVQVLKRTVPAAVPGIFFLSGGQTPTEATVNLDAM
                     NRLAPLPWRLSFSYGRALQEPPLLAWRGDAANAAQAQRALLQRSRLNAMACLGQYDAA
                     QENAG"
     gene            complement(336913..337248)
                     /locus_tag="CNE_RS19625"
                     /old_locus_tag="CNE_2c03060"
     CDS             complement(336913..337248)
                     /locus_tag="CNE_RS19625"
                     /old_locus_tag="CNE_2c03060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952013.1"
                     /db_xref="GI:503717937"
                     /translation="MAATKSTRRPAKGRAKAGTSKGRRWSQQVTEHSDALDLEPHLFA
                     SDNPEEIAASLKRSAVSSRRRKGTAFQSAMSMLNFYINRAGRHLPKARRATLEKAKGK
                     LREAFGRPP"
     gene            337473..339332
                     /locus_tag="CNE_RS19630"
                     /old_locus_tag="CNE_2c03070"
     CDS             337473..339332
                     /locus_tag="CNE_RS19630"
                     /old_locus_tag="CNE_2c03070"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952014.1"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_013952014.1"
                     /db_xref="GI:503717938"
                     /translation="MPTYRSKTSTAGRNMAGARSLWRATGMKDEDFSKPIVAVVNSFT
                     QFVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTRLANPVT
                     KAMEFKKLDLVDAMVIAADSAYSDADVAEVERSACPTCGSCSGMFTANSMNCLTEALG
                     LSLPGNGTVVATHADREQLFKRAGSRIVELARQYYEQEDARVLPRSVGFKAFENAMTL
                     DIAMGGSTNTILHLLAIASEAGIDFSMTDIDRLSRVVPQLCKVAPNTNKYHIEDVHRA
                     GGIMAILGELERAGKLHTDVPTVHAPTLKDALEQWDISRTQDEAVRNFYLAGPAGIPT
                     QVAFSQNTRWPSLDLDRAEGCIRSYEHAFSKEGGLAVLRGNIALDGCVVKTAGVDESI
                     LVFEGTAHVTESQDEAVENILNDKVKAGDVVIVRYEGPKGGPGMQEMLYPTSYIKSKG
                     LGKACALLTDGRFSGGTSGLSIGHCSPEAAAGGAIGLVRDGDKIRIDIPNRTINVLLP
                     DEELASRREAQNAKGWKPAKQRPRKVSAALKAYAKLVMSADKGAVRDLSLLDD"
     gene            complement(339494..340249)
                     /locus_tag="CNE_RS19635"
                     /old_locus_tag="CNE_2c03080"
     CDS             complement(339494..340249)
                     /locus_tag="CNE_RS19635"
                     /old_locus_tag="CNE_2c03080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter permease"
                     /protein_id="WP_041228776.1"
                     /db_xref="GI:752557544"
                     /translation="MRCLLTLIALAAAVSGSFAYLSLDLSQLLSADAAAEMGRFLLTF
                     FPPELSSAFLARTAGGMLETLAVSAVGTLCAAVLGFGLALPASGLYGDALRTLSRLLL
                     NVLRSIPELVWAALTVLAVGLGPFAGTLALALHTAGVLGRLFAEALENAPRAPARALT
                     EGGTPAVLVFMYGTLPCVWPQFLAYILYRWETNIRVAAILGFVGAGGLGQMLYFELSL
                     FHLPQACTVIIAMLALAAVVDTASAIMRAGWHS"
     gene            complement(340286..341107)
                     /locus_tag="CNE_RS19640"
                     /old_locus_tag="CNE_2c03090"
     CDS             complement(340286..341107)
                     /locus_tag="CNE_RS19640"
                     /old_locus_tag="CNE_2c03090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952016.1"
                     /db_xref="GI:503717940"
                     /translation="MTTHPRDPQALQRASGLVLALLLLWPLLRLSRFSPSALFDTENL
                     KVMGAFVRNFLPPEVSPGFLGLVVNATLETLAIATAGIALAFVIATPLAVAMTGSLSV
                     SRIGPGRGRKPRMAVRAGVRTLVLLLRGVPELVWALVFVRALGLGATAGVLALAITYG
                     GMLAKVYAEILESSDKRAVDALFGSGSGRLAALFYGLLPHAAQELVSYTVYRWECAIR
                     ASVVMGFVGAGGLGQLMDQAVKLLNGGEAATILLVFLLLVLLADALSARLRKLID"
     gene            complement(341104..341946)
                     /locus_tag="CNE_RS19645"
                     /old_locus_tag="CNE_2c03100"
     CDS             complement(341104..341946)
                     /locus_tag="CNE_RS19645"
                     /old_locus_tag="CNE_2c03100"
                     /EC_number="3.6.3.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter"
                     /protein_id="WP_013952017.1"
                     /db_xref="GI:503717941"
                     /translation="MSFRLDAASVSYANGQRALSQITLAASRGEPIAVIGPSGAGKTS
                     LLRLLATSLRPSEGRVEVLEQSPWAVSAARLRQLRCRIGMVHQAPPMPPRQRVITAIL
                     AGRLGVWPGWKSLLSLVYPADIDGAGEQLARLELADRLFDRCDQLSGGQLQRVGVARV
                     LYQRPELILADEPVSAMDPVLANLTLGELRREADTRAVPLVASLHAVDLALRWFPRIV
                     GLKAGEIAFDLPAERVTDTLLRELYASESASPPVQGSQALMSIAAGASAAIDGDTPSR
                     PACR"
     gene            complement(341957..342808)
                     /locus_tag="CNE_RS19650"
                     /old_locus_tag="CNE_2c03110"
     CDS             complement(341957..342808)
                     /locus_tag="CNE_RS19650"
                     /old_locus_tag="CNE_2c03110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013952018.1"
                     /db_xref="GI:503717942"
                     /translation="MLPLLKRLAALTLLGFAGLAGAQAVLKVSAIPDESPTELQRKFA
                     PLGNYLEKETGMKVKFVPVTDYAAVVESLATGKIDMAWLGGFTYVQSKIRTKGATIPI
                     VQRQEDAAFTSKFITANSAIKSLADLKGHTFVFGAPSSTSGHLMPRHFLLQAGIDPDK
                     DFKTVAYSGAHDATVAFVQAGRADAGVLNASVWDKLVEQHKVDPAKVRVFAVTPPYYD
                     YNWTVRGGLDPALRKKLTEAFLRLDPANPEQREIMALQRTARYIPTRPENYAGIEAAA
                     RAAGLIQ"
     gene            complement(342792..343847)
                     /locus_tag="CNE_RS19655"
                     /old_locus_tag="CNE_2c03120"
     CDS             complement(342792..343847)
                     /locus_tag="CNE_RS19655"
                     /old_locus_tag="CNE_2c03120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="segregation protein A"
                     /protein_id="WP_041228525.1"
                     /db_xref="GI:752557293"
                     /translation="MDQPNNAKIKLTAFSHGGGCGCKIAPGVLSEILRNSVGFPAPAA
                     LLVGKETSDDAAVYQLNDSQALIATTDFFMPVVDDPYDFGRIAATNAISDVYAMGGTP
                     IMALALVGMPIEKLPPEVIGKILEGGESICAQAGIPVAGGHTIDSLEPIYGLVVLGLV
                     HPNRVKKNSGAEAGDKLILGKPLGVGVLSAAVKKDKLDAAGYQDLIACTTKLNTPGRL
                     LAEVPGVHALTDVTGFGLLGHLLELCRGAGVGARLDMGRIPLLPRVERMAAEGLVTGA
                     SGRNWVSYGSEVDLSTSVTPSQKALLTDPQTSGGLLVSCAPEAVDEILEIFRRDGFAD
                     AAVIGEMTQGAARVAVA"
     gene            complement(343862..344857)
                     /locus_tag="CNE_RS19660"
                     /old_locus_tag="CNE_2c03130"
     CDS             complement(343862..344857)
                     /locus_tag="CNE_RS19660"
                     /old_locus_tag="CNE_2c03130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_013952021.1"
                     /db_xref="GI:503717945"
                     /translation="MRPPKATVAIISPALRKANNGNWQTANRWARFLQGDYDVTLAAE
                     WSTASQGGALPDCLIALHARRSAESIARFAEACPDRPLIVVLTGTDLYRDIRTDASAQ
                     RSLALATHLVVLQDEGLAELAAAHRARCRVIYQSAPACAPAAPSQDHFDVVLVGHMRA
                     EKDPLTPMRALSLLPHDSRVRLIHIGGALDDAYQQAALALEAQAWPGVRRYVWLRNLP
                     HDQTRQHIRQAQAMVISSAMEGGANVITEAVASGVPVLASRIPGNFGMLGRDYEGYFP
                     LGDAAQLALVLERTSRDAGFLNRLRQQCALRAPLFAPARERAEVSKLVADALKPE"
     gene            344892..346058
                     /locus_tag="CNE_RS19665"
                     /old_locus_tag="CNE_2c03140"
     CDS             344892..346058
                     /locus_tag="CNE_RS19665"
                     /old_locus_tag="CNE_2c03140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041228777.1"
                     /db_xref="GI:752557545"
                     /translation="MNKFELDAAFAEAHRRTWGLLQELSPSQWQVPYDAGINPPLWEY
                     AHIAWFTELWVLREPRAGQDGRWVASLPSMLADADRLFDSMRVAHRDRWHLALPRLPE
                     IRDYAAAVLEHVRARLATSDDTDAALYFFRLALFHEDMHAEALTYMRQTLDYPLHAPL
                     GMPSIAPGAGSAAAGGDTFQMGSPIGGDGFVFDNEKWSHPVHIAPFRIDRTCESNAAF
                     AEFVAAGGYRDRQWWSDDGRAWLQQSGLAHPLRWRRTAGGIAGQWALRWFGQWVPLPA
                     EQPVCHINAYEAEAYCRWAGKRLPTEAEWEYAATHDLIRWGSAVWEWTADPFVPYAGF
                     SPDPYQEYSAPWFHTHRSVRGGSFATHARMQHPRYRNFYLPHRGDLFVGFRCCG"
     gene            346320..346709
                     /locus_tag="CNE_RS19670"
                     /old_locus_tag="CNE_2c03150"
     CDS             346320..346709
                     /locus_tag="CNE_RS19670"
                     /old_locus_tag="CNE_2c03150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018003986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_013952022.1"
                     /db_xref="GI:503717946"
                     /translation="MHYQHLAMFGAVALMAASALAQSSGLTRTLVGRADVSVPGREAV
                     VARVEVAPGAYAGRHTHPGDEISYVMEGEAQLLIDGQSPRTVKAGESFVVPAGVVHDA
                     HNSGSTATRVLGVYVVEKGKPLASPAP"
     gene            complement(346711..>347542)
                     /locus_tag="CNE_RS19675"
                     /note="FAD-linked oxidase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(347575..348039)
                     /locus_tag="CNE_RS19680"
                     /old_locus_tag="CNE_2c03170"
     CDS             complement(347575..348039)
                     /locus_tag="CNE_RS19680"
                     /old_locus_tag="CNE_2c03170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006159520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228526.1"
                     /db_xref="GI:752557294"
                     /translation="MQVLVDADACPVVVKEMLYRAAQRVEVCVTLVANQYMRTPPSRF
                     IKALQVPAGFDVADDRIVELVSSGDLVITADIVLAAAALDKGAYVLDPRGSWFSRENI
                     QERLTMREVMEQLRSSGVDTGGPAPYAPQDSKAFAGQLDRFLARHAPPGAVA"
     gene            complement(348131..348559)
                     /locus_tag="CNE_RS19685"
                     /old_locus_tag="CNE_2c03180"
     CDS             complement(348131..348559)
                     /locus_tag="CNE_RS19685"
                     /old_locus_tag="CNE_2c03180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013952025.1"
                     /db_xref="GI:503717949"
                     /translation="MEEIANTTVLFIAGFGPIVREAEASRKLYSQTFGIPFNEEKGGY
                     LHTEALQGANSFALWPLSEAAQSCYGSDSWPGDVPIPQAWIEFDVDNVERATAELESR
                     GYRMLVRNKKEPWGQTVSRFIGPEGLLVGITFTPSMREEK"
     gene            complement(348884..>349414)
                     /locus_tag="CNE_RS19690"
                     /old_locus_tag="CNE_2c03190"
     CDS             complement(348884..>349414)
                     /locus_tag="CNE_RS19690"
                     /old_locus_tag="CNE_2c03190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003302671.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228778.1"
                     /db_xref="GI:752557546"
                     /translation="IQPALKAGRDIVADRFNAGVRLGDTIDKDMIAVPIGPRLRMAVV
                     AAPSYFAGNPARKTPRDLPAHRCINLRFPTHGGLSVWDFERRGRQLKVRVDCQVVFNT
                     TPHIVMAALEGLGVAFLPEEEFAPHVEAGRLGRVLEDWCPPFGGYHLYYPRRRQASPA
                     FSLVVNALRVGGSARR"
     gene            <349393..350013
                     /locus_tag="CNE_RS19695"
                     /old_locus_tag="CNE_2c03200"
                     /note="transcriptional regulator; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            350272..351732
                     /locus_tag="CNE_RS19700"
                     /old_locus_tag="CNE_2c03220"
     CDS             350272..351732
                     /locus_tag="CNE_RS19700"
                     /old_locus_tag="CNE_2c03220"
                     /EC_number="1.1.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_013952028.1"
                     /db_xref="GI:503717952"
                     /translation="MSEALRYSLCRFFIACCLGLAACGGGGDGGGSDSATGTGTGTLT
                     LSISGLPSGTSAAITVSGPGQFRQTVTQSTTLSNLAAGSYTISAASVLTGSTLLKPQP
                     PSQTVAVTAGGRASASVAYGSPETVQLSLTQVAGGLSAPIFLTAPHGDSRLFVVERAG
                     RIRIVRNGTLVATPFLDIAALTTTDGERGLLSMAFDPNYGTNGRFYVYYTDANGAITI
                     ARYSVSAANPDIANASGTVLLSIPHGTFSNHNGGQLAFGPEGMLYIGTGDGGGSGDPS
                     GNAQNPGTLLGKMLRIDVSGASGYGLPAGNPFVGQSGSRGEIWALGLRNPWRFSFDAG
                     LLYIADVGEDQREEVDVAPATSAGLNYGWNRTEGTACVGAAGCDKTGLTMPVFEYGHD
                     AGACAIVGGYVYRGSASPALQGRYFYTDLCTGKLLSFMYRDGVVVEQVDWKVTVPGSV
                     FSFGVDDGQALYVLADPGTSTTSGRVYRVDVSGGTP"
     gene            complement(351975..353357)
                     /locus_tag="CNE_RS19705"
                     /old_locus_tag="CNE_2c03230"
     CDS             complement(351975..353357)
                     /locus_tag="CNE_RS19705"
                     /old_locus_tag="CNE_2c03230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952029.1"
                     /db_xref="GI:503717953"
                     /translation="MKSKALLLCTLAGAVLAVSQINAPSLAAMTPDEVKRLDGPLTPM
                     GAERSANKDGSIPAWSGKWQATPAGLAFRPGDAYPDPYASEQPLATITAQNLEQYRAR
                     LSDGQLAMFRLYPATFKMAIYPSHRDFRYGDAVYKAIQHHAPGTQLTSDANGLKDYPP
                     TAPFPVPKNGLELMWNLRFSSAIAEEAAVYDQAVVYRDGKIAWGKWKYDIWSPVNGTA
                     FEKGSPLINRTFARVETELPLRERGNIIVSHNFWDREGSDTARTWQYNPGTRRVRQAP
                     EFGFDQPLGPGGFRTVDDDRLFNGSGERYDWKIVGKREIYIPYHNYKLADPAVKYAEL
                     LGANHAAPDLVRYELHRVWVLEAKLKPGFRHQYAKRVLYLDEDTWMAVLADNYDARGQ
                     LWRTNLQSSLFAYDARRYYPAVAFYHDLTAGAYLADRLTNEGKPVRLNSSPQFSEAYF
                     SPDSIRGAGH"
     gene            complement(353387..354379)
                     /locus_tag="CNE_RS19710"
                     /old_locus_tag="CNE_2c03240"
     CDS             complement(353387..354379)
                     /locus_tag="CNE_RS19710"
                     /old_locus_tag="CNE_2c03240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_041228527.1"
                     /db_xref="GI:752557295"
                     /translation="MRAVVIDRTGGPDVLRLGDLPRPEPAAGEVLVRVACAGVNPADW
                     KCREGYLSHFMQYSFPFVIGFDASGVVAAVGSGVKDFVPGQRVFAQTAVGAGKWGSYA
                     EYVAVSQDCVVPIPDNLGFAEAAAVPTPALAAWTGLFDEGGLKPGQTVLVHGGAGAVG
                     TFAVQLAKAAGATVAATCSAARRDELMALGCDLAIDYRGDDIAAAMRAWAPAGVDLVL
                     DAVGCGTLPNGMDLLRPGGILVAILTLVSGDNGPDPAAAAQRGVRTAVAFSKMPSGAR
                     LREIAALLGSGRLRPPRIECLPLEQAGRALDLVQSGKAASKLVLRIAEPANAGA"
     gene            complement(354396..355271)
                     /locus_tag="CNE_RS19715"
                     /old_locus_tag="CNE_2c03250"
     CDS             complement(354396..355271)
                     /locus_tag="CNE_RS19715"
                     /old_locus_tag="CNE_2c03250"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013952031.1"
                     /db_xref="GI:503717955"
                     /translation="MTAHRKLTGKIALVTGASRGIGRAIAQRFAAEGALVVATARRAG
                     ESEDEPGTLAETVGQIRRQGGSAIALAADLEDPAQRDDLVAQAASAAGGLDILVNNAG
                     MAEYSRIESMPLEIFDRTVKHYLRIPFVLSRAAIPLMRTRGAGWILNLGSVTALSPAR
                     PYQDFDRAGGVTAYAAVKAAINRFTEGLAAELEADNIAVNSVAPSTAIRTPGSERYIP
                     DGYPTEPVEYLVETALALCSVPARLRTGHIAHSLHFPLAHGLNVRTLDGQGMLPPPVI
                     PSWAHPGLNHELSAR"
     gene            complement(355268..355927)
                     /locus_tag="CNE_RS19720"
                     /old_locus_tag="CNE_2c03260"
     CDS             complement(355268..355927)
                     /locus_tag="CNE_RS19720"
                     /old_locus_tag="CNE_2c03260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952032.1"
                     /db_xref="GI:503717956"
                     /translation="MRLETAQVRLLAGFCSGTCTQEQALLARIETLPGLSHVAIGRNL
                     AGSWGAGDYTLDLLFDPTASGSPGHDIGLVAALDGMAEVDSVAYRPISDGLRAPPLCH
                     GIWRTLMFRLRPEAPDWQVRALEQDLLRMPEYMPGILNWRLARVLSPGTWTHVWQQEF
                     ASADDLLGEYLMHPFHWGHVDRWFDPEFPEWTVQAISHAFCPLATSLIANHNRTEEYA
                     P"
     gene            complement(355917..356261)
                     /locus_tag="CNE_RS19725"
                     /old_locus_tag="CNE_2c03270"
     CDS             complement(355917..356261)
                     /locus_tag="CNE_RS19725"
                     /old_locus_tag="CNE_2c03270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952033.1"
                     /db_xref="GI:503717957"
                     /translation="MIHILDEIVLAPGHLPTVLSLLESQYLPGSAARGLALLQRCVSP
                     PVALEDAPNTLWLLWQVADAPAYYAMRASIDAPVLAFWSTVDTLCEARRRHVMADATA
                     TLPQRKEHCDAA"
     gene            356558..357520
                     /locus_tag="CNE_RS19730"
                     /old_locus_tag="CNE_2c03280"
     CDS             356558..357520
                     /locus_tag="CNE_RS19730"
                     /old_locus_tag="CNE_2c03280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_041228528.1"
                     /db_xref="GI:752557296"
                     /translation="MVQRLLDELKRQGVEVPPAAGASGHAPAARFTALYRAAIERLEA
                     LVAKGNGHPPMRKQEVDLLCRCVLSSQTLREAIRCAADFCAMLYPRAGALSLGQSAGQ
                     AVFRMDSLRRANSSAACLVDLTGLFFYMLLFGWLVGQPLRPTHVYLAHPRREDAMPFL
                     GLFHAAVTSGAQTYGFEFDEALLDRPVVRQAAELDAFLEDFPYRLIGAPVEVVSVSQQ
                     VHGILHAALVHGARLPTLAELAMRFDVSEPTLRRRLAADGSSYRVLREHSLQEYAEQC
                     LCTTNWSVGRIAEQLGFASEEAFRRAFQRWTGHAPTRFRRESRG"
     gene            complement(357591..358706)
                     /locus_tag="CNE_RS19735"
                     /old_locus_tag="CNE_2c03290"
     CDS             complement(357591..358706)
                     /locus_tag="CNE_RS19735"
                     /old_locus_tag="CNE_2c03290"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013952035.1"
                     /db_xref="GI:503717959"
                     /translation="MRLADFILRDTGRIVAAWEEFATTLLPAARNMDSLALRDHAPQI
                     LQAVAKDLLTPQTREAQREKSMGQAPKLLGAPETAAQTHALLRARGGFNINQLVAEYL
                     ALRASVLRLWIDECQPAAPYLDDVMRFNEAIDQAVAESVAFFHSQVEQARDLLLGMVG
                     HDMRSPLQTIQTTASYLAALNAGEKVSEAAARLIRSGSRMNSLLDDLCDFNRTKLGLG
                     INITPYDVDLAELVADTVDQLRAAHPTRRIELEVKGNVQGIWDGLRLQQLLSNLVLNA
                     IRYGAPDEPVCVAVTGHDAEVSLEVRNSGPAIDPLSLERLFDPLRRGPDQENKNADGL
                     GLGLYIVSEITKAHQGSIEARSDQTGTTFDVRLPRRT"
     gene            complement(358881..>359216)
                     /locus_tag="CNE_RS19740"
                     /old_locus_tag="CNE_2c03300"
     CDS             complement(358881..>359216)
                     /locus_tag="CNE_RS19740"
                     /old_locus_tag="CNE_2c03300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312664.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228779.1"
                     /db_xref="GI:752557547"
                     /translation="SGYADKLAKYRDYVSQRMKFWAVLLFCIAVPSEIPGYLFGSMHY
                     PFRKFLAAMAIAEAGYAFGIVVAGESLAIDRPLPFLIAVGILAVVAVLAGLVLRAVRK
                     HKSGGLQRR"
     gene            <359245..360171
                     /locus_tag="CNE_RS19745"
                     /old_locus_tag="CNE_2c03310"
     CDS             <359245..360171
                     /locus_tag="CNE_RS19745"
                     /old_locus_tag="CNE_2c03310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013959786.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228780.1"
                     /db_xref="GI:752557548"
                     /translation="QRRLSGFDDHVISMYARGMSVREIQGHLQELYGLQVSPDLISTI
                     TDEVLAEVEQWQQRPLEAMYPIVYFDALRLKIRDEGTVRNKAVYLALGIRADGRKEVL
                     GLWIEQTEGAKFWLKVFNELKNRGLEDILIAVVDGLRGFPQAIEAVYPAAQIQTCIVH
                     LIRNSLNLASWKDCKGLAAALKPIYQAATADAAATALDAFAGSDWGRKFPTVADMWRR
                     QWEQVIPFFAYPPEVRRIIYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRN
                     IEKDWKMPPITWKQAANQFAILFGDRFTNALR"
     gene            <360216..361016
                     /locus_tag="CNE_RS19750"
                     /old_locus_tag="CNE_2c03320"
     CDS             <360216..361016
                     /locus_tag="CNE_RS19750"
                     /old_locus_tag="CNE_2c03320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013959805.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_041228781.1"
                     /db_xref="GI:752557549"
                     /translation="HPKYVRPFVRTNKTDAADARAIWTAAQQPGMRPIPVKTEAQQAL
                     LGLHRIRSELVDSRTRQVNQIRGLLGEYGLHFVLGRKAAMAQFVTRLSEIEQTIPAPL
                     WRLLSRQLQRLRQLDAEILAAEQEIAAWLKTEPAAQCVDAIPGIGPITATALVATMGS
                     PQAYRSGRAFAASLGLVPTQSGTGGKVHLGHISKRGDPYLRKLLIHGARIVLTRSKRR
                     PCWAEALLVRRPTNVAIVALANKMARTAWALLAHRRVYEPGYVSARPA"
     gene            complement(361258..361584)
                     /locus_tag="CNE_RS19755"
                     /old_locus_tag="CNE_2c03330"
     CDS             complement(361258..361584)
                     /locus_tag="CNE_RS19755"
                     /old_locus_tag="CNE_2c03330"
                     /EC_number="3.1.6.1"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_013952039.1"
                     /db_xref="GI:503717963"
                     /translation="MSNDNKPGGTLTRRDFLLTAGVGTMALGLGAGADAKDAPAGASD
                     AAQAAGSPASGPYNILFILVDQERYFRPGELPKGYGLPAHERLMKRGTTFLTSLYEHR
                     PDAKVN"
     gene            complement(361827..363221)
                     /locus_tag="CNE_RS19760"
                     /old_locus_tag="CNE_2c03340"
     CDS             complement(361827..363221)
                     /locus_tag="CNE_RS19760"
                     /old_locus_tag="CNE_2c03340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228529.1"
                     /db_xref="GI:752557297"
                     /translation="MTDAFLFSKPFTFLACAGMSEVREGVDVLEALPGHLLWLENEDY
                     IRRVYVPDFLEQSRAALEAVMPGGPAQIDAMADEIRHSPRLMPDLQRLSPEIAAAAHS
                     YCYWRYSADVVGRAQGIPRSAIERQFDRAARPRDGAHKLQWICPCCDGPAHYQVDGLL
                     ASQRPARQGGFSIECAHCGHQERLYAGFLHAGRLECRCAHCTGFIKTLAGQLARPARR
                     LCAALEDYAWMHAVDTAAEIRELWEASLQMLASGARPSDNTMAFALAIQSDEARPIPD
                     ILSQIDPTLEGRLDKNPRAWVLLCELLREGVLDADCAIYDHDGRQHVALELALLEDDQ
                     AADSATAQDSLATLLKGYQPPERDAFINWLKALKRLRLCTARFNAAVDVAWKPNLEHC
                     RILTARWSDGQPAPAAQASAAWLPAAPRPRRPERPVYLDAELEAVQLLKSLGYIVLSP
                     EEIRSQRDPIEDML"
     gene            complement(363438..363911)
                     /locus_tag="CNE_RS19765"
                     /old_locus_tag="CNE_2c03350"
     CDS             complement(363438..363911)
                     /locus_tag="CNE_RS19765"
                     /old_locus_tag="CNE_2c03350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_013952041.1"
                     /db_xref="GI:503717965"
                     /translation="MKIGELARLSGIAASRIRFYEASGLLEPAQRQANGYREYAPETL
                     TRLEIIMCAQGSGFSLEEIRAILPPDLDKWPHDQLLQALRRKVDEIELLEQRLAQSKH
                     RLVALIDEINGTREGEDCEGKARRVLERMNQDGNGGAPAGLPGRRTRTSRKGIPL"
     gene            363990..365228
                     /locus_tag="CNE_RS19770"
                     /old_locus_tag="CNE_2c03360"
     CDS             363990..365228
                     /locus_tag="CNE_RS19770"
                     /old_locus_tag="CNE_2c03360"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="WP_013952042.1"
                     /db_xref="GI:503717966"
                     /translation="MKLFTPLALPNGAVIPNRLAKAAMEENMADADHAPSDALLRLYD
                     AWANGMAGLILTGNVMVDHRAMTGPNGVVLEDDTHLDRFRRWARTARAGGAHVWMQIN
                     HPGRQMPAALGQTTLAPSAVPLDLGALSKQFPVPREMTGRDIADVQQRFTRSAQLAER
                     SDFTGVQIHAAHGYLLSQFLSPIANKRQDQWGGSIENRARLLLGIVRSVRSAVSPRFA
                     VSVKLNSADFQRGGFSADDARRVVEMLNPLNVDLIELSGGSYEAPAMQGQARDGRTLA
                     REAYFLEFARDIASVARMPLMVTGGIRRRAVAEQVIDSGIAMAGIATALSIDPNLPRN
                     WHAGKNNAPALRSITWKNKTLGSLAKMAVVKFQLKRLSEGRVTDPRVSPVRALVLQQL
                     STSCQTRRYRRWTTQRAGAR"
     gene            365387..365911
                     /locus_tag="CNE_RS19775"
                     /old_locus_tag="CNE_2c03370"
     CDS             365387..365911
                     /locus_tag="CNE_RS19775"
                     /old_locus_tag="CNE_2c03370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952043.1"
                     /db_xref="GI:503717967"
                     /translation="MKLANFALAAAILFSAGTTFAQDAVNDAQIASIVVTANQVDIDA
                     GKLAKRKASGKDVKAFAQQMITDHTGVNKSATALVKKLKVKPEGNPTSTSLKSDGDKN
                     LSKLKGLKGAEFDSAYIDNEVTYHQAVIDAMDKTLIPGAKNEELKALLVKVRPAFVAH
                     LEHAKQIQGSLGKK"
     gene            complement(366311..367867)
                     /locus_tag="CNE_RS19780"
                     /old_locus_tag="CNE_2c03390"
     CDS             complement(366311..367867)
                     /locus_tag="CNE_RS19780"
                     /old_locus_tag="CNE_2c03390"
                     /EC_number="4.2.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactarate dehydratase"
                     /protein_id="WP_013952045.1"
                     /db_xref="GI:503717969"
                     /translation="MSVVLEQEAATAAELVIRLHPDDDVVIARAQLVAGARLGAGLVV
                     RGLVPAGHKLAVRALEAGAPVRRYGQVIGFATRPVAPGEHVHTHNLAIGAFERDYAFG
                     TATRPAAVAPQRAQFMGIVRADGRVGTRNYIGILTSVNCSATAARAIAEHFRRELNPQ
                     ALADYPNVDGVVALTHGQGCAVDGEGEGLALLRRTLAGYARHPNFAAVLIVGLGCETN
                     QIDGLLDSEGLARGAALKTMTIQATGGTARTVAAGIEQIKAMLPDANRVRREPVDASH
                     LVVGLQCGGSDGYSGISANPALGAAVDRLVAHGGTAILSETPEIYGAEHLLTRRAVSP
                     EVGHKLLDRIRWWEAYCARMNASLDNNPSAGNKAGGLTTILEKSLGAVAKGGTTNLVD
                     VYRYAEPVEAAGLVFMDTPGYDPVSATGQVAGGANLICFTTGRGSAYGCAPSPSLKLG
                     TNTALWQRQQEDIDINCGTVIDGTQTIDALGEEIFRLMLAAASGQRSKSELHGYGQNE
                     FVPWQLGAIT"
     gene            complement(367864..369468)
                     /locus_tag="CNE_RS19785"
                     /old_locus_tag="CNE_2c03400"
     CDS             complement(367864..369468)
                     /locus_tag="CNE_RS19785"
                     /old_locus_tag="CNE_2c03400"
                     /EC_number="1.2.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018003897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dioxovalerate dehydrogenase"
                     /protein_id="WP_013952046.1"
                     /db_xref="GI:503717970"
                     /translation="MTILGLHYIGGERRAAGTPLYSIDAVTGERYPVSFHEATGAEVA
                     AAALAAHQAFPAFRASSPAERAALLETIADEIDALDQAFIAAASRETALPPARLEGER
                     KRTSNQLRMFAATVRRGDFLDVRIDRAQPARQPLPRPDLRQYRVGVGPVAVFGAGNFP
                     LAFSVAGGDTASALAAGCPVVVKAHPGHMVTSAYVANAIERAIARSGAPAGVFNMVFG
                     TAAAGAALVRAPHIKAVGFTGSLAAGRALFDLAQSRPDPIPVFAEMSSVNPVFLMPSA
                     LSARGAQIARELAASVTFGCGQLCTNPGVVLGIRSPAFDAFLAELGTALALAEPQPML
                     GAGIRDNFQRGLAGLREVPGVEVLVSKQADGRIGGHLLKADRSVLFAENRPLEEEVFG
                     PSTVIVALDSEDDFLAFAERMRGQLTATLMADDGDLHHHAALIVLLESKVGRLLFNGY
                     PTGVEVSDAIVHGGPYPATTDARGTSVGSAAIERFLRPVCYQNYPDSVLPPALRDRNP
                     WQLPRLVDGVPTRAAVQGAHDLEAAA"
     gene            complement(369504..370835)
                     /locus_tag="CNE_RS19790"
                     /old_locus_tag="CNE_2c03410"
     CDS             complement(369504..370835)
                     /locus_tag="CNE_RS19790"
                     /old_locus_tag="CNE_2c03410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018003898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952047.1"
                     /db_xref="GI:503717971"
                     /translation="MQTQAANRDPLASAVSKARLRLAPFLALMFALSMLDRSNVGFVK
                     QALMVDSNIGNAAYALGAGIFFIGYAVFEIPSNLILHRVGARVWLSRIMVTWGLASAA
                     MMFAHDETSFYVLRFILGVAEAGFSPGVILYSTYWFPASQRGKALGVYYFGLPVALVL
                     GGPVSGLLLDVMGGQLGLRNWQWMFIIEGLAASVVGVIAFFYLVSKPRDAKWLNADEK
                     TSLEAAITAEDNQKTAHGPATALSALGNWQVLRFVAIYFAIQVSVYGVIFYLPTRISE
                     LTGTAIGAKVGLLTAIPWLCALVSLRLITGIADARGKQREFAMAMLAMAATGIALSTL
                     GHELVPVLMAFCLATVGFVVVQPLFWTLPTAYLSGTAAASGIALIGALGNLGGFIAPT
                     LKTAVESAFHSQQAGMLALAIAGVVGVLLLMSIGARARRASTLRLGSSEAA"
     gene            complement(370969..372168)
                     /locus_tag="CNE_RS19795"
                     /old_locus_tag="CNE_2c03420"
     CDS             complement(370969..372168)
                     /locus_tag="CNE_RS19795"
                     /old_locus_tag="CNE_2c03420"
                     /EC_number="3.7.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase"
                     /protein_id="WP_013952048.1"
                     /db_xref="GI:503717972"
                     /translation="MALPLTLSATQTLPADGLAGTLVGRAWIPAGDGVPAGPAVVVLR
                     PDGVFDISDVAPTMSTLLEQDDPLTVVHNAPGRWIGKLDDLLANTADPHGSNGVARLL
                     APCDLQVIKAAGVTFAGSLVERVIEEQTKGDPQGAAEVRNRIQALVGERLSRIRPGSR
                     EAGELKALLIEHGMWSQYLEVGIGPDAEIFTKAPLLSALGTGTEIGLHPGSAWNNPEP
                     EIVLAINSRGDVLGATLGNDVNLRDFEGRSALLLGKAKDNNGSCAIGPFLRLFDQSFS
                     LDDVRRATVDLRVDGLDGFVLSGTSSMDQITRDPLELAEQAMGATHQYPDGAMLFLGT
                     LFAPVEDRDTAGGGFTHKGGDLVTISSRQLGSLVNRVGRSDRIAPWTFGVRALMANLA
                     ARGHTTF"
     gene            372319..373257
                     /locus_tag="CNE_RS19800"
                     /old_locus_tag="CNE_2c03430"
     CDS             372319..373257
                     /locus_tag="CNE_RS19800"
                     /old_locus_tag="CNE_2c03430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020384424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952049.1"
                     /db_xref="GI:503717973"
                     /translation="MARQTASAPSAVLAKLRFRHLQLLDVLGRSRNLRIAAEQLHITQ
                     PAATKILSDIEDTLQARLFDRLPRDMRPTELGEFALRYASTALAELGKFVSELEALRA
                     GGHGHLTVGAISASAAQVVTTAIREILQQRPRLVVKLIEQSSDQLAVWLEDRKLDIMV
                     GRLTEPRHQAIFDFEALSPEPVWVVCRPGHPLLDRPRLEIADIGAWPWILYPQLTAIR
                     QLFDETIAAAGIQGLVGMVETPSIFSTLELLQATDMLSLQPRAVVERFVAERMLSHVP
                     VPIRRAMSSYGIVTRKNELPSEAMLQFMAALRAAAR"
     gene            complement(373237..373866)
                     /locus_tag="CNE_RS19805"
                     /old_locus_tag="CNE_2c03440"
     CDS             complement(373237..373866)
                     /locus_tag="CNE_RS19805"
                     /old_locus_tag="CNE_2c03440"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B oxidoreductase"
                     /protein_id="WP_013952050.1"
                     /db_xref="GI:503717974"
                     /translation="MKPSRQSVQIWDPIVRFTHWAVAALVLWDLYEDSGGPLHRNLGY
                     AAACLVLVRVAWSMVGNGAGNIREWLPGRGGVVAYVKAAIAGRPPRHLGHNPLGALMM
                     LVLWILILSLAATGWMSRLDMFWGEDWPKELHGILADALLALVSVHVVAAILMSRLHR
                     ENLILSMVTGRKPAAPDQRKPSAGDGEPASSSDPPAISDPRAVSPGRRP"
     gene            complement(373892..374158)
                     /locus_tag="CNE_RS19810"
                     /old_locus_tag="CNE_2c03450"
     CDS             complement(373892..374158)
                     /locus_tag="CNE_RS19810"
                     /old_locus_tag="CNE_2c03450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228530.1"
                     /db_xref="GI:752557298"
                     /translation="MLRIGALMAMILVSGSALASAKCPAHPKSDWMKESDARAKIEAQ
                     GYNIKKFKVDGNCYEIYGTTKEGKKAEIYFDTKTLDIVKAEIEK"
     gene            complement(374432..>375004)
                     /locus_tag="CNE_RS19815"
                     /old_locus_tag="CNE_2c03460"
     CDS             complement(374432..>375004)
                     /locus_tag="CNE_RS19815"
                     /old_locus_tag="CNE_2c03460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014192540.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228782.1"
                     /db_xref="GI:752557550"
                     /translation="VRMRVSPQARKKCPALPEFWQARAIRTIDARGRSRILLTSLFDR
                     RRFKPADIVACYERRWQIETSYRELKQSMLGMELTLRSRTVDGVCQEIWGALIAYNLI
                     RREMASAAREAKLAPTDMSFVRAFHVIQHEMMWAAVTPAYAKLPACLRRLRERLKSLP
                     NVKRPGRSCDRVVKSRPSRYAVRFLNRDLN"
     gene            375514..376794
                     /locus_tag="CNE_RS19820"
     CDS             375514..376794
                     /locus_tag="CNE_RS19820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013958642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228531.1"
                     /db_xref="GI:752557299"
                     /translation="MTPLLSQQFRAFVGIDWADAKHDICLQPAGDDTREFACIPHQVA
                     RIDEWVAALHKRFGGPIAVALELSRGPIVSVLQRHSFLTLFPINPSMLAKYREAFKPS
                     RAKDDPTDAELALDLLLRHPDRFSALNPQSADMRSLLSLIEQRRELVGDKIRFTNRLT
                     HALKQYYPQALEWFEDIDTIQFCDFLTRWPTLPAAKRARRTTLEDFFHAHNCRRAQLI
                     ERRLASIRGAMPMTDDPGVVAPNRLLALMLVAQLRTVLAAIDVFDKEIARIARTLPDF
                     DLFDSLPGAGPHLTPRLLAAFGEQRDRYNGAEELQKYSGIAPVTERSGKKRWVHWRWQ
                     CPTFLRQTFVEWAGQTINKSSWAGAYYRQQRAKGSSYQAAVRALAFKWIRILYRCWQT
                     GTRYDEELYLNALKRRGSPLIGHLEARPDTKLNR"
     gene            complement(377032..377997)
                     /locus_tag="CNE_RS19825"
                     /old_locus_tag="CNE_2c03480"
     CDS             complement(377032..377997)
                     /locus_tag="CNE_RS19825"
                     /old_locus_tag="CNE_2c03480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952054.1"
                     /db_xref="GI:503717978"
                     /translation="MPDRLTALALETLGRMRSRLKARQLNLLVALSEYGSLSRVAQEW
                     GVTQPYLTQMLAEIESMMGTALFTRQRGGVTPTPVGRIAISRASRLLVDLQDWANDMA
                     AARLGFTERLSIGVIHYLSGQLLCDTLSHTREQVGPFVFSVEEASSDRLLALLREHRL
                     EGVVARARGAAQARDLRCDILFRQRPALVCHLKTAKHLGKRALDWHELATMDWVLPPA
                     GTALGASVLDLFLHVGEEPPVPAIETHSLKIVGRMIERNPSMVAIVPADVAHDLSTRA
                     HVASVPCDLEWPLPPVALYRRQGAGDSPTMATFVRTLKTLCKARF"
     gene            378115..379095
                     /locus_tag="CNE_RS19830"
                     /old_locus_tag="CNE_2c03490"
     CDS             378115..379095
                     /locus_tag="CNE_RS19830"
                     /old_locus_tag="CNE_2c03490"
                     /EC_number="4.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-carboxymuconate-6-semialdehyde
                     decarboxylase"
                     /protein_id="WP_013952055.1"
                     /db_xref="GI:503717979"
                     /translation="MPVIDVHTHIFTKPWLELLKRKGGLYNIQQRPDGQHEVFRGDTP
                     VVIPQKGHFDYDLRIQHMDAAGIDISVMSLTCPNVFWGDEETSCEAARESNDSLAQAQ
                     AAHPSRLRWFTSLPWEYPQRALDELKRTCDNGASGVMVLANIAGRSLTDPAFAPIWAE
                     IDRRALPVLVHPTDPPGADLMDMTKFDLSWSVGFMFDTTLAITRMIFEGFFDQYPNLK
                     IIASHAGGALPYLAGRFEKGHEVEIPQRRKMQRTPIDYLRHIHYDCISYSPASLEFLI
                     SVVGADRVMFGTDWPHQVHDTCGSFANTERLSAAQRDAVRSGNAKRVFGF"
     gene            379128..380093
                     /locus_tag="CNE_RS19835"
                     /old_locus_tag="CNE_2c03500"
     CDS             379128..380093
                     /locus_tag="CNE_RS19835"
                     /old_locus_tag="CNE_2c03500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952056.1"
                     /db_xref="GI:503717980"
                     /translation="MMKRRVFNWVATMALAAVLPMGALAQDKPPLKLLVGFAPGGSVD
                     VVARLLAERLRLPLGQQVVVENKPGAGGRLVLGEVKRAPADGNTLVISPSGALVISPW
                     LYNLNYDPVKDFTPVARVVTFDFAVTAGPVAPSGDIRAVLNWLKANPARANYGTSGAG
                     TVPHFAGVLLSQASGVPLTHVAYKGGAPAVSDLLGGQIPIMVDTISETIEHHRAGRLR
                     ILAVTGNARSPALPDVPTLKESGIDATAEAFVGLFAPAGLPADKVKRLSDAIAEVLKA
                     PDLQARVREIGLNANYAGPQQLGETQVAELRRWERPIKASGYKAE"
     gene            <380086..380277
                     /locus_tag="CNE_RS19840"
                     /old_locus_tag="CNE_2c03510"
     CDS             <380086..380277
                     /locus_tag="CNE_RS19840"
                     /old_locus_tag="CNE_2c03510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019451290.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228783.1"
                     /db_xref="GI:752557551"
                     /translation="PSDVAADAVLQLCEREEEAARREYRSALTRDMPEEIRSVLLRQY
                     EGMQNYHERIHAMRGMQIH"
     gene            complement(380372..381325)
                     /locus_tag="CNE_RS19845"
                     /old_locus_tag="CNE_2c03520"
     CDS             complement(380372..381325)
                     /locus_tag="CNE_RS19845"
                     /old_locus_tag="CNE_2c03520"
                     /EC_number="1.2.1.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952058.1"
                     /note="catalyzes the reduction of N-acetyl-5-glutamyl
                     phosphate to N-acetyl-L-glutamate 5-semialdehyde in
                     arginine biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_013952058.1"
                     /db_xref="GI:503717982"
                     /translation="MRYPLVFIDGDQGTTGLQIHERLRGRDDLRLLTLPAGQRKDARA
                     RADAINGCDIAILCLPDSAAREAVTSIVNPAVRVIDASSAHRTQPGWTYGFPEMAAGQ
                     AQRIAGALRVSNPGCYPTGAIGLLRPLVEAGLLPHDYPLAIHAVSGYSGGGRTAVDTY
                     EGPQATRALPFQVYGLGLAHKHTPEIQQHAGLARRPAFVPAYGAFRQGIVLTVALELD
                     LLASGTDVGRLHACLLDHYAGARHVEVMPLAESAAATHLDPQALNGTNALRLGVFANR
                     EHGQALLAAVFDNLGKGASGAAVQNLDLMLAGVAAEVRRAA"
     gene            381527..382411
                     /locus_tag="CNE_RS19850"
                     /old_locus_tag="CNE_2c03530"
     CDS             381527..382411
                     /locus_tag="CNE_RS19850"
                     /old_locus_tag="CNE_2c03530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952059.1"
                     /db_xref="GI:503717983"
                     /translation="MREISLDRLRTLVAIADLGSFAEAARALHLAPPTVSLHIAELEA
                     RVGAVLLTRRRGEVRPSSIGETLVDRARRLLADADLALDDVQRQVQGLTGRVRLGAST
                     GAIAHLLPQALAMLAERHPDIDVQVAVLTSQETLARLAAGTLEVGLVALPQARVAGLT
                     IRPWRRDPVRAFLPASWPCPARITPAWLATRPLILNDGTTRLSRLTAEWFASGGHRPA
                     PRIQLNYNDAIKSLVAAGYGAALLPHEVTTPAPDARVVMRPLRPALWRRLGLAHSGER
                     VERATEYVLEALWALRAG"
     gene            complement(382475..383560)
                     /locus_tag="CNE_RS19855"
                     /old_locus_tag="CNE_2c03540"
     CDS             complement(382475..383560)
                     /locus_tag="CNE_RS19855"
                     /old_locus_tag="CNE_2c03540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease DDE"
                     /protein_id="WP_013952060.1"
                     /db_xref="GI:503717984"
                     /translation="MRGRPKAELLLSEAEREQLKALTMRRKTAQALALRARIVLASAE
                     GLDNKTVAAKQRVDVHTVSKWRSRFVADRLDGLLDAPRPGAPRTIADAQVDAIIAKTL
                     ESVPAGATHWSTRSMARAADLSQSTVTRIWRAFGLQPHRQETFKLSSDPLFVEKVRDI
                     VGLYLDPPLKAMVLCVDEKSQIQALDRTQPILPMAPGIPERRTHDYMRHGTTTLFAAL
                     DIATGKVIGELHRRHRSSEFLQFLRTIEANVPPKLDMHLVMDNYGTHKTASIKAWFAR
                     HPRFHVHFTPTSASWINQVERWFATITEQYIRRGTHRSTRQLEQAIRQYLDLNNANPT
                     PFVWTKSADDILASIKRFCLRISDSGH"
     gene            complement(384000..384887)
                     /locus_tag="CNE_RS19860"
                     /old_locus_tag="CNE_2c03560"
     CDS             complement(384000..384887)
                     /locus_tag="CNE_RS19860"
                     /old_locus_tag="CNE_2c03560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952062.1"
                     /db_xref="GI:503717986"
                     /translation="MASNLDIAALRSLIAGIDLGSFARAAEQVGRSTSAVSAQIHKLE
                     DMAGTPLFRKAGRTLELTEAGSLLLGYARRMVALNDEAAAAVRGVDLSGGVRLGLQEE
                     FGEAMLPEVLGRFARAHPKVRVEAMVARNHDLFARIQARTLDLALVWGSADGARTARE
                     PGADIAVVGEPPMCWVGPAALPWHIVPGEPIPLAAFDRPCHFHDAATAALDRAGIPWR
                     VSFTSPNLGGLWAAAAAGLGLVVRTPYGLPASLRQLGAAEGLPPLGKMPLMLLRAPGP
                     ASEVSQRLADIMLEALRPV"
     gene            384996..386264
                     /locus_tag="CNE_RS19865"
                     /old_locus_tag="CNE_2c03570"
     CDS             384996..386264
                     /locus_tag="CNE_RS19865"
                     /old_locus_tag="CNE_2c03570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter permease"
                     /protein_id="WP_013952063.1"
                     /db_xref="GI:503717987"
                     /translation="MAESVCFPRPGGNSLAASAASHRWKVLGVGVAANASFIAAANGL
                     PATAVWLRSAYQIDNGGLGLLLGALGIGAALSELPWGAAADRWGDRRVLLYGLGATAL
                     ILAVMALFLAPRPDRVPPLPVAMACMALLGLAGGSVNGASGRAVMRWFAEGERGLAMS
                     IRQTAVPLGGALGALVLPWLALAMGFRWVYAVLAALCFASAWLTWRWLHEPTHLASPT
                     SAQRHAHDNASPLRSLRVWCIAVAIGILCAPQFAVLSFASVFLHDAAHVGVSGIAATL
                     CAVQLGAMAMRIWSGRHTDRRGNRRVWLRHCTLIAALMFVPLALCAAVGQSVPATLTM
                     VAVVLAGIAVSAWHGVAYTELATQAGAERAGTALGLANTLVFAAYFAAPAAIPLLLDR
                     GGWAGVWLLAGACAATAWPLFPRAGDRPSN"
     gene            complement(386286..387275)
                     /locus_tag="CNE_RS19870"
                     /old_locus_tag="CNE_2c03580"
     CDS             complement(386286..387275)
                     /locus_tag="CNE_RS19870"
                     /old_locus_tag="CNE_2c03580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_013952064.1"
                     /db_xref="GI:503717988"
                     /translation="MSTLSSTQPQALQRNASIKNLPVNLFASVMGIAGLSIAWRQASQ
                     EFGVTPLISAAAGILAIVVFLALSAGYLVKAIQHPDAVRGEFRHPVAGNFFGTITIAI
                     LLLSSVVAQLSQPLAEVIWIVGTIATIALCFTIASRLLQGKIDAAHAVPAWFIPGVAT
                     LDIAVAGGSMPMPWAHEVNMFALAVGTMIALLFFTMIMSRMIHHEPLPAGMVPSLLIL
                     MAPFEVGFLAYTNFTQRVDTFSGLLFYFGLFIFLTLAPKVFRKGIPFASGWWAISFPM
                     AALASAALKYSMFAQAWPVTVIAILLLAMLSIAIVVLLVRTLHMLINGKLLAG"
     gene            387411..388298
                     /locus_tag="CNE_RS19875"
     CDS             387411..388298
                     /locus_tag="CNE_RS19875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228532.1"
                     /db_xref="GI:752557300"
                     /translation="MSILVAVVDAGSFSAAARQLEIPLATVSRKVAELESHLKTRLLH
                     RSTRQLALTEAGQSYVAACRRILDEVGEAERAASGEYAAPKGELVMTAPIVFGRLHLL
                     PVVAEFLKTYPDIDVRMVLTDRVMHLLEEQVDVAVRIAELPDSSFIATRIGTTRRVVC
                     ASPAYFDEHGTPTNPLELTGHACITMDQIASRQVWTFLSGKAEVEVPIRSRLVVSTAE
                     AAIDAAVAGVGLTRVLSYQMADAIRAGAVKTTLEAFEPAPWPISLVHPGQGILPLKLR
                     AFLDFAGPRLKARLKELGV"
     gene            388548..389162
                     /locus_tag="CNE_RS19880"
                     /old_locus_tag="CNE_2c03600"
     CDS             388548..389162
                     /locus_tag="CNE_RS19880"
                     /old_locus_tag="CNE_2c03600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_041228533.1"
                     /db_xref="GI:752557301"
                     /translation="MQGSIELYGALTGNCIRAAIALDEADIPYTVRRVNLAAGEQRSE
                     QHRVLNAFGKVPVLVEYRNGGNFVLTQSNAIMLFAAERSRNKLLPADPVARAKVYERF
                     FYFLTDVIAVSHCAFRLEQIGAGAHASHIHELARASLIEAEQFLTSTEFMAGDTFSLA
                     DIAAFTIASTFSGNIQWPDHPALMRWFQTAAQRPAVVKGLKAFE"
     gene            389343..389915
                     /locus_tag="CNE_RS19885"
                     /old_locus_tag="CNE_2c03610"
     CDS             389343..389915
                     /locus_tag="CNE_RS19885"
                     /old_locus_tag="CNE_2c03610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041228534.1"
                     /db_xref="GI:752557302"
                     /translation="MRKSKVETADTRRRIVEVAAREFRIHGIQATGLNNVMSPLGLTQ
                     GGFYRHFSSKDQLIAEACSQAMTEVIDGLEAAARDSDADNGFAAVVNAYVSEHHRDTR
                     TGGCPLAAMGSELARADAQTRAAATQGFEELVDVLAKRMDGKSPKAARSSAVFAAAAM
                     IGAVTMSRVVEDSDASAAILEDVKQHLGAM"
     gene            389950..390831
                     /locus_tag="CNE_RS19890"
                     /old_locus_tag="CNE_2c03620"
     CDS             389950..390831
                     /locus_tag="CNE_RS19890"
                     /old_locus_tag="CNE_2c03620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NmrA family transcriptional regulator"
                     /protein_id="WP_013952068.1"
                     /db_xref="GI:503717992"
                     /translation="MEQRKYLITGATGKTGVYTTRFLLNAGHAVRAFVHQEDERSAAL
                     RNEGAEIFVGDLLEHDDVIRAMEGVAGAYLCYPVRPGYIQATSYFADAAKRAGVDVVI
                     EMSQISARDDSESHAARDHWIAERVLDWSGVPAVHIRPTYFSEWLTFPWVLDPLVQEG
                     KITLPYGAGRHAPIAAEDQARLIANILAEPSNHIGKTYSLFGPVELNQQEIADEIGKV
                     LGRKITYAPSTLEQYREHLEKYNLPEFVIQHFLATAVDYQNGIFSGTDGVIKEITGKA
                     PQTVAEFVEANREVFEA"
     gene            complement(390865..392529)
                     /locus_tag="CNE_RS19895"
                     /old_locus_tag="CNE_2c03630"
     CDS             complement(390865..392529)
                     /locus_tag="CNE_RS19895"
                     /old_locus_tag="CNE_2c03630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013952069.1"
                     /db_xref="GI:503717993"
                     /translation="MISVRNVTLRRGVNVVLDRASVTFNPGEKIGLVGRNGAGKSSFF
                     GLLNGTLHEDSGEFSIPAAWKMGQVAQEMPETEQSATDFVVEGDTVLLAAQAEVAAAE
                     VSDDGMRMAHAYMDLHDAGAHDAPARAQALILGLGFSAAQLSQPVNSFSGGWRMRLQL
                     ARALMCPSNLLLLDEPTNHLDLDALVWLEAWLKRYQGTLVVISHDREFLDAVTQVTVH
                     VDNAKLVRYGGNYSKFEDMRAEQLVLQQAAMAKQADKIAHLQKFIDRFKAKASKAKQA
                     QSRVKALERMEKIAPVLADAEFNFEFKEPLNVPNPLLSMLDASFGYPAPTGALPGTPP
                     TVIVRGINRSVLAGQRIGILGANGQGKSTLVKTVAHALAPIAGEISEGKGLNIGYFAQ
                     QELDVLRPLDTPMEHMIRLAKDTPAHMRAPGQSGTEQSLRTFLGTFNFSGDMVHQAVS
                     TMSGGEKARLVLCMIVWQRPNLLLLDEPTNHLDLATREALGMALNEFEGTVMLVSHDR
                     ALLRAVCDEFWLVTKGGVEPFDGDLDDYQQFLRDEARRMREQAPTQ"
     gene            <392880..393293
                     /locus_tag="CNE_RS19900"
     CDS             <392880..393293
                     /locus_tag="CNE_RS19900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011000536.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228785.1"
                     /db_xref="GI:752557553"
                     /translation="RVERLMRDNGIRARHKRRYKVTTDSKHKLPVAENLLARSFTPTA
                     PNQVLAEYGMRCSMSRKGNCQDNAPTESFFNSLKNERVHATRYRTHQEAMADLFEYIE
                     VFYSRSRRHSSLGFVSPVQFLQNWLKAQQTEDAAA"
     gene            393536..393997
                     /locus_tag="CNE_RS19905"
                     /old_locus_tag="CNE_2c03650"
     CDS             393536..393997
                     /locus_tag="CNE_RS19905"
                     /old_locus_tag="CNE_2c03650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952071.1"
                     /db_xref="GI:503717995"
                     /translation="MRSNLKYLSTAAIAATFCIGASAQTAQDAVRPPAILPLSGEPAP
                     KLIAYPALAEPLARGVVIVQFRTENFRVMPVFGKPAVDISPRIGHLHVTVDDVRGTWA
                     HTSEDPIIVVGLTPGPHKLRLELADPSHKILATEVVAVTVPDLRVSKPHEH"
     gene            complement(394309..395790)
                     /locus_tag="CNE_RS19910"
                     /old_locus_tag="CNE_2c03660"
     CDS             complement(394309..395790)
                     /locus_tag="CNE_RS19910"
                     /old_locus_tag="CNE_2c03660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011615268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-aminohexanoate hydrolase"
                     /protein_id="WP_041228786.1"
                     /db_xref="GI:752557554"
                     /translation="MKLAEYTALDGMGLHHLIATREVTAMEVAQAALAAIEAVNPQVN
                     AVLDYWPEEVEIQSAGIVSADPRPLGGVPFLLKDLGVTMQGRRSEMCSRLAMGTVAKE
                     DSYVMTSFRQAGLITLGRTAMPELAVSTTTEPVLYGPTRNPWSLQHGAGGSSGGAGAA
                     VAAGIVPIAHATDGGGSIRVPASCNGLFGLKPTRGRVSNGPHVDEVWNGLGVHFAVSR
                     TVRDSAALLDGIHGGGVGEPYYIAPPKDSYLSEIRQQPGNLKIGFMMNPFSAARADTG
                     VADALSKVARTLESLGHHVHEVAPDLGVSWDAFVQCNAKIWAANAALRINGIAAATGR
                     TVDEKHLEPATLALYRYGIEIGAVELLSALQVRNTVTRALGRFFGDYDILLTPTLPGL
                     PPRIGEYNRVETSVDGLGWIAHVFSQSPFTALSNVTGTPAMSVPLSIDPQADLPIGSH
                     FMSGFGREDTLFRLAAQLEAACPWRERRPPVWAGSIVNKTSKQ"
     gene            complement(395952..397295)
                     /locus_tag="CNE_RS19915"
                     /old_locus_tag="CNE_2c03670"
     CDS             complement(395952..397295)
                     /locus_tag="CNE_RS19915"
                     /old_locus_tag="CNE_2c03670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013952073.1"
                     /db_xref="GI:503717997"
                     /translation="MSQKDQISGSRRDGASLYRKVDIRLLPLLFIGFMFAYLDRVNVG
                     FAKLQMQSDLGFSDAAYGIGAGIFFVGYVLFEVPSNLLLPRVGARLTFSRIMVLWGIT
                     SMCMVFVNSVPVFYALRFLLGVFEAGFAPGVLFYLSRWYGSSRIAGAISIVWLAGPFS
                     GIVGGPLSAWIMTAFAGTASLAGWQWMFLIEGAPTLVLGVAAYFLLVDDPSNAKWLND
                     TEKRALAAETNTAADRRHESFLMVLRDPKVYVLAVAYLCIIAPIYALSFWLPTIIKSA
                     GVTSTQTLGWYAAIPYVAAAFAIFFGGRSSDRRQERRIHIALPAAISSLCFIGWYLAD
                     GNLAVTLVCVSVATGLMWMANIVFWAVPPAYIKGNARAGAIALINTIGLSGGFFGPSI
                     IGWSKSVTGSIYPGFLLMAAMLLMCAFIILFLRLKPGGDTALRHESLPASVGQAK"
     gene            complement(397487..398761)
                     /locus_tag="CNE_RS19920"
                     /old_locus_tag="CNE_2c03680"
     CDS             complement(397487..398761)
                     /locus_tag="CNE_RS19920"
                     /old_locus_tag="CNE_2c03680"
                     /EC_number="3.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_013952074.1"
                     /db_xref="GI:503717998"
                     /translation="MNAPTPSSSLTPVGPRINSPRLWEHVNAMARIGATAKGGVNRQA
                     LTAEDTQGKMLLLQWASRRGYQTSIDPIGNLFIRRPGRNPGLSPVLTGSHLDSQPTGG
                     RFDGVYGVLAGFEVLETLDDHGMETERPIELVVWMNEEGSRFPPPTMGSAVAAGALPL
                     TDALAIKDVNGIDVESALTAQVAELPVLEKRPLGMSGFAYIEAHIEQGPVLENQACDV
                     GIVTGIQGLHAYEIQLLGAEAHAGTTPLRHRKDALVAATTLIGCLRAAINDPEDILRF
                     TVGRLEVYPGSPNTVPGRVTFNIDLRHPDPDSLLRAGETILQLCSGEIEGCPVSAKVL
                     LRSTPITFDDRVVATVRKAAGGRAMKFLNIVSGATHDAKYTAQHIPTGMIFVPCEKGI
                     SHNEAENAREVDVAAGAQVLCDAMLAIMSEPL"
     gene            complement(398876..399340)
                     /locus_tag="CNE_RS19925"
                     /old_locus_tag="CNE_2c03690"
     CDS             complement(398876..399340)
                     /locus_tag="CNE_RS19925"
                     /old_locus_tag="CNE_2c03690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011615271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-PSP family endoribonuclease"
                     /protein_id="WP_041228535.1"
                     /db_xref="GI:752557303"
                     /translation="MQSHDIHQRLKALDIELSPAGAPAAAYVMSAQSGNLVYLSGHIA
                     KKNGNVWVGKLGATMSTDEGRAAARAVAIDLLSTLQAHTGDLNRVKRIVKVMSLVNST
                     PDFTGQHLVTNGASELFVDVFGDAGKHARSAFGVAQIPLGACVEIEVCVELD"
     gene            complement(399418..400167)
                     /locus_tag="CNE_RS19930"
                     /old_locus_tag="CNE_2c03700"
     CDS             complement(399418..400167)
                     /locus_tag="CNE_RS19930"
                     /old_locus_tag="CNE_2c03700"
                     /EC_number="3.5.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_013952076.1"
                     /db_xref="GI:503718000"
                     /translation="MLLHLSTWSEIEQFLKRSRTIVVPIGSNEQHGPTGLLGTDWLCP
                     EIIAREAEKSADILVAPTFNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVVHGFE
                     KILFLNGHGGNVSSIDAAFSELYAEASFARRRAGFALKLCNWWDLAGVGELARDQFPT
                     GHGAHATPSEIAITQYAFPDSIKSADYAPPIAPTGPIREALDFRARFPDGRIGSDPGL
                     ATREKGRALVELAAQSLARELEAFGREPMPD"
     gene            complement(400180..401466)
                     /locus_tag="CNE_RS19935"
                     /old_locus_tag="CNE_2c03710"
     CDS             complement(400180..401466)
                     /locus_tag="CNE_RS19935"
                     /old_locus_tag="CNE_2c03710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013952077.1"
                     /db_xref="GI:503718001"
                     /translation="MLVISSESAVDDTPTLYNKINWRLLPFLLICYLFAYLDRVNIGF
                     AKLQMQGDLGFSDAAYGVGAGIFFIGYVLFEIPSNLMLPRIGARKTFSRILVLWGITS
                     ACMLFVRNVPMFYAMRFLLGIFEAGFAPGMIYYLSCWYGPQRMARAIAIVFLAGPLGG
                     IVGGPVSAWLITALSGTGGLAGWQWMFLVEGLPCILLGVLALYFVPNRPADAAWLTEQ
                     EKRLLANEIGSSAAHNHSFLAVARDVRVYVLALAYFCIIAAIYAISFWLPTFIKAQGV
                     NDTVQLGWYSALPYVAAAFGMYYMGRRSDRVGERRFHSAVPATVGGLLLAASILVDGN
                     LAASLVLLTLGTCALWMAYTVFWAMPSEYIKGPAAAGGIALINTIGLSGGFWGPAIIG
                     WAKTATGNLHLGVLILSALPIIAALIILANKLPAKR"
     gene            401627..402589
                     /locus_tag="CNE_RS19940"
                     /old_locus_tag="CNE_2c03720"
     CDS             401627..402589
                     /locus_tag="CNE_RS19940"
                     /old_locus_tag="CNE_2c03720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952078.1"
                     /db_xref="GI:503718002"
                     /translation="MREINQQRLRYFREVLEQGTIRGAAESLNTSPSVITRQIRLLED
                     ELGTTLFERQARGVRPTEAAAHLLEFWHGYRSHQEKLEDQLHALKGLQQGQVQLVLSE
                     GYVDALVNEVLAPFCAQYPLLDVSMEILGVDQVLDAVAESRAHIGLAFNPPPHPRIEY
                     LASSSQPVGLLVRPDHPLALRGGAASVKDILSWPLAMMPASFGVGHAAKMLEFAENIR
                     IRPTLVTNSLTALKQFVAYENYMTLIGGEFAAYREIAAGMLTVVPIDHPLFRGTQARL
                     LVKAGRPLPAAALKLLEHILRDMPMFAQGGHRLLSAHGKSDGYG"
     gene            403075..404067
                     /locus_tag="CNE_RS19945"
                     /old_locus_tag="CNE_2c03730"
     CDS             403075..404067
                     /locus_tag="CNE_RS19945"
                     /old_locus_tag="CNE_2c03730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_041228536.1"
                     /db_xref="GI:752557304"
                     /translation="MVKDMTMKTTVRSALRFTGAAGPAAALVATLLIGNAHAATPNTT
                     PEIGFVQVNPDIKLRRLVVHNARAKGTVLFLHGFPETLYAWKDVASSLGQDYEVHAFD
                     WPGYGESSRPGVDKFSYAPRDYAKVLVDYISTTGIDKQRLVIYATDIGALPALMAAVN
                     EPAIARRIIVGDFAPFNRPQFMQERLQGLKDPATADAVHAAFNRTRDEILQNAFTRGL
                     PESSHYEVSPEFKADMARGWQNGELTSADAFYQYYTRFTRDQDDFEANLAKLKTHVTV
                     IWGEKDIYIRKEMGEELASRAHLNLKLLPGIGHYPHLQDKAATISEVRAAFDAE"
     gene            404175..404576
                     /locus_tag="CNE_RS19950"
                     /old_locus_tag="CNE_2c03740"
     CDS             404175..404576
                     /locus_tag="CNE_RS19950"
                     /old_locus_tag="CNE_2c03740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_041228537.1"
                     /db_xref="GI:752557305"
                     /translation="MNIVRITMGALVVASLAAHLHSAQAQTPEVHRTDLASHDLSVPG
                     REGIQVRVDFDRGAFAPKHSHPGEEIAHVLQGTLEYRLADQQPVRLNAGESLFIPAGT
                     PHSARNVGTGQASELATYIVTKGAPLVVPGK"
     gene            complement(404703..405197)
                     /locus_tag="CNE_RS19955"
                     /old_locus_tag="CNE_2c03750"
     CDS             complement(404703..405197)
                     /locus_tag="CNE_RS19955"
                     /old_locus_tag="CNE_2c03750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_041228787.1"
                     /db_xref="GI:752557555"
                     /translation="MHRKTFTGMNCSVAGALEQIGEWWSLLIVRECTLGTTRFDDFQQ
                     RLGIARNVLTTRLNTLLEHGVLVKVVAEGSERRTEYRLTEKGEALYPIIVGLMQWGDE
                     WCSSRKPIRLVEDSTGKPVEPVSLRVGPRTLGLRDVRLEAGEGATAQTAEIIDARNKA
                     ILGK"
     gene            405332..406525
                     /locus_tag="CNE_RS19960"
                     /old_locus_tag="CNE_2c03760"
     CDS             405332..406525
                     /locus_tag="CNE_RS19960"
                     /old_locus_tag="CNE_2c03760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952082.1"
                     /db_xref="GI:503718006"
                     /translation="MDRRLIVLASGMFAIGTDSFVVAGVLSQVSASLGVSVALAGQMV
                     TLYAMSYALLSPVIAAAAAHWPRKRLLLAGLAVFVVGNVVTALAPNIELVLASRLIAG
                     LGAAMFSPTATATGASLVPPEQRGRALAIVIGGLSSATALGAPLGTFIGGALDWRATM
                     WFVAAVGTLAGLGVAWRLPEIPTPPAISLSRRLAPLADTRVLLTLLTTWMVYAGLFLV
                     YTYIALSFDRATGGDSRVLAALLLLWGVAATAGNLAAGRLTDRYGSRRIINVAIAALV
                     IDFALLPLTSASLASAVPALIVWGVCGWGVLVPQQHRLISITPAAAPLLLGLNSAAIY
                     IGVSMSGVIGGAAIAWFDRHALGLVGAVFLVVALFVAEWARQRIARPEVRPTGVGGAT
                     SGSAR"
     gene            406592..407818
                     /locus_tag="CNE_RS19965"
                     /old_locus_tag="CNE_2c03770"
     CDS             406592..407818
                     /locus_tag="CNE_RS19965"
                     /old_locus_tag="CNE_2c03770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MexE family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="WP_041228538.1"
                     /db_xref="GI:752557306"
                     /translation="MDWAAEHGRQKSRAARRRWLLAGAVLVVTTGTLVATMALKDTRA
                     ATAPAASAPEVLVKTLAPENVRVWANFSGRLNAVDEALVRPEVGGKIVEVRVRDGQTV
                     KAGDVMFVIDPRPYEAAVARARAELASTRARAEFAAAERERAKGLIDAEAIPLSLHDQ
                     RTNEDRMAKAAVLAAEAALRQAEINLDYAYVKAPIAGRISRAEVTLGNLVQPGANAPV
                     LTRIVSNDGIYADFDVDEQAYVQSIRRHAETQNKEQHIPVEMRVQGDMERIYQGVIYT
                     IDNKIDTRSGTIRARAKFENRDRALVPGMFVSIGLAGSGDTSALVVPDVAVGSDQSKK
                     FVYVVGQDNKVAYREVALGTGLDGRHVVASGLKPGERVIARGLQFAKPDATVTPKELA
                     EDEVKTAASTAPRGAE"
     gene            407823..409567
                     /locus_tag="CNE_RS19970"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            409554..410966
                     /locus_tag="CNE_RS19975"
                     /old_locus_tag="CNE_2c03810"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(411082..411435)
                     /locus_tag="CNE_RS19980"
                     /old_locus_tag="CNE_2c03820"
     CDS             complement(411082..411435)
                     /locus_tag="CNE_RS19980"
                     /old_locus_tag="CNE_2c03820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952088.1"
                     /db_xref="GI:503718012"
                     /translation="MCTHLPLLPAFAALIVAGCNTAPIPPGKPVDIPTALQQVAAGLC
                     AFKKDAEARKQGSFDSVTVELDLTIDGAKDPPVAVAPDIQFMPTVSYGQTISVTKGSK
                     LTMTLKNVDACDMSK"
     gene            complement(412607..412852)
                     /locus_tag="CNE_RS19985"
     CDS             complement(412607..412852)
                     /locus_tag="CNE_RS19985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020326517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_041228539.1"
                     /db_xref="GI:752557307"
                     /translation="MGFVTRNGVELRTNDDFHIHHDKTTIVDGNTVETGSFNFAPSAE
                     TVNSENVVVIRDMPEVSRQYIEHWQSRWDLGKAYPTS"
     gene            complement(412944..413543)
                     /locus_tag="CNE_RS19990"
                     /old_locus_tag="CNE_2c03850"
     CDS             complement(412944..413543)
                     /locus_tag="CNE_RS19990"
                     /old_locus_tag="CNE_2c03850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952091.1"
                     /db_xref="GI:503718015"
                     /translation="MSISTNRLESFSDGVISVSLTLMLFQLQVPEGFSLKDILNNSSN
                     FFGYVLSFVYVGIYWNNHHHLFKVARGINGKIMWANLHLLFWLSMIPFTTTWTGKSAF
                     AQTPTAMYAFVLFMCAVSYSLLTRLIIKYDGEHSALGQAIGNDLKGKLSIPIYALAIL
                     ASFFSSVASFFILTLMAGIWFFPDSRIEKYLLGSNTHEL"
     gene            complement(413556..414284)
                     /locus_tag="CNE_RS19995"
                     /old_locus_tag="CNE_2c03860"
     CDS             complement(413556..414284)
                     /locus_tag="CNE_RS19995"
                     /old_locus_tag="CNE_2c03860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952092.1"
                     /db_xref="GI:503718016"
                     /translation="MSANVNASDNTETNENPSLWEICKAPILLTIVGGAIDTIGFIAL
                     LGFFTAHVTGNLVLAGAAFVKGGAGLWIKLGAIPLFIVTVIISKMLIDRNQRTHQTHQ
                     TLGWLFIAEATFLLGFMVAGLYLEPFDNPDGAGLALTGGLGLVALAVRNTASKTLIKY
                     ISPSTMMTGNTTQLGIDLSNYLRARTRTNFQDLLKSASVVIGFVIGAFLGASLYVTIG
                     FWSVLPFILPVAYMARMAFRNQFR"
     gene            complement(414347..414460)
                     /locus_tag="CNE_RS20000"
     CDS             complement(414347..414460)
                     /locus_tag="CNE_RS20000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_041228540.1"
                     /db_xref="GI:752557308"
                     /translation="MIPGRSVANGALLLGCWLAISTSSVAAAAIVANALIA"
     gene            complement(414499..415197)
                     /locus_tag="CNE_RS20005"
                     /old_locus_tag="CNE_2c03870"
     CDS             complement(414499..415197)
                     /locus_tag="CNE_RS20005"
                     /old_locus_tag="CNE_2c03870"
                     /EC_number="3.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013952093.1"
                     /db_xref="GI:503718017"
                     /translation="MSNAKLEVLTPRNSQLIIIDHQPQMAFGVQSMDRQTMKNNVVGL
                     AKAAKIFDVPTTITTVESDSFSGYTYPELLDVFPGKKTLERTSMNSWDDQKVRDALAA
                     NGRKKIVVAGLWTEVCNTTFALCAMLEGDYEIYMVADASGGTTKEAHDYAMQRMVQAG
                     VVPVTWQQVMLEWQRDWKNRETYDDVMAVAKEHSGAYGMGVDYAYTMVHKAAPRTATT
                     HESLAPVHAPVVER"
     gene            415817..417184
                     /locus_tag="CNE_RS20010"
                     /old_locus_tag="CNE_2c03880"
     CDS             415817..417184
                     /locus_tag="CNE_RS20010"
                     /old_locus_tag="CNE_2c03880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_041228541.1"
                     /db_xref="GI:752557309"
                     /translation="MLLLLAGLSACGSLPHNAPRNLPQAAAGSASAALREPTDIAGQT
                     TVAMSFSGGGTRAAAFAFGALQGLDAMRSPGGASLLDDIAFISSVSGGSITAAYYGLH
                     GKDSLATFRSVLLKDGEAGLRFSLLNPVNLARLFAGGLNDREDLRTWLDEDVFKGATY
                     ADMFRRGKPIVWINATNVYYRVAFPFSQLAFDALCSDLASFPVSEAVAASMAVPLFFA
                     PIVLQKYPEACSAPLPSLDHVQRPGQSLLLGALATAVRGHRDTSKGKYIKLVDGGVTD
                     NYGLATILQTRLLLGTAYGPMSENDAINVRRLLFIVVDAGQGPRGDWNRSQGGPSGIE
                     VASAAIDAAMATNVRMSYDAFVPMMRQWRDDLVAYRCGMPHSRQQEIAARRPGWRCDE
                     VEFFVTRISFEALDKERAASLNDLPTRLRLPEKDVDRLIEAGRDAILGNPVIREFERE
                     STEAR"
     gene            complement(417283..418206)
                     /locus_tag="CNE_RS20015"
                     /old_locus_tag="CNE_2c03890"
     CDS             complement(417283..418206)
                     /locus_tag="CNE_RS20015"
                     /old_locus_tag="CNE_2c03890"
                     /EC_number="3.1.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="WP_013952095.1"
                     /db_xref="GI:503718019"
                     /translation="MFLLQQPAVRDAQVLTRLPESFRRHDPDNAWAHANRGGATIDSF
                     LEGPVWADGNLWVTDIPYGRIFRVSMQGDWELVAEYDGEPNGMKRLVSGDFLITDYRN
                     GLVRLYAKSGTVTPFLERRNSERFRGVNDLTFDSQGNLYFTDQGQTGLHDPTGRVYRL
                     TPDGKLDVLLDNAPSPNGVVLSPDEKVLFVAMTRGNSVWRVPLQADGSVSKVGQFFTS
                     YGPSGPDGLAMRSDGHLLVANPGLGYVWVLNHRAEPVEVIRSPGGTSLTNLCFGGTEG
                     TTLFMTESTTGTILCADMSVGGAPVHGGRLA"
     gene            complement(418219..419184)
                     /locus_tag="CNE_RS20020"
                     /old_locus_tag="CNE_2c03900"
     CDS             complement(418219..419184)
                     /locus_tag="CNE_RS20020"
                     /old_locus_tag="CNE_2c03900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952096.1"
                     /db_xref="GI:503718020"
                     /translation="MLSRTIGCLVAATTLLVSLSAVAAYPDKPVRIIVPNPPGGAVDV
                     VTRKVAQKLTVQTGQSFVVENKPGASGTIGTSQVVNAPADGYTLLANDNSYTTLPYVF
                     KKLNWDHQTALVPIAPFAFSPVVLGVKADSRFKDLASLVSYAKAHPGEVTFGTGGPGS
                     SPHFAAEAFQQAAGIKLMHVPYKGAGEAMVGLLSGSVDLLVVSTPTALAPVKGNQMRL
                     LGISGKTRVDVFPSVPTFAEAGVPNFSLFNWSGLAAPKGTPNDVITRLQTEIQKALQA
                     PDMKTFLAQMGSQPGNLDSPAFAQLIQRETAQWATVAQKAHIEKQ"
     gene            complement(419277..420212)
                     /locus_tag="CNE_RS20025"
                     /old_locus_tag="CNE_2c03910"
     CDS             complement(419277..420212)
                     /locus_tag="CNE_RS20025"
                     /old_locus_tag="CNE_2c03910"
                     /EC_number="1.1.1.95"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_013952097.1"
                     /db_xref="GI:503718021"
                     /translation="MTNKQVIIVTGADLAPEALALLDDHEIVFAGKTPQTADIAALAK
                     EHNPVGIIVRYGSITAEVMDAAPALKVISKHGTGTDTIDKAAAQARGITVAAAAGANA
                     AAVAEHAWALILACAKAVPHLNDRMRQCHWDKATYKAVELNGCTLGIVGLGEIGRRAA
                     VIGVAMGMHVTAFDPYATTVPEGVTLVDLPRLFRESDVVSLHCPLTEENRGMLNRETL
                     ATFKDGAILVNTARGGLIDEPALAEALQSGKLYAAGLDSFAVEPMPVPHPFRDIPNLI
                     LSPHIGGVSNAAYVNMGVGAAKNVLAVLQGVATPA"
     gene            complement(420209..420892)
                     /locus_tag="CNE_RS20030"
                     /old_locus_tag="CNE_2c03920"
     CDS             complement(420209..420892)
                     /locus_tag="CNE_RS20030"
                     /old_locus_tag="CNE_2c03920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_013952098.1"
                     /db_xref="GI:503718022"
                     /translation="MTLPNIIKSFERVPAEIVARAAKFQPAILSDVGGRRGALHGRIR
                     ALRPSMKVAGPAFTVEVRPGDNLMIHAALALAQPGDVLVVDGKGDQTSALMGTIMMHA
                     ARQRGLAGVVIDGAVRDSLELEEMQFPVFSVGTNPNGPTKEVGGRIGHPISVGGVTVN
                     PGDYICGDADGLVVVEREKIEALLDAAAKKEDAEAQRIAQIKEGNTTAPWLLASLVTA
                     GVLKQGEAL"
     gene            complement(420936..421916)
                     /locus_tag="CNE_RS20035"
                     /old_locus_tag="CNE_2c03930"
     CDS             complement(420936..421916)
                     /locus_tag="CNE_RS20035"
                     /old_locus_tag="CNE_2c03930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_013952099.1"
                     /db_xref="GI:503718023"
                     /translation="MKAISRRCIFVLATGLVLASATTQAAPQYPTKPIRVIVPFPAGG
                     GTDIIAREVTNTVAKSTGWVFVVENKPGSGGNLGVDAAAKAPADGYTIVMGQTSNLAI
                     NPSLYERLPYDPLKDLTPISLVASAPLVLVTHVNSPYKTLKDVIQAGKAKPGAINFAS
                     PGNGTVAHLGGELLQTTAKVKFTHVPYKGAAQAVNDLMGGQVDLYMASVPTLLGHIKN
                     NRMRPLAVTSPKRLQDLPQVPTVAELGYPGFDTATWFGFVAPAATPKDIVVRLNIEFN
                     KALKSPALATKLDEQGASVLTGTPEAFSALIKQDIGRWASVIKASGTKLD"
     gene            422014..422784
                     /locus_tag="CNE_RS20040"
                     /old_locus_tag="CNE_2c03940"
     CDS             422014..422784
                     /locus_tag="CNE_RS20040"
                     /old_locus_tag="CNE_2c03940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013952100.1"
                     /db_xref="GI:503718024"
                     /translation="MNANSDPKGASRGDDGAGGVIAVTRALRVLEAFGVNDPQLSLAE
                     LSRRTGIHKTTVLRLARTLAADNYLVQKEDGNWRLGRAAGWLGACYQATFNVQEVVEP
                     VLRELTIKTGESASFYVREGQQRTCLVRVEGPQAIRHHVRIGAALPLDSGSPGRVILA
                     FSGEPGELYEMIRRRGFHLSLGEREAEVSSVSAPVFGLHWRLLGSMCISGPTSRLSEE
                     RLLELAQTVVDAANKLSYAMAGSQRPAMQIERPSTWHP"
     gene            complement(423084..423398)
                     /locus_tag="CNE_RS20045"
                     /old_locus_tag="CNE_2c03950"
     CDS             complement(423084..423398)
                     /locus_tag="CNE_RS20045"
                     /old_locus_tag="CNE_2c03950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011301944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228542.1"
                     /db_xref="GI:752557310"
                     /translation="MDMARSREAPERIADETTLLQFRYFAAAAETRQFSKAATTEHVS
                     QSAIPNAVLTLEQHLAVRLFACLPQGVALTAEGHHFYQHAPAQPAGALSHQIPGQGVN
                     LK"
     gene            423750..424016
                     /locus_tag="CNE_RS20050"
                     /old_locus_tag="CNE_2c03970"
     CDS             423750..424016
                     /locus_tag="CNE_RS20050"
                     /old_locus_tag="CNE_2c03970"
                     /EC_number="1.2.7.8"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013952103.1"
                     /db_xref="GI:503718027"
                     /translation="MRDTAFGIFGRPTERRAERQLIAEYLATVEELAQSLSDGKLDTA
                     VAMASLPDDIRSFGHVKEVNMQKTAQRRTALLGQFRSGALSAAA"
     gene            424200..425294
                     /locus_tag="CNE_RS20055"
                     /old_locus_tag="CNE_2c03980"
     CDS             424200..425294
                     /locus_tag="CNE_RS20055"
                     /old_locus_tag="CNE_2c03980"
                     /EC_number="2.6.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952104.1"
                     /note="catalyzes the transamination of the branched-chain
                     amino acids to their respective alpha-keto acids; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="WP_013952104.1"
                     /db_xref="GI:503718028"
                     /translation="MNTENQLQFVVEPHPGPTPADEIAAKLANPTFGRIFTDHMVTIR
                     WTDGRGWYDAKVEARRPFQIDPACAVLHYAQEIFEGMKAYRGEDGKISLFRPQENARR
                     FRASAARMSMADLPEATFLQAVEALVDIDRAWIPGGDGSLYLRPFMFASENFLGVRAS
                     AEFVFCVIACPVGPYFKAGKSAVTVWVSDRYTRAAPGGTGAAKCGGNYAASLIAQTEG
                     SANGCDQVVFLDAAEHRWIEELGGMNVFFVMDDGSLRTPPLTGTILPGITRASIIELA
                     RHEGIPVNETAYDFETWRTDAASGRVKETFACGTAAVVTAIGQVRHAGGGFTIGNGGE
                     GEVTQRLRSLLTGIQRGKIADPFGWVHHVD"
     gene            425560..426957
                     /locus_tag="CNE_RS20060"
                     /old_locus_tag="CNE_2c03990"
     CDS             425560..426957
                     /locus_tag="CNE_RS20060"
                     /old_locus_tag="CNE_2c03990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_013952105.1"
                     /db_xref="GI:503718029"
                     /translation="MSLFRTKDIDAMLVDRRVCSLKKVLGPVDLVLMGIGAIIGTGIF
                     VLTGTGALTAGPALTVSFVIAAMACGFAALCYAEFASAIPVSGSIYTYSYATLGEIIA
                     WMIGWDLLLEYGLATSAVSVGWSGYFQSLAAGFGLHLPAALTAAPGAVPGVHTLFNLP
                     AFLIMLITTWVVSCGVRESVRLNNLMVAIKISVVVLFIAVGVWHVKPANWQPFAPFGV
                     SGIFNAAALVFFAFIGFDAVTSAAEEVRNPHRDLPVGIIGSLTVCTVLYVIVAAIMTG
                     VVPFAKFAGIDHPVSLVLQYAGQNWVAGFVDLGAILGMTTVILVMTFGQTRVIFAMSR
                     DGLLPAKLSSVHPVHATPFFATWTVGIVFAMIAAFVPLNVLAELINIGTLSAFTLISI
                     AVLVLRRTRPELPRAFRCPGVPVVPLLSVGFCLFLMAHLQALTWIAFLIWLGIGLSIY
                     FRYARRNAVLHGGTR"
     gene            427274..428302
                     /locus_tag="CNE_RS20065"
                     /old_locus_tag="CNE_2c04000"
     CDS             427274..428302
                     /locus_tag="CNE_RS20065"
                     /old_locus_tag="CNE_2c04000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid dehydrogenase"
                     /protein_id="WP_041228788.1"
                     /db_xref="GI:752557556"
                     /translation="MSHERVTLATDPESGLQAIIAIYNTRLGPAFGGCRYWAYPAEVD
                     ALSDALRLSQGMAYKNALAGLPFGGGKAVILRSPAQTDRQQLFRAFGRMVESLQGSYI
                     TAEDVGTTVDDMRAVQAETRYVSGMPRDGGFGGNPSPWTAYGVFVGIEAAALYRLDRK
                     SLAGLSVAVQGLGSVGWELCRRLHEAGATLTVADIDAGRTTQAQQQFGARVVSPEAIT
                     AVDADVFAPCALGAVITPAVAESCRFRVVAGGANNQLASLAEGDTLHQRGIFYAPDFL
                     INAGGIVSCAREYLGGVDESALRDEVAGIRERVLRLAQRVESTGQAPARAAVTWAHEV
                     LSRGIGPN"
     gene            428383..>429525
                     /locus_tag="CNE_RS20070"
                     /old_locus_tag="CNE_2c04010"
     CDS             428383..>429525
                     /locus_tag="CNE_RS20070"
                     /old_locus_tag="CNE_2c04010"
                     /EC_number="2.3.3.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013435918.1"
                     /exception="unextendable partial coding region"
                     /note="catalyzes the formation of 2-isopropylmalate from
                     acetyl-CoA and 2-oxoisovalerate in leucine biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_041228789.1"
                     /db_xref="GI:752557557"
                     /translation="MLDTTLRDGEQSPGAAMTVRQKIAVAEYLDALNVDVIEAGFAAS
                     SDGDHDAIREISGQVKGSVICSLARANERDIERAANALRSARRSRIHTFIATSALHME
                     KKLRMTPEEVYLRACTAVRFARQFTDDVEFSPEDGSRSDPDFLCRVIEGVIKEGATTI
                     NVPDTVGYAMPVEFAEGLRKLRERIPNSDKAIWSVHCHNDLGLAVANSLAAVKYGGAR
                     QIECTINGLGERAGNASLEEVVMAVKTRRDLFGLDVGVNTTHLVAASRAVAEATGFIV
                     PANKAVVGANAFAHASGIHQDGILKARETYEIMRPEDVGWDKGALVLGKLSGRNAFKH
                     RVQELGLHFPDDEGLSAAFARFKGLADTKAAITDDDLRHIALGVAES"
     gene            430165..430734
                     /locus_tag="CNE_RS20075"
                     /old_locus_tag="CNE_2c04020"
     CDS             430165..430734
                     /locus_tag="CNE_RS20075"
                     /old_locus_tag="CNE_2c04020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952108.1"
                     /db_xref="GI:503718032"
                     /translation="MTEFPLTFISQIEWESWLAQNGGTSTGAWLRLAKKGAEQPTVTY
                     EQALEGALCYGWIDGKKQAESEKYWLQRFTPRSAKSIWSKLNKDRAEALIAAGRMRPP
                     GMTQIERAKKDGRWEAAYASASKSIVPDDLQVALDANPRAKKFFATLDSRNRYAILFR
                     VQNAKKPETRARKIEEFVNMLNRGEAFYP"
     gene            complement(430978..>431884)
                     /locus_tag="CNE_RS20080"
                     /note="histidine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(<431884..433077)
                     /locus_tag="CNE_RS20085"
                     /old_locus_tag="CNE_2c04050"
     CDS             complement(<431884..433077)
                     /locus_tag="CNE_RS20085"
                     /old_locus_tag="CNE_2c04050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952109.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228790.1"
                     /db_xref="GI:752557558"
                     /translation="MPAIPAASTVVDSALFRDAFGTKKMRQIFSDGALVQRYIDVEVA
                     LAKAEARAGVIPAEAAEAIARESRIERINFDHMREETDIVGYPILPLVHQLVAMCGEA
                     GRYVHWGATTQDIMDTAVALQMRDALDSIDADIRELRAILADLSARHRNTPMACRTHL
                     QQALPVTFGYKTAIWLAMFDRHQQRIAELRPRVAVVEFAGAAGTLASLGGQGDNKGFA
                     VQEALAAELGLGVPATTWHVARDGFAEAVNLLALVTGSLGKIALDIMIMASTEFAEVY
                     EPFVKGRGASSTMPQKRNPISSELMLAASKAVRQHAGLMVDAMVQDFERATGPWHAEW
                     IAIPESFILTSGALHQAKFALGGLIVDEARMQHNLGISRGLIVAEAVMMGMAPYIGRQ
                     QAHDVV"
     gene            <433083..433455
                     /locus_tag="CNE_RS20090"
                     /old_locus_tag="CNE_2c04060"
                     /note="GntR family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            complement(433591..437538)
                     /locus_tag="CNE_RS20095"
                     /old_locus_tag="CNE_2c04070"
     CDS             complement(433591..437538)
                     /locus_tag="CNE_RS20095"
                     /old_locus_tag="CNE_2c04070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase"
                     /protein_id="WP_013952111.1"
                     /db_xref="GI:503718035"
                     /translation="MARLKIEVLGGLQVRLAGQHGSLAFPTRKSKAILAYLALSPGML
                     RSREQLASVLWERSAEEQARASLRQTLSSLRRVLPNAPPILNAEPDAIWLDGQFVEVD
                     ALQFTSLATERSPDSLSKAVALYRGALLDGFSLREEPFEQWMIIERRWFHERAVEVFT
                     ELVGHYEQSGEFDRAIATASRVLALDPSLEWAHALLMRLYARTGRRNAAVRQYQECVR
                     VLNTELGIAPAESTQRLAAQIQQDSGGAREPAGPAVAVGEPAKQSGIASRAGYAADSA
                     TALPAERKHLSVLCARVREPISVIDQETALERVDAVLKAMVDSVQRFGGLVTQLRSDG
                     VTALFGAPVAHEEHAVEACYAALAMRARISALIERSLDVRIGVHSGEAVVRTIGDEGS
                     QHYDALGSVPQIANQIDVALAAGEIGVSADTARCAEGFIELSDLRARSLPGATPPLEI
                     FTLGTKSELRLRWNARTVRGLTHFVGRDTEMASLQGMLARAGHSAGQVCAVVGEPGVG
                     KSRLVHEFVNSEQAAGWTKFETGATSRDTSAIYLPLANLLRTWFGIGTHDTLDGAAEK
                     LRRGVDAVDPALAWTCPALAAMLDLPPDDPQWDMATPPQRRKRTLEAIASLMIRASEH
                     RPSILVVEDLHWIDDGTQAVLDHLVDFIGASRVMLLVTHRPEYRHTWSGKSYFAQLHV
                     DSLGTEGAKQLLQSLLGDGSELSALRRHLIERTGCTPFFLEESVRALADSGALVGQKG
                     AYQMARTIDTFDIPSTVHAVLASRIDRLSAQQKALLQMAAVIGHEFPVDLLEPIANLD
                     RERLLDLLADLQAAEFLYQTRLLPHQQYTFKHALTHRVAYASVLKERRRPIHVQLVGV
                     IEQLYTQRLDEHVELLAHHALAGELWDKAVHYLYQSAGKALQRFAYQQAVDHLNRGLE
                     IIRMLPRSPALLRQELEYQKVLGVTMMAAKGWAAKEVLDAYTRARALCEELGDESELF
                     TVLRGEGQYRMIRGESEIARELGNRCTALTAGSHDPGMQIETHHLFWTNSFFMGEYAA
                     SEFHSRSGMVLYERERDHPLTFKYSGHDPGVCCRCFTALVQCLRGYPDKSLAICDEAL
                     GLAQELRHPLTTALTYWACSFAHILRGEPELAKQWAAREIAVCDEYMLPLLLSQGKFQ
                     LGWSLAQMGDLDEGIERMREGISAISATGAEMGLPYFNALLGEALGCAGKPEAGLVEI
                     DRALAAVNRHGGRFQLSEMLRLKGELLATRHPMQRNEALATLHEAIAVAQRQGAGLPG
                     LRAAISLARQLAAAGDIQHACAVLQPACDSIREGSDLTDVRTAQTLLAELKNR"
     gene            438031..438975
                     /locus_tag="CNE_RS20100"
                     /old_locus_tag="CNE_2c04080"
     CDS             438031..438975
                     /locus_tag="CNE_RS20100"
                     /old_locus_tag="CNE_2c04080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952112.1"
                     /db_xref="GI:503718036"
                     /translation="MEIMTDGHRVTTTNRYAKCIAASKRVRWDIDRDVIRGRSFDFTK
                     KFLPDALSKVDSLAFLGHDEQRLLSQIQGRTYANMFGLVERFIAAKVLEMSGPYRLGD
                     QSALEALVRFSDEEIKHQELFRRIERMCAEGMPAGYSFLPDANSVASFVLAKSTWAVL
                     ALTCHIELFVLAHYRGSIDGDMNSSELWKDVFLYHWREESQHAILDEIEWQREDARLS
                     PEERDAAVNDLIELVAAVDGILQTQANADADYFAMICPRSLSMADKDSVRIGLLAAYR
                     WQYIISGVQEPRFSQALSSMITGSQLFRIETAMAPIMS"
     gene            439158..439397
                     /locus_tag="CNE_RS20105"
     CDS             439158..439397
                     /locus_tag="CNE_RS20105"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228543.1"
                     /db_xref="GI:752557311"
                     /translation="MARSIQKGTFVGWYRLNSRFRRTLADDFDARCIMIRFLAAAILC
                     GLTLSMFGCAGPQMGADNTHRFNSDPYNYEFSRNL"
     gene            439860..440834
                     /locus_tag="CNE_RS20110"
                     /old_locus_tag="CNE_2c04110"
     CDS             439860..440834
                     /locus_tag="CNE_RS20110"
                     /old_locus_tag="CNE_2c04110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_041228791.1"
                     /db_xref="GI:752557559"
                     /translation="MFGVADLYTEYVKSGANHVARVEDGGLYQSRWGLRGKEELAPGL
                     STVFTLETGLALDSGTAQQGGRLFGRQAWVGLSSKDWGALTLGRQNTPIYYIEGQASA
                     FGFSPYGPLGRLQNGGPAGSSLTARADNSIRYESPELAGLQGSVIYSFGAERTSAPRD
                     ADRLAAGGLTYARGPLWLGLAYERTYSIGAVTDADRDERAIGATYEFPWVKLFANVRQ
                     ATRWVPGQATLKDRGFHVGTTIPVGGAGLVLLAYGMQQSVGTPNRGQQASIGYQYSMS
                     KRTTLYANASKIWNTNKANYTFSNIPNEVTASSVSDPRGVMMGMRHLF"
     gene            440941..441429
                     /locus_tag="CNE_RS20115"
                     /old_locus_tag="CNE_2c04120"
     CDS             440941..441429
                     /locus_tag="CNE_RS20115"
                     /old_locus_tag="CNE_2c04120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228792.1"
                     /db_xref="GI:752557560"
                     /translation="MAFGLHLFCAPIASAAGVTQLQTLGADAAVRLTDAAKRFAEDRK
                     LAVSIVVVDVSGHFLSGVRMDGAPFATFDVARGKAIASAATGGASGAELVKRYQANPI
                     VFGQMSSLVYGGPVFPSQGSLGIYVGGRLVGAVGVSGGPSDVDEEIGRRGVVAIGATE
                     AP"
     gene            complement(441528..442316)
                     /locus_tag="CNE_RS20120"
                     /old_locus_tag="CNE_2c04130"
     CDS             complement(441528..442316)
                     /locus_tag="CNE_RS20120"
                     /old_locus_tag="CNE_2c04130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013952117.1"
                     /db_xref="GI:503718041"
                     /translation="MHYNQDGAVVTIGNGPNHVIALHGWFGHARGWGPFVDVLDGDRF
                     TYAFIDYRGYGSRRGIQGRFDMREIAADVLALGDELGWQRFSLIGHSMGGKAMQAVAM
                     LAPARVTAMVGVTPVPPTPVPFDKPARALFERAAGELAARIAVLDNSTGKRLSRHWVE
                     KMVRASTQHADADAFAAYFRAWADTDFSAEVAGSSVPTLLLVGEHDPSLTADIMEQTY
                     GKAFLDLAIDVIRNAGHYPMDETPVDLATRIERFLSDIQSRSEP"
     gene            442588..443634
                     /locus_tag="CNE_RS20125"
                     /old_locus_tag="CNE_2c04140"
     CDS             442588..443634
                     /locus_tag="CNE_RS20125"
                     /old_locus_tag="CNE_2c04140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952118.1"
                     /db_xref="GI:503718042"
                     /translation="MQSRKPPSFLTAPRRVATLAAITAAITATLAVAVAGLRPVAANA
                     AAADTNIQASWKPSKPIVFIVPFPPAGINDVLARALAQRLSNALGQPVVVENRPGASG
                     NIGAEALVRAAPDGYTIGILNSIHAVNAAFYRKLPYDVTRDLVPVAPLGESPLVLVTN
                     PHTPYKSVPELIAYAKANPGKINYGGPTSYPLEMIKTMAGVDITNIPYKGSGPTINDM
                     IAGHIDLATGPLLEYMPHVNSGKLKLLAVGTASRLKALPNVPTVAESIPGYDTTVWYG
                     VFAPKGTPAPVVERLRGEIHAIMSDAGIRAKLTGLSVDTAFSQTGVTGLSTRLTSETQ
                     RAHQIVAKTGGYLN"
     gene            443694..444317
                     /locus_tag="CNE_RS20130"
                     /old_locus_tag="CNE_2c04150"
     CDS             443694..444317
                     /locus_tag="CNE_RS20130"
                     /old_locus_tag="CNE_2c04150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_041228793.1"
                     /db_xref="GI:752557561"
                     /translation="MSACMLALCALAVPSLAQPAPEAGESRPARLMVEQVCAACHGNT
                     GQSTQKEYPSLAGQNADYLFKQLRQFKAGAGEPALRQDATMAAVVQSMSETEMREVAR
                     YFSRQPPARGQAALPHLVEAGKAIYWKGNPSNRLPACISCHRPKGEGIAPDFPRIAGQ
                     QPEYVVRQLHAWRSGTRGGPGKLMSLLVPLMTDEEIVAVAQNVAQLH"
     gene            444388..445524
                     /locus_tag="CNE_RS20135"
                     /old_locus_tag="CNE_2c04160"
     CDS             444388..445524
                     /locus_tag="CNE_RS20135"
                     /old_locus_tag="CNE_2c04160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetamidase"
                     /protein_id="WP_013952120.1"
                     /db_xref="GI:503718044"
                     /translation="MMIDRRHWLKAAGALGLGAASLKAAAQVTAGRNTPLAASDAASL
                     PIVKPGKIHRIESATETVRVGILDPKAAPVASIESGDLVMYPNTWVNWANGASYGMSY
                     EDREPVRKRFPQGPYSNVGPVELRGSMPGDVVECRMVKLRPIGWGWNSAPKGVGALPN
                     DFAKPYLRYFKFDESRQYTEFAPGIRIKLAPFQGVMAVQPAGDEPVSGILSGPYGGNL
                     VLRELVEGTSLFLPVQRPGAMIWTGDSHAAQGDGVVNQTAIETAMEDMQIQYFLHKQR
                     PLALPMAETPSHWIILGFGKNLDEALVACLRQMLNWVSAATGMDPHDVYSLASITSDF
                     RITQYSNQTASNYTSIPAKTVHGMLPKAVFDAVIQDKLSRSLRG"
     gene            complement(445557..446420)
                     /locus_tag="CNE_RS20140"
                     /old_locus_tag="CNE_2c04170"
     CDS             complement(445557..446420)
                     /locus_tag="CNE_RS20140"
                     /old_locus_tag="CNE_2c04170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013952121.1"
                     /db_xref="GI:503718045"
                     /translation="MAKDRQIRIVHGSFGRATLHRISGPLVAHAHAEFHLIFKIGGTD
                     ATFKIDGQPATLTDGCALLINPWSTHAKSAKEGSPSLLLALLLEPEWLGRTLGVDNPA
                     GGLHFSKALVRMDADTVTSLTALGTCLARDLADDSAIGSADCEAAVANLARRVSACHL
                     QRRSMTEVLANTRPLDYRIKRATEYIRSHAGENPNVETVASAVGMSRSRLFHQFKACM
                     GISPQQYLDWIRIGIATRLLAERHASIGDVAHQLGFSAQGHFTRFFVQHLGLSPSEFR
                     RTGMPGGAHGD"
     gene            complement(446775..447821)
                     /locus_tag="CNE_RS20145"
                     /old_locus_tag="CNE_2c04180"
     CDS             complement(446775..447821)
                     /locus_tag="CNE_RS20145"
                     /old_locus_tag="CNE_2c04180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011089014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bll6274 protein"
                     /protein_id="WP_013952122.1"
                     /db_xref="GI:503718046"
                     /translation="MTARPSTMISAAGLQAFAQALLASAGLHEPGASLVAESLVWADL
                     RGSPGHGVSRIPQYTAWLASGDMNGQAQPRPGLSLPALTVVEGDRCAGALGMRIAAGQ
                     AIAGARQAGASLVLLRETTHTGALGFHTAHVASAGMFAMAMAASSPLMAYHGASVAGV
                     STAPLSMACPGLGEPIVFDMASGAVAFGKLMQARATGRPLEPGWAIDAMGNPTTDARQ
                     ATTPLPLGGPKGSGLALMAEIACSLLTNHPILAPTLLAPAAGHRHTQNAWLLVIDIAQ
                     VVDPSLFQAQLAELAGAIHNLPASVEGPPRLPGERGYAEARERGANGIALAPVTADAL
                     EALASQAGIRAPWA"
     gene            complement(447818..448711)
                     /locus_tag="CNE_RS20150"
                     /old_locus_tag="CNE_2c04190"
     CDS             complement(447818..448711)
                     /locus_tag="CNE_RS20150"
                     /old_locus_tag="CNE_2c04190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007436151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228544.1"
                     /db_xref="GI:752557312"
                     /translation="MSVHTVVKFDSDGLRLAGALHLPPDLAAGERRPAIAVLHGFGSN
                     KDDGMVQLATRLFSSLGYVVLRFDMRGCGNSEGARGKVLCEDQVSDTRNAVSYLQSLP
                     EVEPAKIAVMGHSFGAAVAVYAAGVDPRIVACISSAGWGDGEVKLRQQHAGSAAWQRF
                     EAMVEEGRARLATGQSMQVSRFDIVPIPPEMRSSLPAGSFMEFPFEVVESMLRFRPNA
                     VVGNIAPRPLLLLHPADDSVTPTDQSIGLFRNARMPAELHLFSEIDHFIFSDDNRAVL
                     NLVTDWLHKFFPARQASLGAA"
     gene            complement(449016..449543)
                     /locus_tag="CNE_RS20155"
     CDS             complement(449016..449543)
                     /locus_tag="CNE_RS20155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228545.1"
                     /db_xref="GI:752557313"
                     /translation="MSQGSRHFRKANLTVLCMAGVLVSCTTPRISAPPELQPTDARGT
                     IAVLHASGVQIYQCKRANDGRLLWSFLAPEATLKDDTGQLVVKHYAGPTWEAPDGSKV
                     TGKVLRQTPNAQEPDSIPLLLLQATSTGGTGLLARTRYVQRLNTLGGQALPQACTQEG
                     LENRMPYRADYVFLE"
     gene            complement(449963..451409)
                     /locus_tag="CNE_RS20160"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(451747..>452049)
                     /locus_tag="CNE_RS20165"
                     /old_locus_tag="CNE_2c04230"
     CDS             complement(451747..>452049)
                     /locus_tag="CNE_RS20165"
                     /old_locus_tag="CNE_2c04230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013958590.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228794.1"
                     /db_xref="GI:752557562"
                     /translation="QYASAEYQTLLARHQIVCSMSRKGNCWDNAVTERFFLNLKMERV
                     WQRQYANHAEARRDITQYIVGFYNPVRLHSTLGYLSPAAYEAKSIEKEPICLSEIT"
     gene            complement(452057..453454)
                     /locus_tag="CNE_RS20170"
                     /old_locus_tag="CNE_2c04240"
     CDS             complement(452057..453454)
                     /locus_tag="CNE_RS20170"
                     /old_locus_tag="CNE_2c04240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013952126.1"
                     /db_xref="GI:503718050"
                     /translation="MGRPAGWMQKLTGRGAMRSPGAPSHRREIERRFWAQIATGITSE
                     KAAEAVGVSQAVGARWFRYRGGMPLFMSNPISGRYLSFAEREEIGLLSLQGVGVREIA
                     RRIGRSPSTVSRELTRNAATRGGQLEYRASVAQWKAELVAKRPKPSKLVTNPRLRHYV
                     QDRLEGKVCDADGREISGPRQAPFKGRNKPHRGDRKWVNGWSPEQISNRLQIDFPDDE
                     SMRISHEAIYQALYIQGRGALKRELVSCLRTGRALRVPRARAQAKAWAHVSEDVMISS
                     RPAEAQDRAVPGHWEGDLIIGLNRSAIGTLVERSSRFTMLVHLPREKGYGSTPRTKNG
                     PALAGYGAVTMANALKKTVSDMPAQLWRSLTWDRGKELSDHARFTVESGVKVFFADPH
                     SPWQRGTNENTNGLLRQYFPKGTDLSRWSAREIQAVANALNTRPRKTLGWKTPAEALD
                     DYLKSVQQSSVATTG"
     gene            complement(<453502..454086)
                     /locus_tag="CNE_RS20175"
                     /old_locus_tag="CNE_2c04250"
     CDS             complement(<453502..454086)
                     /locus_tag="CNE_RS20175"
                     /old_locus_tag="CNE_2c04250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013958590.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228795.1"
                     /db_xref="GI:752557563"
                     /translation="MSYRVVAHLQQEAVSVSNACRVLQVSRSGYYAHRRAKPSMKTLQ
                     EQTHVKAAFAASGASYGSRRVMHAVREQGVRLGRYRIRRLMREAGLRATWKRKFVSTT
                     DSKHTLPVAENVLDRQFDVAEPNRAWTSDITYVRTAQGWLYLAVVLDLYSRKVVGWSM
                     APTMPADLVMSALSMALQQRRPAPGLVLHSDRGSQ"
     gene            complement(454083..454379)
                     /locus_tag="CNE_RS20180"
     CDS             complement(454083..454379)
                     /locus_tag="CNE_RS20180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006051384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013958589.1"
                     /db_xref="GI:503724513"
                     /translation="MTRRRRQFDASFKLEVVRMVRDQGLSVSEVCRSMELGETAVRRW
                     MAQYDAECAGGPGVGKPLTAEQQRIRQLEAENRQLREDNALLKKASAFFARELK"
     gene            complement(454672..455280)
                     /locus_tag="CNE_RS20185"
     CDS             complement(454672..455280)
                     /locus_tag="CNE_RS20185"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228546.1"
                     /db_xref="GI:752557314"
                     /translation="MEVKLLRRSFVALAAAALAACAASSIDPQTKASIGSVYVEPVQL
                     SKATVFGPNAREVDTVSGKVPATASEAISRIQHVLDTQANLSQLIERQAKQDLAIRGY
                     RLTDDASHATAKLKITVRHALSVPVGANDVRGIAMSVGTEMVRVSDGKQLFLAGASQI
                     KDPGTKGVRLMPYAEWFTNEGFLVEQYRLVAWLLTAQTLEGL"
     gene            complement(<456094..456291)
                     /locus_tag="CNE_RS20190"
     CDS             complement(<456094..456291)
                     /locus_tag="CNE_RS20190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013957083.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228796.1"
                     /db_xref="GI:752557564"
                     /translation="MQEQTASKQQTVLAAIPEEFRESMDCISAGLDRVLALLEVESEC
                     SDACFGIRCLVEMIKAKFDRTS"
     gene            complement(456607..457104)
                     /locus_tag="CNE_RS20195"
                     /old_locus_tag="CNE_2c04300"
     CDS             complement(456607..457104)
                     /locus_tag="CNE_RS20195"
                     /old_locus_tag="CNE_2c04300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952132.1"
                     /db_xref="GI:503718056"
                     /translation="MHHTDDALPEHEFTAIHEPRLWRDKGWTARVIKNEDGDGWAVEM
                     IRDGSAEPALVGPWTMGRNKVDPKPLDATAHQTLVKTASEVIRRHEQQLHAQLNKQVS
                     IESESGTVMVKLVITPDEFEPFGTLTAEDSFGDVLATVKVRPDFRLTRDSAERWAAGG
                     FDRIR"
     gene            complement(457322..459685)
                     /locus_tag="CNE_RS20200"
                     /old_locus_tag="CNE_2c04310"
     CDS             complement(457322..459685)
                     /locus_tag="CNE_RS20200"
                     /old_locus_tag="CNE_2c04310"
                     /EC_number="3.5.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013952133.1"
                     /db_xref="GI:503718057"
                     /translation="MHLLRFSTEAYPRNRRGAAWRDELRAARLHCESLCADHTLHGTI
                     QSRTTPAGIELTCIASVPQTLAITSGDGRGLMLVMLTEGEAHLAAPELREPLRPGQVV
                     CVPEHAARRLALATSFRMLIVHIGQALLSARITAPLPRSALVLSGDSAELFARLLQSM
                     AASFDTIVSANAKAIQPFDNTITACLDAALADSQPSAPPDMTPSRAAVFARVCSRIDA
                     RLAEPELSLAAIAADERMSARYLQKLFEKSGSSFSAYLRTSRLERCRADLANHQYDKL
                     SVSDICYRWGFNDPSHFSHAFREQFGLSPRAYREQTANTPEHRPPQNVSRGLPAHAKR
                     APASPGAPANDVPAARLQPAPTIVPITQARSHAARPEGRHHWLQATDKTVHWGYLSHD
                     LPPVLEVMPGDTVTIETLTQHASDDRERMIEGDAGAESVFHWTAEQKNVNRRGAGPID
                     ASVYGRGAGEGFGVHICTGPVAVRGAMPGDVLEVRILDVRPRPCCNPRFAGRAFGSNA
                     ATWWGFHYRDMLTEPREREVVTVFEIDCERADSRARAVYNFRWTPQRDPFGVLHPTID
                     YPGVPVDHDTIVKNYDVLRDIEIPVRPHFGVIAVAPAQDGLIDSIPPSSFAGNLDNWR
                     VTRGASVYLRVAVPGALLSIGDPHASQGDSELCGTAIECSLTGDFQLILHKSTMIDRD
                     APFADLSYPLVETADEWILHGFSSPNHLAELGQMAQSHIYLKSTLDDAMRDAFRKTRR
                     FLMSVKGLSEDEAVALISVAVDFGITQVVNGNWGVHAIIRKSMFTRR"
     gene            complement(459783..459974)
                     /locus_tag="CNE_RS20205"
                     /old_locus_tag="CNE_2c04320"
     CDS             complement(459783..459974)
                     /locus_tag="CNE_RS20205"
                     /old_locus_tag="CNE_2c04320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952134.1"
                     /db_xref="GI:503718058"
                     /translation="MLEIALGSTELQAAAVGLVTGVIYTAVRAPIPAPNVLGGIFAIF
                     GTFAGFVLVAAMRGQLLFG"
     gene            complement(460007..460216)
                     /locus_tag="CNE_RS20210"
                     /old_locus_tag="CNE_2c04330"
     CDS             complement(460007..460216)
                     /locus_tag="CNE_RS20210"
                     /old_locus_tag="CNE_2c04330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010812532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010812532.1"
                     /db_xref="GI:498512086"
                     /translation="MQYVYIGRNELVALIVGLVTGTLYSWLNLPIPAPNVTGGICAIL
                     FTYIGYLIVHAWRRTIAFGRPPESR"
     gene            complement(460249..461274)
                     /locus_tag="CNE_RS20215"
                     /old_locus_tag="CNE_2c04340"
     CDS             complement(460249..461274)
                     /locus_tag="CNE_RS20215"
                     /old_locus_tag="CNE_2c04340"
                     /EC_number="3.5.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formamidase"
                     /protein_id="WP_013952135.1"
                     /db_xref="GI:503718059"
                     /translation="MLHDLPARPETVHWGYFDAAKAPALTVKSGDLIRAEAVTHHAGD
                     APDLMMDDAIREIFRAIPHDDRNPGVHIMTGPIYVEDAKPGDVLEVRYLQMIPRFRFG
                     ANAAAHWGQLYKEFEKERVTIYELDQRSNTAHALYAFDYPGKMTIPGKLVDDRECCRQ
                     PALAGVRVPVRPHLGTAGVAPDARGRVTTVEPGLHGGNIDNWRIGAGATMYYPVQVDG
                     ALFSIGDPHISQGDGEVSGTAIEASLNVLFQVVLRKDFHFPSPLLETPDCWVVHGFHE
                     DLDEAGKNAARDMIHLLTEQQGLSRDDAYSLMSVSADFGVTQVVDGTQGIHCTMPRSI
                     FPPKDKG"
     gene            complement(461566..462888)
                     /locus_tag="CNE_RS20220"
                     /old_locus_tag="CNE_2c04350"
     CDS             complement(461566..462888)
                     /locus_tag="CNE_RS20220"
                     /old_locus_tag="CNE_2c04350"
                     /EC_number="2.7.13.3"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013952136.1"
                     /db_xref="GI:503718060"
                     /translation="MDAKVAQAEDGRTSLAGVARHAWQTVFETAARATLLDEESVIRL
                     RRIQMVGALGVIGHPLYYVIWSYIFPQPYENLWLRLVCTALFVPLLFASAFSDRRWLP
                     PYALFAITVGLPFAFIFFYLENGGSMVWAESVIIAVVILYHFNTAFATIALFSGAAAA
                     IALFVLAGNSMGGIPWEPVLLQLPVIGFVIAVLVVIKMDRQLLAEQKRRGMAAALATV
                     AHELRTPLTSLAMTARGLKARLPAALDQDTPLRDGLMQAVARMESDLAHISNSIELLV
                     ANSKNPDNATQELFELGGVIRDAVGRFPFEQSDLELVTVDLPGPAYVMGNAQLFGLVT
                     TNLLKNALEATKRAGKGTIHIRCEVRPDAVHVVFRDTATGVPPQVLARMFQPFFSYPA
                     HRGTGIGLAFCQKVLNSWGASISCRSEEHVFTEFDMRFPRKGKWPEAQ"
     gene            complement(462897..464189)
                     /locus_tag="CNE_RS20225"
                     /old_locus_tag="CNE_2c04360"
     CDS             complement(462897..464189)
                     /locus_tag="CNE_RS20225"
                     /old_locus_tag="CNE_2c04360"
                     /EC_number="2.3.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952137.1"
                     /db_xref="GI:503718061"
                     /translation="MFSEAEPPHSMRHASRAKAPTLPPWITARMAQHFDERMGKLWGG
                     DHLLHGRTPGPDALHLSSNDYLCLLGESSLVQAQARAFLNEEPELLMSSVFQHGDTPQ
                     RRVERKIADLMQAEDGLIAQSGWAANVGLVQCIAGPGIPVYIDMNGHASLWEGIIAAG
                     AQAVPVRHNDCEHVRRQLERFGPGVIMVDSVYSTTGSVAPLEDYVDLAEASGCVLVVD
                     ESHSLGTHGPSGGGLVRALGLSERVHFRTASLAKAFAGRAGYVACSTDFKDFFAVESR
                     PAIFSSGLLRHEVAWFDAVTDFVATADERRARLHAITRDTRAAIAELGYNIGEGSEQI
                     IGLEAGTEPQVKVLRDALQSRGIFGAVFCAPATPKNRALMRLTLHAKLAANEIDRLVS
                     VLASIRDEVRLDEWSSTRRARRKSQNPTSGPLAGSREE"
     gene            complement(465073..466269)
                     /locus_tag="CNE_RS20230"
                     /old_locus_tag="CNE_2c04370"
     CDS             complement(465073..466269)
                     /locus_tag="CNE_RS20230"
                     /old_locus_tag="CNE_2c04370"
                     /EC_number="1.3.8.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952138.1"
                     /db_xref="GI:503718062"
                     /translation="MIRDSARQQALLADIRRFVLETCIPLEAEIDRTDVIPEPVVEQM
                     RRLGLFGHSIPEAYGGAGLTTEELALVNIEVSQAATVFRARFGGNTGIASESLVADGT
                     EAQRQRYLPQLASGKVTGCFALTEPEAGSDATSLQTTARQDGDHYVLNGSKCFITNAP
                     IADLFTVFARTDPDTPGAHGISAFLIERGTPGLSTSEPERKMGQHGSPVGDVYLKDCR
                     VTASAIVGGKPNVGGKPNVGFKTAMKALNKQRINLAGLCVGPAIRLVDEMVRYAAQRR
                     QFGKPIADYQLVQQMIADSNTELHAARALVLDTARKRDAGEDVTMEASMCKLFASEMA
                     GRVADRAVQVFGGSGYMARTVAERFYRDVRLFRLYEGTTQIHQLNIARRTMEARGAAL
                     VGGSAA"
     gene            complement(466311..467309)
                     /locus_tag="CNE_RS20235"
                     /old_locus_tag="CNE_2c04380"
     CDS             complement(466311..467309)
                     /locus_tag="CNE_RS20235"
                     /old_locus_tag="CNE_2c04380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952139.1"
                     /db_xref="GI:503718063"
                     /translation="MDAIQPLRRLAAGMLACAALMPLPALAAPDNAARFPDRPIRIIV
                     PFSAGGVVDSVTRITAENMARVLKQPVIVENKTGAGGAIGADFVARSPADGYTLLAVS
                     PSYVVGPLLNPSIQGKGGKDFRAVAGIGAVPNVIVVPAASPLRTLPELLDAARSQPGT
                     LTYASAGVGTSNHLSAELLAQMTHVKLTHVPYKGQPEAMSDLLGARVSMMALTSAIAR
                     QQVQSGKLRALAVTSAKRSAVMPDVPTVAEAARLPGYEVGGWFGLVAPQGTPDAVVRK
                     LAEAAAQATSDPATARRLAELGMDLAPQSTAVFDRFLDTETKKWTGVLKTAGITAQ"
     gene            complement(467433..468251)
                     /locus_tag="CNE_RS20240"
                     /old_locus_tag="CNE_2c04390"
     CDS             complement(467433..468251)
                     /locus_tag="CNE_RS20240"
                     /old_locus_tag="CNE_2c04390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_018312626.1"
                     /db_xref="GI:517123808"
                     /translation="MDRNPEHLPLPGLASEDALATDRQFATNLARGLEVLRAFTPSSP
                     VLGNQDIVARTGLPKATVSRLTYTLGLLGFLSRVPGNQKYRLGAGVLALAYPMLAGLA
                     IRQVARPYMEAIARETGCTVNLGMRERLSVVYVDSCRLDPGNLYQPDIGSTRPLLASA
                     IGRAVLLACSADERTALLNRLRVDDPERFNVERQMWADDQKHFRAHGYCLSRGEWRPE
                     IHAIAAPVRQSLHEDPFALNCTIAASRNRDNMLEREVAPRLREAVRQIELSCAR"
     gene            468404..469636
                     /locus_tag="CNE_RS20245"
                     /old_locus_tag="CNE_2c04400"
     CDS             468404..469636
                     /locus_tag="CNE_RS20245"
                     /old_locus_tag="CNE_2c04400"
                     /EC_number="2.8.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA transferase"
                     /protein_id="WP_013952141.1"
                     /db_xref="GI:503718065"
                     /translation="MQDQEHAVSPDAHCTGPLGGLRILDMATVVAGPFSATLCADMGA
                     DVVKLELPDGSDPLRGLEPVTEDHALYWKVTNRGKRGISLDVRTPRGREIFLRLLPQF
                     DVLVENFRTGTLARWGLDLDTLHAANPKLIVLRLTGFGQTGPDAARPGFARIFEARSG
                     LTNLAGTAQSGPMHMNYPVGDMIAGLFGAFAIATAAAEQRARPGQRGREIDLAATEAL
                     FRLLDPLAIEYEQLGHVRQRAGNRTTYAAPSNMYRTADEIWVTVVASSDATFRRLAEA
                     IGAPQLAQAPEYATNAGRVRNIEALDGSIAEWFAAQPYAAVAARLEQCQVPFSKVFSI
                     ADIVDDPQMAARQAIVRLPDPDLGSVPAPCVVPRFSGYAPPSPRTGPDVGEHNAEVYG
                     QLGIGDEELARLRAEGVV"
     gene            complement(469829..470410)
                     /locus_tag="CNE_RS20250"
                     /old_locus_tag="CNE_2c04410"
     CDS             complement(469829..470410)
                     /locus_tag="CNE_RS20250"
                     /old_locus_tag="CNE_2c04410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952142.1"
                     /db_xref="GI:503718066"
                     /translation="MNTIPLATAKARLAQYVEAKDNNRPTLIHEAFAPDASLTFSIDT
                     DSISFPPRAEGADAIAATLVSEFAKTFDRCRTYYIGDVGAALDGNAMTIPWLVVMRET
                     AASALRVGKGYYRWGFAAGDDGTYRIASLHIHIERIDTIADPGAVTLAALQAALPYPW
                     LPAPVLAASIEAQASAQPALGFLNVFAQAARLP"
     gene            470522..471064
                     /locus_tag="CNE_RS20255"
                     /old_locus_tag="CNE_2c04420"
     CDS             470522..471064
                     /locus_tag="CNE_RS20255"
                     /old_locus_tag="CNE_2c04420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013952143.1"
                     /db_xref="GI:503718067"
                     /translation="MATTPANKNLTVTHPACLVDGSDREFRHLVNGLLPFAARLLSVR
                     DGFGGLIGLTGVQYSLIRSILHLSQQGEVTVNQLADHLHLSGPFITIETGKLKKLGLI
                     DKKAHPEDKRKMRLTITAAGTRLLNELLPVQQQINDVLFDGVSRTEFKVLCSVVDRLV
                     ANGDRAALDLEHLQARRQKG"
     gene            complement(471061..472284)
                     /locus_tag="CNE_RS20260"
                     /old_locus_tag="CNE_2c04430"
     CDS             complement(471061..472284)
                     /locus_tag="CNE_RS20260"
                     /old_locus_tag="CNE_2c04430"
                     /EC_number="2.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952144.1"
                     /note="catalyzes the removal of elemental sulfur from
                     cysteine to produce alanine; involved in NAD biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013952144.1"
                     /db_xref="GI:503718068"
                     /translation="MQSEPKTLPIYMDYSATTPVAPQVVEKMVPYLHQQFGNPASRSH
                     YYGWQAEEAVEAARAHVAALLNADPREIIWTSGATEGNNLAIKGAAHFYRGKGNHIIT
                     VKTEHKAVLDTCRELERQGFEVTYLDVGTDGLVDLDALRAAMRPDTILVSVMMVNNEI
                     GVIQPVAQIGELCRAAGVVFHCDAVQAAGKIAIDLEALKIDLLTVTAHKVYGPKGVGA
                     LYVRRKPRIRIEAQIHGGGHERGMRSGTLPTHQIVGMGEAFRLAKLELAEEARRVGAL
                     RDRLLAGLSRLDEVYVNGSLAHRIPHNLNISFNYVEGESLIMGIKDVAVSSGSACTSA
                     SLEPSFVLRALGRSDELAHSSIRFTLGRYTTEAEVDEVIRQVSETVTRLRELSPLWEM
                     HQEGIDVGTVQWAAH"
     gene            472655..473200
                     /locus_tag="CNE_RS20265"
                     /old_locus_tag="CNE_2c04440"
     CDS             472655..473200
                     /locus_tag="CNE_RS20265"
                     /old_locus_tag="CNE_2c04440"
                     /EC_number="1.14.13.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase"
                     /protein_id="WP_013952145.1"
                     /db_xref="GI:503718069"
                     /translation="MAESSVGQGVKADAEADAEAHRRFRNALAMFATGVAVITAPREE
                     GLPVGITVASFNSVSLDPPLVLFSVDRRCLSLGDLRSARRYAVNVLAEAQQDISNRFA
                     RANSGKWEGIGFSKRNEDSHVLLPDALATFECEPYAMHDGGDHVIFIGRVVRHQARQD
                     GRPLIFFGGKYRALEDSPAAA"
     gene            473237..474721
                     /locus_tag="CNE_RS20270"
                     /old_locus_tag="CNE_2c04450"
     CDS             473237..474721
                     /locus_tag="CNE_RS20270"
                     /old_locus_tag="CNE_2c04450"
                     /EC_number="1.14.14.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate 3-monooxygenase"
                     /protein_id="WP_013952146.1"
                     /db_xref="GI:503718070"
                     /translation="MIKTGNQHIVMLRDGREVYLDGKRVTDVTSHPAFRNSIRSYANL
                     YDFQAQPGNVDKMTFQPAGTDRRVSRIWELPTSYNELVERRQMLEAWTELHYGFMGRS
                     PDHVASCISGMYMGIDVFEQADPARAGALRDYYRYARDNDLFLTYVIVNPQANQSKSA
                     HEQEDKYLAVGIVDQDAEGITVRGAKMLATSGIMANEVFCSCIQPLREGDEMYALSFA
                     VPMNTKGLKVMSRKSYEANATSVFDNPLASRFDENDAVLYFDDVKVPWERIFVAGDVG
                     LCARQFHATPAHVYQNYQCQVRLMVKLRFLVGLAHRITEINGTSSFPQVREMLGQLAA
                     EAGMVEAWVYGMEAKGQVGKHGYFVPDRSMLYGSQVVTQQLYGKVLATLRELAGGGMI
                     MLPSSIEDFANPSLAGIIAKTQKSPVCSPEERVKFFKLAWDAVGSEFASRHNQYEMFY
                     AGATFVTKGHAYRTYDWQNASGLVDNMLGSYSLESELAKLPQAA"
     gene            474767..475147
                     /locus_tag="CNE_RS20275"
                     /old_locus_tag="CNE_2c04460"
     CDS             474767..475147
                     /locus_tag="CNE_RS20275"
                     /old_locus_tag="CNE_2c04460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_010812510.1"
                     /db_xref="GI:498512064"
                     /translation="MAITKLHDEFHTLDLESGWEVPHGYPSGIQQKILSGSLDENGRS
                     GSRTRLLRFQPGVFTTSPFVHEYWEEVYLLSGDLTVGNDANGKGGEAFVPNTYACRPP
                     GAFHGPFKSDGGCMLLEIHYYDPA"
     gene            475150..476493
                     /locus_tag="CNE_RS20280"
                     /old_locus_tag="CNE_2c04470"
     CDS             475150..476493
                     /locus_tag="CNE_RS20280"
                     /old_locus_tag="CNE_2c04470"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018309819.1"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_013952147.1"
                     /db_xref="GI:503718071"
                     /translation="MEATIATAQRQLAAGSANALSLLASCVERICNPGSEGARVFPHG
                     VSMAARKQAQASDMLREQGVVGPLAGVPVSVKDLFDVQGDVTRAGARVLPERAASADA
                     PAIARLRAAGAVFVGRTNMTEFAYSGVGINPHYGTPRNPYDRQAGRIPGGSSSGAAVS
                     VTDGMALAAIGSDTGGSCRIPAALCGIAGFKPTARRVPLQGTVPLSPSYDSVGCLANT
                     VACCAAIDAVMAGEAPPAGPAPLAGLRLAVPSGLVLEGMSDEVAEVFSRTLRRLSAAG
                     ALLQDVSFDSWDQLAGIGANGGLVAAEASAWHGSLLAEQADRYDPRVLSRIRLADGQR
                     AADYLRMLQRRGELCRQADAELAGFDAVVLPTVPVVAPRIANLDDDEAFFRTNRLLLR
                     NPAIANMLDLCALSVPCHRLGDAPVGLMLFGRHLSDRRLLAIGMGIEAALRHERG"
     gene            476541..477767
                     /locus_tag="CNE_RS20285"
                     /old_locus_tag="CNE_2c04480"
     CDS             476541..477767
                     /locus_tag="CNE_RS20285"
                     /old_locus_tag="CNE_2c04480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952148.1"
                     /db_xref="GI:503718072"
                     /translation="MPDIRTGAAVLACATLFAATASAADPAPISDGVVKIGVLTDMSS
                     IFSDIGGKGSVVAAQMAVDDFGGKVLGAPIQVVSADHQNKTDVAATLARGWLDNQKVD
                     VIQDALPSSVALAVSNLGKLKHKIVIASGAGTTRLSNEDCSPYTIQYSYDTYAFAANT
                     VKALARRGDNSWYFLTVDYALGASLEKDGTEALSSVGGTLKGKARHPINSADLSSYLL
                     QGQSSGAKVIGLANAGADTVNAIKTAADFGINTAGKQKLAGLHMFISDIHSLGLQAAQ
                     GMTLTTSFYWDRDDATRAWSQRFFEKTGRMPTLVHAGVYSSTTHYLKAIQAARTDDSD
                     AVLARMRETPVNDFFAKNGTIRADGLMVHDMYLVEVKRPQESKRPWDYYKIKTVIPAS
                     EAFRPLSASACPLVRK"
     gene            477835..478524
                     /locus_tag="CNE_RS20290"
                     /old_locus_tag="CNE_2c04490"
     CDS             477835..478524
                     /locus_tag="CNE_RS20290"
                     /old_locus_tag="CNE_2c04490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952149.1"
                     /db_xref="GI:503718073"
                     /translation="MKTLTFELDSRQGKSQRTVTIHQLIVAGWTGRDVEAMEAHIREL
                     EELGVKRPPYTPVFYRVAAQRLGPAPEIQVSGEASSGEAEFLLVRDGDDILVGIASDH
                     TDREAETYGITVSKQMCEKPCASALWRLSEVEGHWDQLVLRSYATIDGERVLYQEGPV
                     TAMRSPADLLQRFCGHGGEFGEGSAMLCGTLPAIGGIRPAERFEIELEDPVLGRTLRH
                     AYAVAALPVAG"
     gene            478574..479347
                     /locus_tag="CNE_RS20295"
                     /old_locus_tag="CNE_2c04500"
     CDS             478574..479347
                     /locus_tag="CNE_RS20295"
                     /old_locus_tag="CNE_2c04500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_013952150.1"
                     /db_xref="GI:503718074"
                     /translation="MHHDLILETRNLGKAFRGFTAVSDVNLRVRRGSIHALIGPNGAG
                     KTTCFNLLTKFLEPTTGTILFNGIDITREKPAQIARRGVIRSFQISAVFPHLTVMENV
                     RIGLQRQLGTAYQFWRSERSLDVLNDRAMELLEQVGLTEFAQTLTVNLPYGRKRALEI
                     ATTLAMEPELMLLDEPTQGMGHEDVDRVTQLIKKVSAGRTILMVEHNMSVVSSIADKI
                     TVLQRGAILAEGPYAEVSKDPRVMEAYMGTVDAELQGAH"
     gene            479365..480090
                     /locus_tag="CNE_RS20300"
                     /old_locus_tag="CNE_2c04510"
     CDS             479365..480090
                     /locus_tag="CNE_RS20300"
                     /old_locus_tag="CNE_2c04510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_013952151.1"
                     /db_xref="GI:503718075"
                     /translation="MTTSNTPALEIRDLHAWYGESHILHGVDLTVNRGEVVTLLGRNG
                     AGRTTTLRAIMGLTGTRKGSIKVNGHETISLPTHKIAHYGIGYCPEERAIFSSLSCEE
                     NLMLPPVLKGADTSKGMSETDIYEMFPNLKERRQSQGTRLSGGEQQMLAVGRILRTGA
                     NLLLLDEISEGLAPVIVQALARMILMLKQKGYTVVMVEQNFRFAAPLADRFYVMEHGS
                     IVERFAANELQAKMPVLHELLGV"
     gene            480101..480985
                     /locus_tag="CNE_RS20305"
                     /old_locus_tag="CNE_2c04520"
     CDS             480101..480985
                     /locus_tag="CNE_RS20305"
                     /old_locus_tag="CNE_2c04520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952152.1"
                     /db_xref="GI:503718076"
                     /translation="MNLFEIPLPALLSQLLLGLVNGAFYAMLSLGLAVIFGLLSVINF
                     AHGALFMLGAVLAWAGMTYAGLSYWAMLLLSPLVVAALGVVIEKTMLRWIYKLDHIYG
                     LLLTLGITLVVEGIFRSVYGVSGLPYGPPEALQGASDLGFMRLPNYRVWVVGASLAVC
                     LSTWYVIEKTRLGAYLRAGTENAKVVEAFGVNVPRMVTLTYGFGVALAAFAGVLAAPV
                     MQVSPLMGQNLIIVVFAVVVIGGMGSIMGAILTGLGLGVIEGLAKVLYPEASSTVVFV
                     IMVVVLLLRPAGLFGKEK"
     gene            480985..482001
                     /locus_tag="CNE_RS20310"
                     /old_locus_tag="CNE_2c04530"
     CDS             480985..482001
                     /locus_tag="CNE_RS20310"
                     /old_locus_tag="CNE_2c04530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952153.1"
                     /db_xref="GI:503718077"
                     /translation="MSGQSIAAIGVRQQQVAGRLPKQVIYGVVLACLLAAPLAGAYPV
                     FVLKVLCFALFACAFNLLIGYTGLLSFGHAAFFGGAGYAAGHALKVWGVTPEIGLILG
                     TAAGALIGYVVGSLAIRRQGIYFSMITLALAQMLFFICLQAPFTGGEDGLQGIPRGKL
                     FGVLPLSDDLTLYYVALAIIVAAFALIVRTVHSPFGQILKAIKENEPRAVSLGYDVDH
                     FKLTAFVLSAALSGLAGSVKALVLGFETLSDVHWSMSGMVILMTLLGGLGTLTGPIIG
                     AFVVIALENKLGELGGYLAAVTGIDWFNGLGESVSMVTGIIFIVCVLTFRKGIVGSLG
                     RGPE"
     gene            complement(482081..483349)
                     /locus_tag="CNE_RS20315"
                     /old_locus_tag="CNE_2c04540"
     CDS             complement(482081..483349)
                     /locus_tag="CNE_RS20315"
                     /old_locus_tag="CNE_2c04540"
                     /EC_number="1.4.99.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616645.1"
                     /note="catalyzes the oxidative deamination of D-amino
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase"
                     /protein_id="WP_013952154.1"
                     /db_xref="GI:503718078"
                     /translation="MKSIAVIGGGITGVTTAYALARRGFSVTLFERHRYAAMETSFAN
                     GGQLSASNAEVWTHWSTIVKGMKWMLRNDAPLLLNPRPSWHKLSWFAEFIAAIPHYRR
                     NTIETARLAIAAREHLFDWAAQEGIDFDLKKEGILHIYRDKAGFDHAGRVSALLAQGG
                     LERRAVTPEEMRAIEPTLAGSYYGGYFTESDSTGDIHKFTSGLAAAIDRLGVRCLYGQ
                     DVRAVKTDGRRATVTVQDGADTASSTFDGAVICAGTASRALAAGLGDRVNIYPVKGYS
                     ITVNLTDEASRAAAPVVSLLDDETKLVTSRLGDDRFRVAGTAEFNGYNRDIRADRIRP
                     LVEWVQQCFPGVSTRSVVPWAGLRPMMPDMLPRVGRGRTACIFYNTGHGHLGWTLSAV
                     TADMVAGIVYQHLGAKLAVAPGASLALAKA"
     misc_binding    complement(483406..483524)
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     misc_binding    complement(483525..483623)
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     gene            483780..486110
                     /locus_tag="CNE_RS20320"
                     /old_locus_tag="CNE_2c04550"
     CDS             483780..486110
                     /locus_tag="CNE_RS20320"
                     /old_locus_tag="CNE_2c04550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_013952155.1"
                     /db_xref="GI:503718079"
                     /translation="MLRSGGVSQKKRRQQGFPVKKNRIALAVSAVLMGPAVAAAQVVD
                     ALEPLQEVVVSAKSERGETPAIPPNTPSPAYGISSRRMADFNVVNTEDALKYAPNLAV
                     RKRFIGDMNSIISVRSTSSRQSARGLVYADGLLLSNLLGSDFSFPPRWSLVNSAEIER
                     MDVLYGPYSALYPGNSLGATVLITTRTPEKFEGDASVQLFTQRFSLYGTHDNFNGVHA
                     NAYVGDRVGPFSWLVSVDRQDSKSQPLSFYTAARSTARATSADKPVTGAHFDQDQTGR
                     DRVVMGVNSEGVTHTVQDQLKLKLGYDITNTLQAQFTAAYWQQDRSSATGSYLRDASG
                     NVVSNGPVNIGGYEYVIPANAFAPSNGEDARWLYGLSLRTRNETGWNFSGVASLFDVS
                     KDISRSANTVGSGPGTVTYGDGTGWRTLDLKADYRPQQLQGGHWVTFGYHYDNYRLSN
                     TTYNTSDWQAATITAFNNAFAGKTETQALYAQDAWYFAEDWKLIPGVRYEHWRAYDGS
                     RSQPGADIGYPVRSESNWSPKLALEKAFGQDWLGRLSLGQAYRYPTVSELFQGRITGT
                     ALINNDPNLRPERSFSKDLTFERTLDSSYFRVSVYEDDIRDALVSQTNTTVFPTVTSF
                     QNVDRVRTRGIELAYDARDVFVSGFDLSASGAYNHSKTLENANNPASVGKYFYRIPKW
                     RANLMGTYRITPAWAGTLAMTYSGRQYNTLDNSDVNPDTFGGTSSFLTFDVKVTYRPA
                     KNVRLGLGIDNLTDQRYYVYHPYPGRTFYAEAKLSF"
     gene            486136..487356
                     /locus_tag="CNE_RS20325"
                     /old_locus_tag="CNE_2c04560"
     CDS             486136..487356
                     /locus_tag="CNE_RS20325"
                     /old_locus_tag="CNE_2c04560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952156.1"
                     /db_xref="GI:503718080"
                     /translation="MQGVCPSFRLIVAGLMACAALAATAQTHGDHAGHGSQAKTAKMS
                     ELGTGAAFDREGKLWVAYKDGPYVAVRASTDYGRSFGPAQHVNSVPEQVAADHESRPK
                     VAAGRDGEIYVTWTQPLPKPWTGFIRFARSTDGGKSFAEPLTVHANRDQIAHRFDAIA
                     VDNAGRVFVSWIDKRDVVASEARKQPYTGAAVYYAVSADQGKTFQGDYKIADQSCECC
                     RIALSPTPDGKMLALWRHVFPPNARDHALALLGTDGRATPMQRATFDDWRIDACPHHG
                     PGASVAPDGTVHMVWFNVREGKPTVSVGRWKDGKLLAQRPLDDPRAQHADIVALKDNE
                     IAVTWKSFDGQQTRLSAMLSQDGGKTWQTRKLAGTERDSDQPHLLQHAGRAYVLWRTE
                     AEGFQVFPLGKEGA"
     gene            487353..487850
                     /locus_tag="CNE_RS20330"
                     /old_locus_tag="CNE_2c04570"
     CDS             487353..487850
                     /locus_tag="CNE_RS20330"
                     /old_locus_tag="CNE_2c04570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952157.1"
                     /db_xref="GI:503718081"
                     /translation="MMPSRRKLLAAAVLTLAMTAANAGSAPAERVAVFASATQLAASQ
                     QGKPFVLVVWSLDCVYCKRNFDAIGKLRAQHRDLRVVTLATDNPDALPQVQQLLQRVR
                     LTRNAWVFGHEPQERLRYAVDPDWMGEMPRTYFYRADGQRQGVSGVISDADWGKHLRW
                     AGIAG"
     gene            complement(487876..488865)
                     /locus_tag="CNE_RS20335"
                     /old_locus_tag="CNE_2c04580"
     CDS             complement(487876..488865)
                     /locus_tag="CNE_RS20335"
                     /old_locus_tag="CNE_2c04580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952158.1"
                     /db_xref="GI:503718082"
                     /translation="MTSINPLRRHLLKTTAALGACALAPTLARAQAWPAKPIRLVVPF
                     APGGSSEIVARSTAAELTKLLGVSVFVENKPGAAGNIAMGEVARADDNHTLILGHIGT
                     LAVNPFIFPKLPYDPIKDFRAISLLSKVPSLYVVHPDVPAKNLKEFVALAKSKPGKLN
                     YGSAGNGSAGHLAFEYLKAATGTFITHVPYRGSGPQITDLLSGRLDAAAVGAPAIIQF
                     IKAGKLRCIATGTTQRIPQLPDVPTVAEQGYPGFEMTQWYGLLAPASLPQAAADKLAD
                     ATAKAVKSKSSVERLSADAAIVVGDTPAEFSRFIAQEQQRWKPIIARAGIKPD"
     gene            complement(488927..489907)
                     /locus_tag="CNE_RS20340"
                     /old_locus_tag="CNE_2c04590"
     CDS             complement(488927..489907)
                     /locus_tag="CNE_RS20340"
                     /old_locus_tag="CNE_2c04590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952159.1"
                     /db_xref="GI:503718083"
                     /translation="MHARHAIAATIAAMITTTTLVQAADTAAAWPARPITIVVTYPPG
                     GGADLMARLIAPGLGRELGQTVIVENRPGAGGQIGAAYVAKAAPDGYTMMVDASSYAV
                     NPSLYPRLPYDPDKAFRPVGVLARYPNVLVATASFPASKVSDVMAMARQKPGSVAFAS
                     SGNGSAQHLAGVLFEQRAGVDLLHVPYKGGGPAMTDVIAGQVPLFFANVASSLQHIKA
                     GKLKPLAVTSHARTQALPSVPTMQEAGVASYEVYEWNAAFLPAATPDPIAAKLADALQ
                     KVMTSPEIRQRVAELGGEVVAAPPAQARQFIDGQTRLWAKVIRDGNIKPE"
     gene            complement(489934..490683)
                     /locus_tag="CNE_RS20345"
                     /old_locus_tag="CNE_2c04600"
     CDS             complement(489934..490683)
                     /locus_tag="CNE_RS20345"
                     /old_locus_tag="CNE_2c04600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013952160.1"
                     /db_xref="GI:503718084"
                     /translation="MPDNALFQTTTTAAGLSRYGQIAAELQARIVSGAWAPGSAIPAE
                     GALAKEFGIALGTIRQAIAVLVQQGLLERVQGKGTFVRKGLSGASLMRFFRFGGADGA
                     PAVPRSEILSCRAVRLDKAMATRFGLPTGARGLAISRRRWLDDTPRLLESIWLPLPRC
                     EALQQLPPVQWGDLLYPLLGSACGITVHRAVDEVTFRTLAADEAALLDLPDAHPCAVV
                     TRHAFDLGGSCIEYRLTRGDAFAFRYTADVR"
     gene            490809..491663
                     /locus_tag="CNE_RS20350"
                     /old_locus_tag="CNE_2c04610"
     CDS             490809..491663
                     /locus_tag="CNE_RS20350"
                     /old_locus_tag="CNE_2c04610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013952161.1"
                     /db_xref="GI:503718085"
                     /translation="MSKRALPLVDTHFHVFDAGVAAPSARYRPPYAADLKGWHVRLAE
                     LGELYGVVVQPSFLGTDNAALLAALQAMPGRLRGVAVVDPEVTDQELATLHGAGVRGI
                     RLNLYGDPDWLRIATAPWRGLFSRIAGLGWHVELHTSNGDGAMVLAQLDAALGDAGAP
                     VVLDHFGRPGPAGTADAIFDVATAVRARRQVWVKISAPYRLASPQDWHGLAQRWREVV
                     GDDRLLWGSDWPWTNHEAPARVDECRMLAAWPGQGASGDSEEAGAALSAALRWRNAAA
                     LYGFAVKG"
     gene            complement(491686..492606)
                     /locus_tag="CNE_RS20355"
                     /old_locus_tag="CNE_2c04620"
     CDS             complement(491686..492606)
                     /locus_tag="CNE_RS20355"
                     /old_locus_tag="CNE_2c04620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952162.1"
                     /db_xref="GI:503718086"
                     /translation="MEPITHDRLAGISAFVAAAEAGSFAQAAARLGLTRSAIGKAIAR
                     LEARVGTRLFVRTTRSLALTDDGQAFYERCAQALEDLDAAQLMLEAGRREAAGRVRVS
                     APVVFGRHHVAPLLLELADRHPQLRLEGNFTDRLVDFADDGIDLAIRSGRLPDSDMLV
                     ARPLGMQAMVLCAAPGYLRKHGTPASIADLASHRCLVYMHGGESVPWSLAGPDGNIAR
                     PELAHRLGFDDIDTIAAAAIRGAGLVNVPLWLVRQPLDQGTLVRVLPQASVIRTPLHL
                     VWPRTRFLPHKLRVTIDLLVEAIPAVLALD"
     gene            492711..493712
                     /locus_tag="CNE_RS20360"
                     /old_locus_tag="CNE_2c04630"
     CDS             492711..493712
                     /locus_tag="CNE_RS20360"
                     /old_locus_tag="CNE_2c04630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_035828336.1"
                     /db_xref="GI:737861284"
                     /translation="MQRWQLSAFGRNNLRRVDAPIPVPGPGEVLVRVHAVALNYRDLL
                     IIQDGMGMPVQPPLVPGSDMRGEVVAIGEGVADFAPGDAVISTFFTGWLDGVQPRRSM
                     PLGVPGPGMLSEYVVLAEDSLVSAPRTLDAAQASTLTCAGLTAWQALAEATVTRPGDT
                     VVVIGTGGVALFAVQIARAQGARVIVVSGSDDKLARVQELGAAHGVHRGRTADWPAAV
                     RELTGGRGADHMLELAGGDNFGRSLAALAQGGRISVIGNLQGDELRASVYPVLHGRVT
                     VQGIGVSHRRALQDLVRAVDWLGLRPVIEREYDFGDLPAALDHLERGAFGKVVVRLR"
     gene            complement(493729..494424)
                     /locus_tag="CNE_RS20365"
                     /old_locus_tag="CNE_2c04640"
     CDS             complement(493729..494424)
                     /locus_tag="CNE_RS20365"
                     /old_locus_tag="CNE_2c04640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952164.1"
                     /db_xref="GI:503718088"
                     /translation="MASLDVAADIRAQLDAWQASGADQADPVRFRLMEALARRCAGHS
                     GAVRGLLDERLRGLAAAYAAIVQRYTGNDSDIADGGAPSTPTSSPTASALGALVHDIT
                     ARARPAVAVASNDARSPAPVPAHAPQSNAPLVDALADYFRETWARVSVEQHFRLSLER
                     VPENAGPLNTDHLVHRSLSLMRETSPEYLRHFLSYVEGMSWLEQLGAAAAAEKEAARA
                     AAAKKSARGKARK"
     gene            complement(494417..495064)
                     /locus_tag="CNE_RS20370"
                     /old_locus_tag="CNE_2c04650"
     CDS             complement(494417..495064)
                     /locus_tag="CNE_RS20370"
                     /old_locus_tag="CNE_2c04650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952165.1"
                     /db_xref="GI:503718089"
                     /translation="MREDLDAGVEPTVPAWAVFGDLMSVLLGAFVLVLLGVIGVQMEL
                     SARLEAEVKQRQEEAQRRETLEKALAGPLAAGRVTLVNGRIGISGNVLFALNSDQLQP
                     DGRDLLKSLAQPLSAYLRSRDEILMVSGFTDDQQVREGNRRFADNWELSAQRALTVTR
                     TLIDAGIPPTSVFSAAFGSQQPVTPNADAEGRAKNRRVEISPVPRVTAGTVKPHG"
     gene            complement(495061..498198)
                     /locus_tag="CNE_RS20375"
                     /old_locus_tag="CNE_2c04660"
     CDS             complement(495061..498198)
                     /locus_tag="CNE_RS20375"
                     /old_locus_tag="CNE_2c04660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013952166.1"
                     /db_xref="GI:503718090"
                     /translation="MTRYLTHIVAFLAGLAIVCWIAAGYAGTNFLALAVTLLIGGCYL
                     AGAFELYRYRQATATLAQAVASLSEAPASLGSWLERLHPSLRDSARLRVEGERVGLPG
                     PALTPYLVGLLVLLGMLGTFLGMVATLRGTGIALETATDLQAIRASLAAPVKGLGFAF
                     GTSVAGVATSAMLGLLSALCRGERIQAAQALDARIATTLRPYSRGHQRDEAFRLLQRQ
                     ADVMPALVERMQAMMTTMAEQNQALTERLAASQDAFHGKTEVVYTRLASSVEQSLKDS
                     IADSARASSAAIQPAVDATMAGLARETTALRDTVTHAVQQHLDGVSSRFESATAGVAD
                     TWNQALAGHQRASEALAADLRTSLDGFAQTFEQRSAGLLDGVATRLDTAAASAADAWR
                     EALSRQERTGEKLASDNQQALTAAAVAIGEQAATLVRTVGESHAGLQTQLAAHDAQRL
                     SAWADTLGTMTAGLRQELEQLNAHTVSRQDEISTTLAQSVREISAQTQAHASQTLAEI
                     DRLVQAASDAPKAAVALQAELASRDAQRFAAWTDTLGTMTAALRQEWEQLNAHTVSRQ
                     DEISTTLAQSVREISAQTQAHASQTLAEIDRLVQAASDAPKAAVALQAELASRDAQRF
                     AAWTDTLGTMTAALRQEWEQLNAHTVSRQDEISTTLAQSVRDISTQTQAHASRTLAEI
                     DRLVQAATDAPKAAVALQAELAARDEQRFASWTDTLGTIAATLRQQWEQASTHAATRQ
                     QEICEALAQTARAISTETQAHASTTLAEIDRLVQAAAEAPKAATTLQAELASQDAQRM
                     AAWTDTLGTMAASLRQEWEQASAHTVSRQQEICETLAVTARDMAAQAQAQATGTIAEV
                     AHLMQAASEAPKAAAEVIAELREKLTDGMARDNAMLEERSRMLETLGTLLDAVNHAST
                     EQRSVVDTLVATTADLLDRVGTRFTDKVESETGKLTDIASQVTGSAVEVASLGEAFGV
                     AVQLFSESNGKLIDHLQRIEVALDKSMTRSDEQLAYYVAQAREVVDLSMLSQKQILED
                     LQQRAGQQAPSAEAA"
     gene            complement(498209..498949)
                     /locus_tag="CNE_RS20380"
                     /old_locus_tag="CNE_2c04670"
     CDS             complement(498209..498949)
                     /locus_tag="CNE_RS20380"
                     /old_locus_tag="CNE_2c04670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952167.1"
                     /db_xref="GI:503718091"
                     /translation="MLQVPRRTGFSGPTLVRLLARLTDADAPPPASSLSSQLSQWLGW
                     ADAIALSSALKANAPAAPPAARAADSTEARECARVRAALADAIVEDTTLAGKRRGPAR
                     PSALPDPVDAQVDYAVYRQRYLTLQQTMETAIGDLRGRLRGALSGHAPGMAKLAMVDA
                     VMERVLGAREQSLLGALPTMLEPHFQRLRQAEAAALAEAQAAGQPATARPGAWLGVFR
                     KDMQSVLLAELDIRWQPLEGLLAALQDS"
     gene            499165..500232
                     /locus_tag="CNE_RS20385"
                     /old_locus_tag="CNE_2c04680"
     CDS             499165..500232
                     /locus_tag="CNE_RS20385"
                     /old_locus_tag="CNE_2c04680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015867145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952168.1"
                     /db_xref="GI:503718092"
                     /translation="MKTKLHRLKVLSAVLCVTLAACGGGGDGNGGGSGSSGGTGNSGN
                     TSGTGGTGGTGGTGGTGGSTATRTVMFEATPVTGTSAEFLTQLNGQGARGFRFVSGFY
                     FLGNPAGSEQKGVYVKDAQTTYSYELPQEPGGADVQAWVTAYEAWLNSHGARGFVWGG
                     PYMVGGQIHALMRKDNGSSSTFSYKVVVVDTNASLSAFVQNQANPLGADGYYLAVPAY
                     LGPFGVSSTVAIFRKDLQGSARYGYEVLSNPASDGDLVAQINTEGVRGYRFKVPFVSG
                     GTQVNLYEKDLSQSSTFRFYDFASQQTSAGFLTQANAEGQKGSSLMGAYGLPSGTIRD
                     FYFEPASCTGFLCDTRSLFGL"
     gene            500359..501048
                     /locus_tag="CNE_RS20390"
                     /old_locus_tag="CNE_2c04690"
     CDS             500359..501048
                     /locus_tag="CNE_RS20390"
                     /old_locus_tag="CNE_2c04690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013952169.1"
                     /db_xref="GI:503718093"
                     /translation="MTRSQGAAENNNDDNIDDSGCRNYAIVVDDHPLMARGIAGYLAA
                     HCGFDAALHAADAKECAALTEREGCPALLVVDFWLPDGTAVGVLREAAARLPACKLLV
                     MSADDDARVCIKAREAGAHGFILKNEPPEVFATAVASLRRGRRWFQQAGPPSARRELP
                     LEPSELGLTARQAEVLGMMLRGLPNKRIALTLSVSEQTVKEHVTAILGKLGVRNRIEA
                     IALLHGRRLES"
     gene            501069..502841
                     /locus_tag="CNE_RS20395"
                     /old_locus_tag="CNE_2c04700"
     CDS             501069..502841
                     /locus_tag="CNE_RS20395"
                     /old_locus_tag="CNE_2c04700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_035816303.1"
                     /db_xref="GI:737849025"
                     /translation="MGLSRPDADADISPRARARLLDMTFGRLVFSVNAIPFVGLPFVI
                     WLYVQQLDGGALLAWTLGYGVAAVWMQLRFRRYKQEREDDDALVRRWLPFVQHVALVH
                     GFCLSLAAVLTASLGGFDFKLLLYISIAAIVAANATHQTPILGVFQRFFVACWTLQIV
                     NTPRSFPEHWPFVLPLALLYALAIYRHALIANQFFRQQVRLEDDGIRLAERYRLAKEE
                     AEKALHAKNLFLTTASHDLRQPVHAMGFLIEAIARRNRDPALIPPLEDLRRSVRSVHL
                     MFNSLLDLSRIEGGIASPRNTAVAFAPLVEEVASLFREEARSRGLDLRVRLPAGAAAV
                     LADPALLRQSLVNLVHNALRYTKRGGVLVSARRRGSHWLLEVWDTGVGIASEEKGRVY
                     SPFYRNEHAWRIDSAGHGLGLAVVARCATLMGATYGLDSVERRGSRFWLRFPEAKPLA
                     PTAIEPVYEPDGLSASTLLQGVCLIVEDDPLVTAAWTSLMEAWGVQAACAASGQEALA
                     LVDAGLQPQAILCDQRLRSGESGFEVLKALFERCPDASGAMVSGEFDSEALMQAEREG
                     YLVLHKPLEPSQLHALLFQWLCAA"
     gene            503020..504396
                     /locus_tag="CNE_RS20400"
                     /old_locus_tag="CNE_2c04710"
     CDS             503020..504396
                     /locus_tag="CNE_RS20400"
                     /old_locus_tag="CNE_2c04710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952171.1"
                     /db_xref="GI:503718095"
                     /translation="MSISNRAVAASMLAVSMLAGLAGCHSPSAAALAAASAVTSRPDP
                     AAVSEQDINDAYVYLLGRLLVLRQQQIDFQKEGFQWNRIIHRDVGGVSWANPNLDVAY
                     SEAWVAVDEKTCTVFSVPAIKGRYYTIQFLNGWGETVANINERNYPDHPSGEFAMCLK
                     GATAALSPNARRIDLPAKTSRVLARVEIGADKKQAIALQHQITTRITGTPTIAPVPAT
                     PAFSNDKLPGVEAFDSAVVALRSEPDINPGMEPIQAKVRAVSAAVASSPAERARVDKI
                     IREKTLPAFFQSFSTAGTVRNGWNRPATIGKYGSDYQTRTRIDLGGIWANSTDEVVYF
                     KTDTDGTGTKLDGGNVYTITFPKGELPARHVKYFWSVIAVDSRNFRVIPNAKNRFLIN
                     KQSRLSYGTDDSLTLYFGPARPKDAPDGNWLPTPKGKNYNLTFRLYGPDQPVLSGEWF
                     PAPLVKRN"
     gene            complement(504448..504813)
                     /locus_tag="CNE_RS20405"
                     /old_locus_tag="CNE_2c04720"
     CDS             complement(504448..504813)
                     /locus_tag="CNE_RS20405"
                     /old_locus_tag="CNE_2c04720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bleomycin resistance protein"
                     /protein_id="WP_035816304.1"
                     /db_xref="GI:737849026"
                     /translation="MNLSAGIPILRIFSVDKAKEFYLDFLGFTLDWEHRFEDGLPLYA
                     QVRRSGLTLHLSEHHGDATPGSTVFVTVEDIDALQRELSAKAYPYARPGVEDVGWGRM
                     LQVADPFGNRLRFCEVSGD"
     gene            504970..505941
                     /locus_tag="CNE_RS20410"
                     /old_locus_tag="CNE_2c04730"
     CDS             504970..505941
                     /locus_tag="CNE_RS20410"
                     /old_locus_tag="CNE_2c04730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952173.1"
                     /db_xref="GI:503718097"
                     /translation="MNPTHDSRRRLLLAAAGAATAASALPGVSWGQGQTALRIGYQKS
                     STLMILLKSRQTLEKALPAKGVAVQWYEFTSGLPLLEALNLGNIDLSADVADAVPPFA
                     LAAGAALTYYASETPSPQAQAIVVRGDSPIREVAQLKGQRVAFAKGAGAHYLVLEALA
                     RAGLSIRDIEPAYLSPADARAAFERGSVAAWVIWDPFLAAVQRQANARVLRDGEGLAS
                     YRRFYLAATPFARAHAEVLEVVFDALRDAGDWVKRNPAEAARWHAPLIGLDAATVEAA
                     NARRSYAVRTVDAAALAEQQRIADAFTAQQILPRKVTISASPVWRKA"
     gene            complement(506025..508229)
                     /locus_tag="CNE_RS20415"
                     /old_locus_tag="CNE_2c04740"
     CDS             complement(506025..508229)
                     /locus_tag="CNE_RS20415"
                     /old_locus_tag="CNE_2c04740"
                     /EC_number="3.1.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase C"
                     /protein_id="WP_013952174.1"
                     /db_xref="GI:503718098"
                     /translation="MTFNPSKRQFLKTSLGTGAAAAVLASFPPSIRRALAIEANNATG
                     TIQDVKHVVMVMLENRSFDNYFGTFKGVRGYGDRFAIPLPNGKNAFYQTDANGNLLTP
                     YHLDETQGNAQRAGGTPHTWPDAQAAWDHGRMDRWPVAKKTLSMGYYDDAEIPFQRAL
                     ADAFTLCDAYHCAMHTGTIPNRLFYWTGSNGPTGDNVAVMINEFNAGADVGPSTEGWT
                     WKTYADRLQAAGVGWKVYQNVPDNYGCNQMMSFRHWRAEMEKMPVGRKLSNTAGTGVN
                     PPYNPDIDDQYSPLAKGFCNTMPDGGFLQSLRDDVLNGKLPEVSWIIPPAEFSEHPGP
                     SSPAKGGWYVQAILDALTASPEVWSKTVLLINFDENDGFFDHSPPPTAPSRNLDGTLA
                     GKSTLDDAQMAYEYFNFQPATAKQPPQDGKPFGPGPRVPMWVVSPWSRGGWVNSEVFD
                     HTSVLRFLEARFGVMEPQISAYRRAICGDLTSAFNFATPNTETLPTLAGRTTRADATS
                     LTAWQQTQPAIPVPATPALPEQDTGTRPSRKLPYELHTSARVDAASKAVRLLFANAST
                     NQAGALFHVYDKLHLDRIPRRYVVEAGKTLDDAWDINADGGKYDLWVLGPNGYHRAFS
                     GDINEAVTTSTEIQVCYNPCKKPTIQVKLHNDSDADVTFTVTALAYRDDGPWTQRVKR
                     GKVETLEWPVADSGNWYDFVVTCEASPSFARRFAGRMETGENAVSDPEMGVV"
     gene            complement(508276..508485)
                     /locus_tag="CNE_RS20420"
                     /old_locus_tag="CNE_2c04750"
     CDS             complement(508276..508485)
                     /locus_tag="CNE_RS20420"
                     /old_locus_tag="CNE_2c04750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952175.1"
                     /db_xref="GI:503718099"
                     /translation="MRPSLLSRSARPWLAAGTLTLALMLTACGGDDSPGASGSTLQPT
                     AANGNKPDQPGKPDRPGTCTTRCAP"
     gene            508871..509557
                     /locus_tag="CNE_RS20425"
                     /old_locus_tag="CNE_2c04760"
     CDS             508871..509557
                     /locus_tag="CNE_RS20425"
                     /old_locus_tag="CNE_2c04760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013952176.1"
                     /db_xref="GI:503718100"
                     /translation="MSEEKKSLSETIRAAIEQEILSGKLPSGAQLEEQQLLARFGVSR
                     TPVREALIQLESAGLVDLVPRQGAIVSSISLREYVAMNEILVQLEALAARLAARRISA
                     AQRTAMQAAFDDCRAAAERADSDRYREANDAFHEVIYAACCNDILSRQIRTMRARMRG
                     MRDLRFEKPARILASLAEHEAVMGAIVRGNEDDAAAAMVRHIATGGDVYADMIASMPG
                     DEAGGKRGRR"
     gene            complement(509572..510549)
                     /locus_tag="CNE_RS20430"
                     /old_locus_tag="CNE_2c04770"
     CDS             complement(509572..510549)
                     /locus_tag="CNE_RS20430"
                     /old_locus_tag="CNE_2c04770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952177.1"
                     /db_xref="GI:503718101"
                     /translation="MKHTLGRAAIGAALATLAALPGMAAAQDYPTRPIRLLVGYTPAG
                     AADYVSRVFGEALSKELGQTVLVDNKPGAGSTLASAALAQAVPDGYTLGLATSTLYGI
                     DQQLYKARYKATDFTPVTRLTVSPLILAVNKNLNVSDIKTLVAKARAQQGKFNYSSSG
                     IGGSPHLAGLQFEKATGVKMTHVPYKGGAPALQAVAAGEVELSFGTAASVLPMGTQGV
                     VKMIGVTTPKPSAVAPGLPALAEMGLPGFDFTFWFGLYGPAGLPDGIRDKLFAATAKV
                     MADPQLRAKLASNGSEVSTSASPAEFGKWAAADGKSAVTRIEQAGVKLD"
     gene            complement(510604..511782)
                     /locus_tag="CNE_RS20435"
                     /old_locus_tag="CNE_2c04780"
     CDS             complement(510604..511782)
                     /locus_tag="CNE_RS20435"
                     /old_locus_tag="CNE_2c04780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-transferase"
                     /protein_id="WP_035816305.1"
                     /db_xref="GI:737849027"
                     /translation="MPLSGITVLDLSIARAGPAAVRLLSDWGADVIRVEPPPPQDRGS
                     VTGRRRGSDEQNLHRNKRSLCLDLKTPQGAEVLARLVRRSDVVVENFRSVVKERLGLT
                     YERLSAINPRVILASISGFGQDGPYCERPGLDQIVQGMSGLSSVTGEPGKGPLRVGIA
                     ISDTTAGMFLGQGILLALLHRARTGRGQWVHTSLIEGMLNKLDFQATRYTVDGEVPTQ
                     QGNAHPTLVPMGTYRCRDGVVNIAASTDRMWTNFCRTVEAGWLLDDPAFQTATGRAAE
                     RHRLDEAINRCTAAFSAAELTSRLNAAGVPCGPVFDIGQAFEDAQVRHLRMTRPAEHP
                     ALGPLELLRSPINLSAAPHPERFARAAPDPGEHTDEILRGLGYDEAGVAALRKAKVAS
                     "
     gene            512085..513065
                     /locus_tag="CNE_RS20440"
                     /old_locus_tag="CNE_2c04790"
     CDS             512085..513065
                     /locus_tag="CNE_RS20440"
                     /old_locus_tag="CNE_2c04790"
                     /EC_number="1.6.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_013952179.1"
                     /db_xref="GI:503718103"
                     /translation="MLTDSVCINRVGGPEVLESCQVTVPPPGPGELQLCQSAIGLNFA
                     DIYQRKGAHGPYTAAPFPVTLGSVGAGKVTAVGPGVEGFEVGQRVACMHPGAYQVTRN
                     VPAGRVVPLPDAIPEEVAGATLLRGLTAEYLLRRLYAVQSGDAVLVHAAAGGMGVLLS
                     QWARALGATVIGTVGSEAKRAVALEHGCHHVINYREADFVAEVQALTGGEGVAVVYDA
                     VGKDVFVPSLQCLRPCGMAINYGTASGDVEAFDLQLLHARSLIVSRPTLRTYIASPQA
                     LANAAATLFAAVAGGQLRLEVNHRYPLAAVRDAHRDLEGRATTGSAVLIP"
     gene            513142..513900
                     /locus_tag="CNE_RS20445"
                     /old_locus_tag="CNE_2c04800"
     CDS             513142..513900
                     /locus_tag="CNE_RS20445"
                     /old_locus_tag="CNE_2c04800"
                     /EC_number="4.2.1.116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydratase"
                     /protein_id="WP_013952180.1"
                     /db_xref="GI:503718104"
                     /translation="MQTDGSLPSLDIAGHVATITLRRPEVANRLGPDDLAELQRHVDA
                     VNDSDLRVLRLRGTGKYFCSGFDIGRLAAGQRGAGFETLVNAVEDCRAVTIAEIHGGV
                     YGGGTDLALACDFRLGTAAVDMFMPAARLGLHFYQRGMERYISRLGLNHAKHLFLTAE
                     RIDADEMLRRGFLTELLPAERLRERADQLSDTVAGLAPLAVQGMKRHLNAIGRGTLDT
                     EALAGDISRATQSQDIREGALAWKEKRRPQFTGT"
     gene            complement(513907..514797)
                     /locus_tag="CNE_RS20450"
                     /old_locus_tag="CNE_2c04810"
     CDS             complement(513907..514797)
                     /locus_tag="CNE_RS20450"
                     /old_locus_tag="CNE_2c04810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952181.1"
                     /db_xref="GI:503718105"
                     /translation="MELRHLRYFQVVAQELNVTRAAERLHMAQPPLSRQIRQLEEEVG
                     VALFDRVGRGLRLTEAGRFLLEQSTQLTQRLEETIEGTRRIGRQDKRWFGIGFVPSVL
                     YGVLPELIRELRESDRHDQQVEVGLAEMITVEQIEALKAGRIDLGFGRIALNDPAIRQ
                     QVVMAEPLVAALPARLPAPRRKALTPQALAAQPFILYPARPRPSYADHLLSLFRAQGL
                     QLRVAQEANELQTALGLVAAGIGITLVPASIQRLHRDDVRYCPIDAPGFVSPVIMSYR
                     EGDTSPFLARVVEWVMRQRQ"
     gene            514910..516028
                     /locus_tag="CNE_RS20455"
                     /old_locus_tag="CNE_2c04820"
     CDS             514910..516028
                     /locus_tag="CNE_RS20455"
                     /old_locus_tag="CNE_2c04820"
                     /EC_number="5.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="muconate cycloisomerase"
                     /protein_id="WP_013952182.1"
                     /db_xref="GI:503718106"
                     /translation="MTTTITSVEAILVDLPTIRAHQLAMATMQQQTLVIVRLRCSDGV
                     EGIGEATTIGGLSYGDESPEGIKLTIDTYLAPALAGQDATNVHGAMARLGKVARGNRF
                     AKSALETALLDAQGKRLGVPLATLLGGAVRSTLPVLWTLASGDTARDIAEAEQLLAER
                     RHHTFKLKIGRRSVRDDVAHVAAIKRALGDRARVTVDVNQAWNEADAATGIAMLEAAG
                     IDLIEQPTPREQRMALARLAARFVVPIMADEAVCGPEDAMELARIGGADVFALKIAKA
                     GGIFGMLRTAAVGDAAGIALYGGTMLEGSVGTIAAAHGFCTLPQLAWGTELFGPLLLK
                     DDIVQQRPEYRDFSLHLPEGPGLGLALDEDKLAHYRRG"
     gene            516094..517089
                     /locus_tag="CNE_RS20460"
                     /old_locus_tag="CNE_2c04830"
     CDS             516094..517089
                     /locus_tag="CNE_RS20460"
                     /old_locus_tag="CNE_2c04830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952183.1"
                     /db_xref="GI:503718107"
                     /translation="MKTLFQRLASTGRAGALALAAGLSFAAPTAHAAYPDHPIRWIVP
                     FPAGGAMDNIARTLGEDMSRTLGQAIVVENRPGAGGNIGAELVARAPADGYTLIIVAN
                     GMAVNPALYGRLSYDPVKDFAPVSLLAVVPNVLVASKARRQESTVKDVVAHAKAAPGK
                     YTYASAGNGTSIHLAGELFTSMAGVDMLHIPYKGSGPAMTDLLGGQVDYMFDSITSAR
                     PHIESGKLTAIAVTTSKRSSALPNVPTVAEAGLPGYELSPWFAAFVPAKTPQPVIDTL
                     NRAMLEALRKPAVQKRLAQIGAEPIGSSPAVLREHLAKETEKWGVLIRQRGIRAD"
     gene            517280..518974
                     /locus_tag="CNE_RS20465"
                     /old_locus_tag="CNE_2c04840"
     CDS             517280..518974
                     /locus_tag="CNE_RS20465"
                     /old_locus_tag="CNE_2c04840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_041228798.1"
                     /db_xref="GI:752557566"
                     /translation="MRDGLADLARRLRFAMEEGAIWLDEQRMILIHTAALGALRKELV
                     DTLGMERARGLFTRMGFHSGMRDAEVARKLRAGHSDFGQLEIGPCLHTIEGVVRVTPV
                     KVDIDIAAGIYDGEFLWEDSFEGDVHRQLFGIVDEPACWMQIGYATGYTSALMGRTIL
                     YREVECIACGHPHCRIIGKPVEAWEDGAQALALYQPDPVIETIIALQSEVEHLRALQG
                     TPATPADLVGTSPGFRAAWSLLQRAAASNVTVLLLGETGVGKERFAQALHSVSGRADK
                     PFIAVNCAAIPDELIESELFGVEKGAFTGASQSRPGRFERAHGGTLFLDELGELSASA
                     QSKLLRVLQEGEVERVGGTGTRKVDVRLVAATNVDLAEAVKQGTFRKDLYYRLNVYPV
                     TIPPLRERLDDIRPLAERFVARYGARHGKRIVGITDRALAELRHYDWPGNVRELENVI
                     ERGVILASQGGQITADHLFLPGTVAPVVDTAPRLGAGGTLPDLREAAVHALLDQMSEQ
                     QLALGEVETVLMEAAMQRADGNMSQAARLLGITRPQLAYRWKMRGTRGGNGHGNGN"
     gene            519498..519722
                     /locus_tag="CNE_RS20470"
                     /old_locus_tag="CNE_2c04850"
     CDS             519498..519722
                     /locus_tag="CNE_RS20470"
                     /old_locus_tag="CNE_2c04850"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase"
                     /protein_id="WP_013952185.1"
                     /db_xref="GI:503718109"
                     /translation="MNTPSVPLFEATPRYVRVEGRTPEGFVQFAFSVADPELNVELIM
                     PEPMFEAFCCVNRVRFLPPLEAAPQPQADD"
     gene            519773..520768
                     /locus_tag="CNE_RS20475"
                     /old_locus_tag="CNE_2c04860"
     CDS             519773..520768
                     /locus_tag="CNE_RS20475"
                     /old_locus_tag="CNE_2c04860"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase"
                     /protein_id="WP_013952186.1"
                     /db_xref="GI:503718110"
                     /translation="MQVDIKTQQIQPLRQTYGHVARRFGDKPASRYQEATYDVQSEVN
                     FHYRPTWDPGFELYDKRRTAIVMQDWYALKDPRQFYYGAYVTARGRQQDATEKSFAFV
                     EKRGLLQALPAEWQERLATGLLPLRHVEWGANMNNFYCADYGWGTAITQACTYCAMDR
                     LGIAQYLSRIGMLLDGNTGVALERARVAWLESAAWQPLRRFVEHTFVTEDWFETFVAQ
                     NLVLDGLLYPLVYQHADAVIARACGTGLAVLTEFMNDWRDEHARWVDAVIQAAAAESE
                     ANRVLLSGWARAACAEVAQALVPVADALTGEDGAQMVALCREQFEVRLGKLGLAA"
     gene            520801..521082
                     /locus_tag="CNE_RS20480"
                     /old_locus_tag="CNE_2c04870"
     CDS             520801..521082
                     /locus_tag="CNE_RS20480"
                     /old_locus_tag="CNE_2c04870"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_013952187.1"
                     /db_xref="GI:503718111"
                     /translation="MSATPANVYIALQNNDDTRPIIDAITEANPHAVVSQFPAMVKID
                     APGHLTIVRELVAGKLGRDWDLQEIHLNLISLCGNIDEDEDAFTLRWNA"
     gene            521118..522638
                     /locus_tag="CNE_RS20485"
                     /old_locus_tag="CNE_2c04880"
     CDS             521118..522638
                     /locus_tag="CNE_RS20485"
                     /old_locus_tag="CNE_2c04880"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenol 2-monooxygenase"
                     /protein_id="WP_013952188.1"
                     /db_xref="GI:503718112"
                     /translation="MDARKKLNLREKYASMTRDLAWETTYEPMDKVFPFDKYEGIRIH
                     DWDKWEDPFRMTMDAYWKYQSEKERKLYAIIDSFVQNNGHLNVSDPRYLNALRLFLTG
                     VTPLEYAAHRGYAHLGRHFRGAGARVAAQMQSVDELRHAQTQLHTLSVYNKYFHGFGE
                     WRHMHDRVWYLSVPKSYFEDAMSAGPFEFITAISFSFEYVLTNLLFMPFMSGAAYNGD
                     MATVTFGFSAQSDESRHMTLGLEVVKFLCEQDPGNIPILQKWLDKWFWRGFRLLTLVG
                     MMMDYMLPKRVMSWAEAWEMYFEQAGGALFKDLERYGLRMPKYHEVATKTKDRITHEA
                     WATFYNYAGAAGFHTWVPKADEMAWLAEKYPQTFERYYKPRLDHWQERQQAGDRFYNA
                     TLPMLCQTCQIPMVFSEPDDPTQTCYRESSYHGMKFHFCSDGCKDIFDDEPAKYAQAW
                     LPVHQIYQGNCGGATLEDVLKWYRLNPGADNLDFEGSQDQRNWNAWKGIGPAADAA"
     gene            522670..523029
                     /locus_tag="CNE_RS20490"
                     /old_locus_tag="CNE_2c04890"
     CDS             522670..523029
                     /locus_tag="CNE_RS20490"
                     /old_locus_tag="CNE_2c04890"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase"
                     /protein_id="WP_013952189.1"
                     /db_xref="GI:503718113"
                     /translation="MPVVSIGDYAFEAADREAVFHGNRLLYIGWDGHLLFCAPHCLPF
                     PPSMPLREVVDKVLPGVYGYHPDFARIDWGQVQWLRGRQPWQPDLDRSLEENGLGHKD
                     VIRFRTPGLDGIGGSRS"
     gene            523067..524134
                     /locus_tag="CNE_RS20495"
                     /old_locus_tag="CNE_2c04900"
     CDS             523067..524134
                     /locus_tag="CNE_RS20495"
                     /old_locus_tag="CNE_2c04900"
                     /EC_number="1.14.13.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase"
                     /protein_id="WP_013952190.1"
                     /db_xref="GI:503718114"
                     /translation="MYSLTIEPIGQTIPIAPGQTVLDACLRNGVWLPHACCHGLCATC
                     KVQVVDGEVEQGEASSFALMDFERDNGQCLACCATAQSDLVIEADIEEDADALGLPLA
                     DYRAEVVETRALTPTILGIWLRVKDGGRTAFQAGQYVNLTVPGCDQPRAFSLANAPGD
                     DLVELHVRRVPDGQATGYLHDQLAVGDELSFSAPYGRFFVRKSAQVPMLFLAGGSGLS
                     SPRAMILDLLAAGETLPITLVQGARNRGELYYGAEFQALAQAHPNFRYVPALSDEPAD
                     SGWSGARGYVHDVLQQLYAQDGNADFRGHKAYLCGPPPMIEACIRTLMQGRLFEADIH
                     TEKFLSAADAQNSARSPLFKI"
     gene            524146..524469
                     /locus_tag="CNE_RS20500"
                     /old_locus_tag="CNE_2c04910"
     CDS             524146..524469
                     /locus_tag="CNE_RS20500"
                     /old_locus_tag="CNE_2c04910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_013952191.1"
                     /db_xref="GI:503718115"
                     /translation="MHTVEIAGSGLRYPCAPEQNLLRAMEVLGQRGIPAGCRGGGCGV
                     CKVRIEAGDYHAGKMSRACLSEAQQRDGLVLACKTYPDSDIRLRPVALLQRCLEKQRQ
                     REQGR"
     gene            524541..525476
                     /locus_tag="CNE_RS20505"
                     /old_locus_tag="CNE_2c04920"
     CDS             524541..525476
                     /locus_tag="CNE_RS20505"
                     /old_locus_tag="CNE_2c04920"
                     /EC_number="1.13.11.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catechol 2,3 dioxygenase"
                     /protein_id="WP_013952192.1"
                     /db_xref="GI:503718116"
                     /translation="MALTGVLRPGHVALRVLELEPALKHYTEVLGLIETARDAQGRVF
                     LKAWDEHDHHSVVLREADSPGMDYMGFRVDSGHTLERLAQEVERSGLAIDCQWIAAGE
                     HPHTGARFRFTIPTGHAIELFADKDKPGCRTGDLNPDPWPDDLRGMAPSRFDHCLLYG
                     DDVDGTVRLFRDVLGFSLAEQVVAGPDGEMLIGAFLTCSNKAHDIAFIRHPEKNRFHH
                     ASFLLDNWGEVLKAADIISKKDVSLDIGPTRHGITRGATIYFFDPSGNRNEVFSGGYI
                     HYPDKPTITWTDNELGRAIFYHDRKLNEAFLNVLT"
     gene            525592..527046
                     /locus_tag="CNE_RS20510"
                     /old_locus_tag="CNE_2c04930"
     CDS             525592..527046
                     /locus_tag="CNE_RS20510"
                     /old_locus_tag="CNE_2c04930"
                     /EC_number="1.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952193.1"
                     /note="catalyzes the formation of betaine from betaine
                     aldehyde; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxymuconic semialdehyde dehydrogenase"
                     /protein_id="WP_013952193.1"
                     /db_xref="GI:503718117"
                     /translation="MKDFKNFINGEWVGTARTFENRNPTDNSLIGHVHEAGRAEVDAA
                     VQAARSALQGPWGRMTVAQRVELLHAVADGINRHFDEFVQAEIADTGKPFGLASHIDI
                     PRGAANFKVFADLIRNVPTESFAMDTPDGGKAINYAVRSPRGVIGVVSPWNLPLLLMT
                     WKVGPALACGNTVVVKPSEETPATATLLGEVMNEAGVPPGVYNVVHGFGPDSAGAFLT
                     AHPQVNGITFTGETRTGEAIMKAAANGVRPVSFELGGKNAGIVFADADFDKAVAGITR
                     SAFENSGQVCLGTERVYVQRPIFERFVAALKAKAEGLKLGRPTELGVNMGPLVSHEHR
                     DKVLSYYRKAAEAGATVVTGGGVPQMPGALAEGAWVQPTIWTGLPESAAVIREEIFGP
                     CCHIAPFDTEEEVIALANDTPYGLAATVWTGDLGTAHRMGSALDVGICWINAWFLRDL
                     RTAFGGARQSGIGREGGVHSLEFYTELRNVCVRL"
     gene            527056..527835
                     /locus_tag="CNE_RS20515"
                     /old_locus_tag="CNE_2c04940"
     CDS             527056..527835
                     /locus_tag="CNE_RS20515"
                     /old_locus_tag="CNE_2c04940"
                     /EC_number="4.2.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="WP_013952194.1"
                     /db_xref="GI:503718118"
                     /translation="MHSELLEIGAGLHHALASRRPVAPLTESWPELSIDDAYRIQLAM
                     VQHRLDAGERVVGKKIGVTSRVVMDMLDVRQPDFGHLLSGMVYPDGAAIPADTLIAPK
                     AEGEIAFVLKEDLEGPGVTNADVLRATAYVLPCFEIVDSRIRDWKIRIQDTVADNASS
                     GVFVLGDAAVDPRSVDLGTVGMTLEKNGEIVATGAGAAALGHPVNAVAWLANTLGRLG
                     IGLKRGEVILSGSLAAMVPVTAGDQLRISLGGIGSAGVRFV"
     gene            527872..528660
                     /locus_tag="CNE_RS20520"
                     /old_locus_tag="CNE_2c04950"
     CDS             527872..528660
                     /locus_tag="CNE_RS20520"
                     /old_locus_tag="CNE_2c04950"
                     /EC_number="4.1.1.77"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate decarboxylase"
                     /protein_id="WP_013952195.1"
                     /db_xref="GI:503718119"
                     /translation="MNLTQDTIARLAEHLENAELQREAVRKITDEYPDMDWDDAYAIQ
                     DAIRARKEARGTRIAGLKMGLTSFAKMRQMGVSDPVYGFLTDYGACMDGAAIDTGTLI
                     HPKVEAEIAFVLKAPLKGPGCHIGDVLAATDFVVPAVEVIDSRYEYFRFDLKSVIADN
                     TSSARFVVGGTHRGAEGLDLKNLGVVLEKNGEVVATAAGAAVLGHPANSVAMLANMLG
                     ARGRELPAGTFIMTGGVTEAIAVAAGDNITVRYQHLGTVSMRFT"
     gene            528684..528875
                     /locus_tag="CNE_RS20525"
                     /old_locus_tag="CNE_2c04960"
     CDS             528684..528875
                     /locus_tag="CNE_RS20525"
                     /old_locus_tag="CNE_2c04960"
                     /EC_number="5.3.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="WP_013952196.1"
                     /db_xref="GI:503718120"
                     /translation="MPIMQVFLIEGRTDEQKARLIRALTDAAVEAVGAPVETVRVMIT
                     EVPKAQFGIGGKTARELGR"
     gene            528901..529845
                     /locus_tag="CNE_RS20530"
                     /old_locus_tag="CNE_2c04970"
     CDS             528901..529845
                     /locus_tag="CNE_RS20530"
                     /old_locus_tag="CNE_2c04970"
                     /EC_number="1.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="WP_013952197.1"
                     /db_xref="GI:503718121"
                     /translation="MDMKASGRHKVAIIGSGNIGTDLMIKVMRHGRSLEMGAMVGIDA
                     ASDGLARAARLGVPTTAEGIDGLVGMPGFGDIRIAFDATSAGAHAYHNRVLQQHGVRV
                     IDLTPASIGPYVVPVVNLDQHLDAPNINMVTCGGQATIPMVAAVSRVANVHYAEIVAS
                     ISSRSAGPGTRANIDEFTETTSQALCSVGGAARGKAIIVLNPAEPPLMMRDTVFTLSE
                     DGDEAEIAASVEAMAQAVQGYVPGYRLKQRVQFERIAASAPLNIPGLGPMSGLKTSIF
                     LEVEGAAHYLPAYAGNLDIMTSAALACAERLAEARLSA"
     gene            529863..530927
                     /locus_tag="CNE_RS20535"
                     /old_locus_tag="CNE_2c04980"
     CDS             529863..530927
                     /locus_tag="CNE_RS20535"
                     /old_locus_tag="CNE_2c04980"
                     /EC_number="4.1.3.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952198.1"
                     /note="catalyzes the formation of pyruvate and
                     acetaldehyde from 4-hydroxy-2-ketovaleric acid; involved
                     in the degradation of phenylpropionate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hyroxy-2-oxovalerate aldolase"
                     /protein_id="WP_013952198.1"
                     /db_xref="GI:503718122"
                     /translation="MTAQPTRKLYISDVTLRDGSHAIRHQYSLDHVRRIAAALDAARV
                     DSIEVAHGDGLSGSSFNYGFGAHTDLEWIAAVAETVRHARVATLLLPGVGTVHDLRAA
                     YDAGARVVRVATHCTEADVSRQHIEYARELGMDTVGFLMMSHMTTPAALAQQAKLMES
                     YGAQCVYVVDSGGALGMQDVRERFRAFKDVLKPETQTGMHAHHNLSLGVANSIVAAEE
                     GCDRVDASLAGMGAGAGNAPLEVFIAAAERLGWQHGCDLYTLMDAADDIVRPLQDRPV
                     RVDRETLALGYAGVYSSFLRHAEAAAARYGLGTVDILVELGRRRMVGGQEDMIVDVAL
                     DLLARRSAQAEQGVSSAAVA"
     gene            complement(530956..531510)
                     /locus_tag="CNE_RS20540"
                     /old_locus_tag="CNE_2c04990"
     CDS             complement(530956..531510)
                     /locus_tag="CNE_RS20540"
                     /old_locus_tag="CNE_2c04990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_013952199.1"
                     /db_xref="GI:503718123"
                     /translation="MNCALLIIDFQAGLVDSAPLPGDAAAVATNINTLSTRARQAAVP
                     VIFIQHENEDALRHGSTAWQLSAGLQVEPGDYRIGKRTPDSFLRTELQTVLAEHDVKH
                     VVVCGYATEFCVDTTVRRAAANGYGVTIAADAHTTHDKPHADAARIREHHNATLSNIR
                     SFGPKIAAVSTDAIDFRSLARPRC"
     gene            complement(531552..533258)
                     /locus_tag="CNE_RS20545"
                     /old_locus_tag="CNE_2c05000"
     CDS             complement(531552..533258)
                     /locus_tag="CNE_RS20545"
                     /old_locus_tag="CNE_2c05000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_041228547.1"
                     /db_xref="GI:752557315"
                     /translation="MLNGFDALVEESMADWKIPGLALAVIRDGEPVLMRGYGVRDSVG
                     SAPVTTATQFMLCSITKSFTAAGLGLLVDERKLNWTTPVRDLIPGFRLHDAVTTERIT
                     VRDLLCHHSGMPRHDWLHTPGDLDTSELLARLRHLAPSRDLRERWQYQNLGYVIAGHV
                     AERLSGQRWEDFTGERLLRPLGFSRFGFSADALAAAPDHAHPHTMVGDERLRASLSSI
                     VKPAGGLATSVEDLAKWMRCLLDEGKVGGRALLSPAIVRDMMTPGVHIGMSEFPEVGD
                     QHYGLGLTVEQYRGERTVSHSGSWLGWAALMTLMPSRRIGIAVLTNRAPSAVTALLTY
                     AALDQLCGHPPIDWFTCMQARRHEMLAQLQINQAARQARQHTGTSPSPSHPLHDYAGD
                     YSHPAYGQVTIGADGDALSWRWRGMSGQLAHRHYDVFSTAEKPAEIHPDNLALTFLYN
                     REGTIDSIAAPLEPLVDDIVFHRMASGDATTAAFRARCAGEYRHSVQRIEVALDAAGH
                     LLMTITGQPRYHLLPSEGQTFEIAELPGWRVEFRAPAQEAVDALKLFQPNGTFLALRV
                     QP"
     gene            533656..535290
                     /locus_tag="CNE_RS20550"
                     /old_locus_tag="CNE_2c05010"
     CDS             533656..535290
                     /locus_tag="CNE_RS20550"
                     /old_locus_tag="CNE_2c05010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_013952201.1"
                     /db_xref="GI:503718125"
                     /translation="MNFRSLSIRTRLLAGFGTLAGMVLVVSAYSLHALGDATAGFNDY
                     LNGLNARADMAAQVRSAVDRRAIAARNLVLVTDAAELEREKADALRAHQDVQTRLARL
                     NEMVRQPGISDEARKLVEEVAKVEAQYGPVATGIVGLAVERKIEEAVSRIDKHCRPLL
                     AALIKATDAYAEFTKTRQKEMERRLEADYERQRNLLILISLVSAAIAVVGGLLVTRAI
                     TRPIQRAVDVAGTVASGDLGARIEVDRDDETGRLLAALRDMNERLTATVTQVRAGSGN
                     IAVSTSEIARGNADLSSRTEEQAASLEETAASMEELTETVRLNTDNARQASELARSAA
                     DVAQRGSATVQRVVGTMQDISASSSKIAEITGIIEGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVASEVRGLAQRSSSAAKEIKDLIEASGRQVHDGASLASEAGQTMAEVTQAVA
                     RVTGIVEEIATASAEQTRGIEQVNQAIAQIDQVTQQNASLVNEAANASRALEEQGREL
                     TEVVAFFRLPGEGGASHLGADTLATQRRAAHRLAAA"
     gene            535369..536334
                     /locus_tag="CNE_RS20555"
                     /old_locus_tag="CNE_2c05020"
     CDS             535369..536334
                     /locus_tag="CNE_RS20555"
                     /old_locus_tag="CNE_2c05020"
                     /EC_number="4.3.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313565.1"
                     /note="catalyzes the formation of 2-oxobutanoate from
                     L-threonine or the formation of pyruvate from serine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine dehydratase"
                     /protein_id="WP_013952202.1"
                     /db_xref="GI:503718126"
                     /translation="MTALPISFDDVAAAHERIRAAAHRTPVLTSATADAATGAQLFFK
                     AENFQRIGAFKFRGAYNAIAQFTPQQKAGGVLAFSSGNHAQAIALSARLLGVQAVIVM
                     PQDAPAIKIEATRGYGAEVVLYDRYQDDREALGRRIAAERGMTLIPPYDHPHVMAGQG
                     TAAKELFEETGPLDMLVVCLGGGGLLSGCAVAAQAMSPGCAVYGVEPEAGNDGQRSLR
                     SGEIVRIDTPRTIADGAQTPFLGNHTFAVIRELVMDIATVSDAELVDTMKFFAGRMKI
                     VVEPTGCLAAAAVLHGKLDVKGKRVGVIISGGNVDLGAFGSFLLG"
     gene            536410..537639
                     /locus_tag="CNE_RS20560"
                     /old_locus_tag="CNE_2c05030"
     CDS             536410..537639
                     /locus_tag="CNE_RS20560"
                     /old_locus_tag="CNE_2c05030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein RtcB"
                     /protein_id="WP_013952203.1"
                     /db_xref="GI:503718127"
                     /translation="MTDKRHYDVLDTGAGKPVKLWTRGVPVESAAREQLLNTARMPFI
                     FRHLAVMPDVHLGKGSTIGSVIPTVGAVIPAAVGVDIGCGMMAVKTSLTAADLPDNLG
                     PLRSAIEHAVPHGRTAQGGRRDQGAWGSAPAPVDAAWAEMAPGFRRITDKYPHLARTN
                     HRNHLGTLGTGNHFIEVCLDEAQSVWFMLHSGSRGVGNAIGTTFISLAQQDMRKHLAN
                     LPDRDLAYLVEGSEHYEDYIFAVSWAQAYARRNRELMMEAVLAAAQRVLRRPFQARLE
                     AVNCHHNYVQKEHHFGAEVLVTRKGAVSARVGELGIIPGSMGARSFIVRGKGNPESFC
                     SCSHGAGRTMSRSEAKRRFTVADQVHATEGVECRKDAAVIDEIPMAYKDIDAVMAAQA
                     DLVEIVHTLRQVVCVKG"
     gene            complement(537663..538655)
                     /locus_tag="CNE_RS20565"
                     /old_locus_tag="CNE_2c05040"
     CDS             complement(537663..538655)
                     /locus_tag="CNE_RS20565"
                     /old_locus_tag="CNE_2c05040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952204.1"
                     /db_xref="GI:503718128"
                     /translation="MRPLSVVRSLASLLFVAGSLGTLPGRAEANIASTFPQKPIRVVV
                     TFPAGGGTDSLARLIGNDLSKSLGQPVVVDNRPGASGNIGAEFVAKSPADGYTLLIVN
                     SSFAINPSVFKKLQFNPKSDFSAVITFASVPSVIAVPSHSKLRTFSDLLAAGRSGSPP
                     SYASCGNGTPQHLAGELLKVSAKMDMLHVPYKGCAPAIADVLGNQADVSVNTLTNTIP
                     YLKSNKLRALAVTSKARSPFLPDVPTVNELGVAGYDVDQWFGILAPANTPPEIVQRLN
                     TEIARAIARPEIKASLTQLGFATTTSTPAEFQKLVSSDIDRWQKFATKINLLVD"
     gene            complement(538699..540504)
                     /locus_tag="CNE_RS20570"
                     /old_locus_tag="CNE_2c05050"
     CDS             complement(538699..540504)
                     /locus_tag="CNE_RS20570"
                     /old_locus_tag="CNE_2c05050"
                     /EC_number="2.4.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0K3R9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="WP_013952205.1"
                     /db_xref="GI:503718129"
                     /translation="MKATGTFFFVVGPSGAGKDSLIDGARAALDDDYVFARRVITRPD
                     GSAGEAHEGVTEAEFARRQRSGEFLVTWDAHDLCYGLPRSLMLELERGRNVVANGSRG
                     VIAELAARLPRFVVIVVTAPHDVLAQRIAARGRESGDQVASRVARAGAPVPPHVPCIT
                     VSNDSTLEAGTARFVEALRNGTGASAAERPASRTNLMAKLRGDPLDEAAYVAVLQDAI
                     AGRYTEAELTEFLVAATRTLTDEEVVALARARTAFTPRIDWDEPVVVDKHSMGGVPGS
                     RITLIVVPIVAAYGLAMPKTSSRAITSAAGTADAMETIARVDLAHEDVRRCVAQARAC
                     IAWNGRLNHSVVDDVMNAITRPLRLDSRRWSVASILSKKYTAGATHVIVDLPYGPQTK
                     LATRADAEALGALFEHVGKGLGLHVRALVTDGSRPIGRGIGPALEVRDVRLVLDNAPD
                     APADLREKALRFAGEIIAFDPRVDSPEHGMQIATALLHEGKARAAFDRIAAAQGARAD
                     PVAPGTHTQVVPAATQGRVTGIDGLQISGVARAAGAPRDGGAGVDMLCTIGAKVAPGQ
                     PLYRIHAGSAEALEAAAALARAGGEYCQAVRIDPD"
     gene            540901..541446
                     /locus_tag="CNE_RS20575"
                     /old_locus_tag="CNE_2c05060"
     CDS             540901..541446
                     /locus_tag="CNE_RS20575"
                     /old_locus_tag="CNE_2c05060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_041228799.1"
                     /db_xref="GI:752557567"
                     /translation="MATKKPDAPVPITPADEADEERLAHLVKDAARAYIRALQLRLAE
                     HSVSYGHWTILRILWRHDGVSQRELSERAGVTEPTTFAAVKALEALGYVERTHLPGNK
                     KKVHVFLSKTGRALRRKLEPLATEVNELSVEGVSEEDVLTTRRVLITIAKRLVADEVA
                     SAEHGRRVPSTQEVGRLLSDL"
     gene            complement(541555..542388)
                     /locus_tag="CNE_RS20580"
                     /old_locus_tag="CNE_2c05070"
     CDS             complement(541555..542388)
                     /locus_tag="CNE_RS20580"
                     /old_locus_tag="CNE_2c05070"
                     /EC_number="2.4.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="WP_013952207.1"
                     /db_xref="GI:503718131"
                     /translation="MYDIFATDKLIDLWLTEDIGICDLTVQTMIEPGETGTFCMNARE
                     PMLIAGIDVAARIFARYDPTLSVDVRVADGDKVEKGAVLLNVSGNARSVLTAERTALN
                     IMQRLCGIANHTATYAQAIAHTRARLIDSRKTTPGLRALEKHAVTCGGGLNHRLSLDN
                     GVMIKDNHIAVCGSIAAAVARVRRKLPVLTKLEVECDRLEQVHEALAAGVDVIMLDNM
                     SVPDMKEAVQIVNGRTKVEASGGIRLETIRAVAETGVDYISTSKITQSAPAVDIGLDE
                     A"
     gene            complement(542512..543297)
                     /locus_tag="CNE_RS20585"
                     /old_locus_tag="CNE_2c05080"
     CDS             complement(542512..543297)
                     /locus_tag="CNE_RS20585"
                     /old_locus_tag="CNE_2c05080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="WP_013952208.1"
                     /db_xref="GI:503718132"
                     /translation="MVEFTSAQLYSWLVAFLWPFFRLLALIGTAPLFGESTIPRRAKI
                     ALSAMIAMVVSPTIAQLPVVPVYSFGGLMIILNEIGIGLATGFAMRLVFATVQQAGEI
                     IGLQMGLSFASFFDRAAGGQTMVLSRFLNLIAMLLFLALDGHLLMLGTLVDSFNGLPI
                     GGTPLSAGGAMAVARAGGMVFSSGLLLALPMIAALLTLNLAMGILNRASPQLSIFAVG
                     FPVTLSGGLLVLMLVMPQMGTYMQHMIEAGLEAVGTVLGQFAR"
     gene            complement(543356..543625)
                     /locus_tag="CNE_RS20590"
                     /old_locus_tag="CNE_2c05090"
     CDS             complement(543356..543625)
                     /locus_tag="CNE_RS20590"
                     /old_locus_tag="CNE_2c05090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008651899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliQ"
                     /protein_id="WP_010810398.1"
                     /db_xref="GI:498509932"
                     /translation="MTPETVMTIATQAMKMTLLLAAPLLLVALAAGLVVSLFQAATQI
                     NEMTLSFIPKLIALFATMVLAGPWMINSMVDYMREVFQSIPALAH"
     gene            complement(543666..544451)
                     /gene="fliP"
                     /locus_tag="CNE_RS20595"
                     /old_locus_tag="CNE_2c05100"
     CDS             complement(543666..544451)
                     /gene="fliP"
                     /locus_tag="CNE_RS20595"
                     /old_locus_tag="CNE_2c05100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952209.1"
                     /note="FliP, with proteins FliQ and FliR, forms the core
                     of the central channel in the flagella export apparatus;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="WP_013952209.1"
                     /db_xref="GI:503718133"
                     /translation="MNFPRAALRRPLPGPLLSLLALMLAVAALVPAQAWAQTLPGVVS
                     KPAPGGGQIWSLPVQTLLLLTSLSFLPAAMLMMTGFTRVIIVLGLLRSALGTASSPPN
                     QVLVGLSLFLTFFVMAPVFDRVYNDAYKPLSENKISLEAAAAKAAEPLKAFMLRQTRE
                     KDLAMFAQMAKAPEMQGPEEVPLSILVPAFVTSELKTAFQIGFTIFIPFLIIDLVVAS
                     VLMAMGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFMN"
     gene            complement(544448..544903)
                     /locus_tag="CNE_RS20600"
                     /old_locus_tag="CNE_2c05110"
     CDS             complement(544448..544903)
                     /locus_tag="CNE_RS20600"
                     /old_locus_tag="CNE_2c05110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliO"
                     /protein_id="WP_013952210.1"
                     /db_xref="GI:503718134"
                     /translation="MTIQTRASLAVLAALPGAAMAADGTHVPAISGAASLAQAGLGLF
                     AIVALILGMAWVARRAGLVRHATGGAMKVVGSTMLGARQRLVLVEVGDTWLVLGVSPG
                     EIRPLHTLPAGTTAANPLAATGGAGPSQQPGGGTFAEKLLRSMQDHLKS"
     gene            complement(544900..545349)
                     /locus_tag="CNE_RS20605"
                     /old_locus_tag="CNE_2c05120"
     CDS             complement(544900..545349)
                     /locus_tag="CNE_RS20605"
                     /old_locus_tag="CNE_2c05120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_013952211.1"
                     /db_xref="GI:503718135"
                     /translation="MSDGIEDKPVDPMDDWASALAEQTSATSAATPAAAAPAAQPAAT
                     PAAATVFQPLAKEAPSGFRNDIEMILDIPVQLTVELGRTKVPIKNLLQLAQGSVVELD
                     GLAGEPMDVLVNGYLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNK"
     gene            complement(545342..546361)
                     /gene="fliM"
                     /locus_tag="CNE_RS20610"
                     /old_locus_tag="CNE_2c05130"
     CDS             complement(545342..546361)
                     /gene="fliM"
                     /locus_tag="CNE_RS20610"
                     /old_locus_tag="CNE_2c05130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810394.1"
                     /note="with FliG and FliN makes up the switch complex
                     which is involved in switching the direction of the
                     flagella rotation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_013952212.1"
                     /db_xref="GI:503718136"
                     /translation="MAYDKFLSQDEVDELLKGVSGEADTPKASEPALDEGGVRPYNLA
                     TQERIIRGRLHTLEIINERFARSMRTALFNFIRRGADITVGSIRIEKFGDFARNLPMP
                     TNLNLVHLKPLRGTALFVYDPNLVFLVVDNLFGGDGRFHTRVEGRDFTQTEQRIIQRM
                     LELTLASYGNAWRTVHPIETEYIRSEMHPKFANVATHNEAVVTTAFHIELGAVGGQLH
                     VCLPYSMIEPLKDLLMNPLQDEKEVDKGWVTQLSTQLRAAEVELVAEFAHLQSTVAEV
                     LAMRAGDVLPIELPEKVFGKVDGVPVMQCGFGTMNGQYALRVERMINHQDGDSHLDTE
                     DSDYE"
     gene            complement(546421..546912)
                     /locus_tag="CNE_RS20615"
                     /old_locus_tag="CNE_2c05140"
     CDS             complement(546421..546912)
                     /locus_tag="CNE_RS20615"
                     /old_locus_tag="CNE_2c05140"
                     /function="Cell motility and secretion"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018005080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FliL"
                     /protein_id="WP_011616679.1"
                     /db_xref="GI:499935945"
                     /translation="MANTASPPRTGNTGKRGRLLLIGAGVLVVALGAGGFVLGSVLSN
                     RQPAAPAAPAAPVVPPPIFVPLDAFTVNLRSDDGDRFLHTGLSLKVADAETQARLAQY
                     LPEARSRILLLLSARQPADLATVEGKRKLADDIRDTISKPFASGLPAQRVLDVLFTSF
                     VVQ"
     gene            547355..549946
                     /locus_tag="CNE_RS20620"
                     /old_locus_tag="CNE_2c05150"
     CDS             547355..549946
                     /locus_tag="CNE_RS20620"
                     /old_locus_tag="CNE_2c05150"
                     /EC_number="4.2.1.3"
                     /EC_number="4.2.1.99"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314464.1"
                     /note="catalyzes the conversion of citrate to isocitrate
                     and the conversion of 2-methylaconitate to
                     2-methylisocitrate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aconitate hydratase
                     2/2-methylisocitrate dehydratase"
                     /protein_id="WP_013952213.1"
                     /db_xref="GI:503718137"
                     /translation="MLENYRAHVAERAALGIPPLPLTAKQTAELVELLKNPPAGEEQN
                     LVELITYRVPAGVDDAAKVKASYLAAVALGKEKCALISRAKATELLGTMLGGYNISPL
                     IELLDDAEVGTVAAEALKKTLLMFDAFHDVKEKADKGNANAKAVLQSWADAEWFTSRP
                     EVPQSLTITVFKVPGETNTDDLSPAPDATTRPDIPMHALAMLKNKREGAAFQPEEDGK
                     RGPVKFIESLKEKGHLVAYVGDVVGTGSSRKSATNSVLWFTGEDIPFIPNKRFGGVCL
                     GNKIAPIFYNTMEDAGALPIELDVSKMEMGDVVELRPYEGKALKDGAVIAEFKVKSDV
                     LFDEVRAGGRIPLIVGRGLTAKAREALGLAPSTLFRLPQNPADTGKGFTLAQKMVGRA
                     CGLAEGKGIRPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAA
                     YPKPVDVKTHHTLPEFISTRGGISLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIG
                     ISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGVTLRDLVNAIPLYAIKQGLL
                     TVAKQGKQNIFSGRVLEIEGLPDLKVEQAFELSDASAERSAAGCTVRLNKDPIIEYIN
                     SNITLLKWMIAQGYQDPRSLQRRIKAMEAWLADPKLLEPDADAEYAAVIEIDLADVHE
                     PIVACPNDPDDVKTLSEVAGAKIDEVFIGSCMTNIGHFRAASKLLEGKRDIPVKLWVA
                     PPTKMDQKQLTEEGHYGVFGTAGARTEMPGCSLCMGNQAQVREGATVMSTSTRNFPNR
                     LGKNTNVYLGSAELAAICSRLGRIPTKEEYMADMGVLNANGDKIYKYMNFDQIEDFKE
                     VADGVTV"
     gene            complement(550038..550256)
                     /locus_tag="CNE_RS20625"
     CDS             complement(550038..550256)
                     /locus_tag="CNE_RS20625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228548.1"
                     /db_xref="GI:752557316"
                     /translation="MRTAQEGAGHWKNPIINRPCHACGAGPQAVSAGCTARCRAARKH
                     RENLMRKLDLHNTAEVVAYAARHGVPLD"
     gene            550278..550982
                     /locus_tag="CNE_RS20630"
                     /old_locus_tag="CNE_2c05160"
     CDS             550278..550982
                     /locus_tag="CNE_RS20630"
                     /old_locus_tag="CNE_2c05160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_041228549.1"
                     /db_xref="GI:752557317"
                     /translation="MPDLSAFPITRKWPAQHPDRIQLYSLPTPNGVKVSIMLEETGLP
                     YEPHLVRFDAHDQMSPEFLSLSPNNKIPAILDPNGPRGKPLALFESGAILLYLADKSG
                     KRIPADPARRYETIQWVMFQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRL
                     LNVLNQRLEGRDWIMGDEYTIADIATFPWVRNLVGFYEAGELVGIQDVPHVRRVLEAF
                     VKRPAVVKGLDTPHRG"
     gene            551112..552443
                     /locus_tag="CNE_RS20635"
                     /old_locus_tag="CNE_2c05170"
     CDS             551112..552443
                     /locus_tag="CNE_RS20635"
                     /old_locus_tag="CNE_2c05170"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sorbosone dehydrogenase"
                     /protein_id="WP_013952215.1"
                     /db_xref="GI:503718139"
                     /translation="MPMPTAISLLRVVLLAGATAALAACGESAKLPSEAGFGPVPQLP
                     PPNQTAIPTVKIAPAIGWAAGQRPVPAAGMAVTAFADKLDHPRWVYVLPNGDVLVAES
                     NAPPKPDDGKGIRGWIMKKLMKRAGAGTPSANRITLLRDTNGDGVADQRSVFLKDLNS
                     PFGMALVGNDFYVAATDAVLRFPYQPGQTQITAAPQKVVDLPGGPLNHHWTKSLIASR
                     DGSKLYVTVGSNSNVGEHGMDREVGRAAIWEVDPKTGTHRIFASGLRNPNGMAWEPVT
                     GMLWTAVNERDEIGSDLVPDYITSVRDGGFYGWPYSYYGQHVDARVKPPAPDLVARAI
                     VPDYAVGAHTASLGLAAAGGNSLPARFSEGMFVGQHGSWNRRPLAGYKVIFVPFSKGR
                     PNGAPFDVLTGFLDEDGNARGRPVGVAIDPRGGLLVADDVGNTVWRVSGAK"
     gene            552515..553363
                     /locus_tag="CNE_RS20640"
                     /old_locus_tag="CNE_2c05180"
     CDS             552515..553363
                     /locus_tag="CNE_RS20640"
                     /old_locus_tag="CNE_2c05180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952216.1"
                     /db_xref="GI:503718140"
                     /translation="MSLTVFAVVLLAAFLHAAWNAVVKGGGDKMLSTVMVAVSAGLMG
                     AVALPALPQPAPASWPFIAASVGVHVVYFALVARIYHTADMSQTYPLMRGTAPLLVAV
                     ASVGWLGEHLSGLAWGGIAVVSLGILAMAGGGHGARAAAGSREGMWLALLNALVIAAY
                     TLIDGTGVRRSGAPVAYAFWIFVLTAVPLAAWALVARRPALAGYVRRNLVFALVGGGG
                     TLASYGLSLWAMTRAPVAPVAALRESSILFGALISGLLLKERVGAARLGAACLIAAGA
                     ATLRFA"
     gene            553505..554329
                     /locus_tag="CNE_RS20645"
                     /old_locus_tag="CNE_2c05190"
     CDS             553505..554329
                     /locus_tag="CNE_RS20645"
                     /old_locus_tag="CNE_2c05190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase UbiE"
                     /protein_id="WP_013952217.1"
                     /db_xref="GI:503718141"
                     /translation="MDHTADSFRAFELAGWEDPEVVSQYQEHLSHVTRQSVESLLDDA
                     HVASGLRVLDVATGSGHVAAGAVRRGAESVGIDFSLAQVQLARKLHPDVHYEQADAQA
                     LPFGDASFDAVVNGFGMCHLSDPEAALAEAFRVLRPGGRIAFTVWDTPERAVGFGAVY
                     AAIRACGSMEVDLPVGPNFFLFSDPGHCRTALQQAGFVSPTCRSVPQVWRFSTPDQLF
                     DALAQGTVRAAATLRAQTPRARDEIRAVLRGTVAAYMRGSGFEVPMPAVLAAAVKP"
     gene            554562..554924
                     /locus_tag="CNE_RS20650"
                     /old_locus_tag="CNE_2c05200"
     CDS             554562..554924
                     /locus_tag="CNE_RS20650"
                     /old_locus_tag="CNE_2c05200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952218.1"
                     /db_xref="GI:503718142"
                     /translation="MNTRSQCQTGQAAPRPPAILHRSRQAMALLRVLGLCINSVACAQ
                     SEAPQAAAPAVQAVTPEQKFAPGYLEAVATGYDNGLALREPEGLVPLRPPREARSAPA
                     AGAVPVAMPAAVRPQPAR"
     gene            555049..555909
                     /locus_tag="CNE_RS20655"
                     /old_locus_tag="CNE_2c05210"
     CDS             555049..555909
                     /locus_tag="CNE_RS20655"
                     /old_locus_tag="CNE_2c05210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952219.1"
                     /db_xref="GI:503718143"
                     /translation="MDIELARTFLQVVRTGSLLAAADKLHVTQTAVTARIKSLESQLN
                     CRLFDRNKAGARLTPDGQRFLGYASQLVQTWEAACRELPLPAGLASLFRFGTEISLGN
                     PLVLLWTTRLRQLMPAQAVRAEVGEGAELQRKLQSGTLDAALVYQPEYAPGMHVEALM
                     EEKLILIRSTQRDGGYVYVDWGPEFRRQHDSALPEHARASLYFNLGPLALQYILQFGG
                     SGYFRTRVVQSYLDSGVLARVEGASEFSYPVFLVCARTPTGAAQDAVRILRDIVREES
                     DWSQRWDFPQ"
     gene            complement(555920..556168)
                     /locus_tag="CNE_RS20660"
                     /old_locus_tag="CNE_2c05220"
     CDS             complement(555920..556168)
                     /locus_tag="CNE_RS20660"
                     /old_locus_tag="CNE_2c05220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952220.1"
                     /db_xref="GI:503718144"
                     /translation="MEAVLWIALVLALVALGGSVTWLIGTRVPEPVFERAQLHGRFAG
                     LEPRPPRGGGRGRRVRRVRQWRLVAVPGPMGQLVPVRI"
     gene            556402..557559
                     /locus_tag="CNE_RS20665"
                     /old_locus_tag="CNE_2c05230"
     CDS             556402..557559
                     /locus_tag="CNE_RS20665"
                     /old_locus_tag="CNE_2c05230"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952221.1"
                     /db_xref="GI:503718145"
                     /translation="MQRLIFEAEHDAFRESARRFYQREVGPHGERWREQGCVDREVFR
                     KAGEQGYLLMWADEKYGGAGVEDFRYEQILIEENARHGDSGFFGTLHSRLVAPYIGRI
                     GNEEQRQRLLPAAARGESIFAIAMTEPQAGSDLAGMRTRAEDHGDHWVLNGAKTYISN
                     GQLADFVVVVARTDPERSHGLGLFIVERGMPGFERGRKLRKMGLHSQDTSELFFDNVK
                     VPKANVLGEPGQGFRYLTRHLAEERLIGACGYMASAQVAFDLTLDYVKERKAFGRAIG
                     TFQNSRFRLAELRAQLDALQTFVDQCVLQHNAGTLTVETAASAKLLTSELQGRMVDEG
                     VQLHGGAGYMEEYRICRMYTDARISRIYAGSSEIMKEIIGRSLGLDDRVKG"
     gene            557915..559300
                     /locus_tag="CNE_RS20670"
                     /old_locus_tag="CNE_2c05240"
     CDS             557915..559300
                     /locus_tag="CNE_RS20670"
                     /old_locus_tag="CNE_2c05240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_013952222.1"
                     /db_xref="GI:503718146"
                     /translation="MPFVFSRIAVGALLVLGVLARPAAILAAERPADPLPSADSADAA
                     GPCVPPPAGATLTLAQVRLDALRCNRDIIAARRGVEASQADIQIASQRPNPVLSLGVT
                     NINPHAGIGSGNLRSKTVDSTLRVDQLIETANKGGLRVDAARKASAAAGEVVQAVVVQ
                     QTAGAEQAFYEAVISQERVGVLREMLGLYDRTRQASETRLKAGDVSRAEVTKLQLDAL
                     RAQNDMRQAMADHSRDKAQLAQAMGVPGTLADNRLVPDWPPLDTPVPQVDPDTLQRRP
                     DVTAAEARLAAAAAARDLARAGRVPDVTVGAQAEHYPVSATNTNGSGNSYGVFLTIPL
                     YVRHRNGGEARRAEVDYYAALDERNRVLLEAGNEMERLRSQLEASRQSLRQMRDDVLP
                     AAESVAGSAEFAYGKGATGVLDLLDARRALRQTRLDAVSAQGDYAKALSAYRAALQTS
                     TTGTATTTSRP"
     gene            559355..560545
                     /locus_tag="CNE_RS20675"
                     /old_locus_tag="CNE_2c05250"
     CDS             559355..560545
                     /locus_tag="CNE_RS20675"
                     /old_locus_tag="CNE_2c05250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_041228800.1"
                     /db_xref="GI:752557568"
                     /translation="MSSVHFPAGLPARVAALSLCALALASCGKSEAPKADDEPKVSGN
                     TIQFPASVKTLPGIAGEAAKTGGERMLSLPGRLVWNEDKTVRVSTPFAGRVTEILVQP
                     GTTVKAGQPLASLTSPDFGVAQADARKAAADSAVAAKALARQRELYGAGIIAQKELEQ
                     AQADAARSAADLQRTQAALGQYGAAAGGAGAVNQRFPLRSPIDGLVVERNINLGMELR
                     PDQPPAAPLFLVTDPTTLWAQVDAGEADLSLFKPGVDVQLTTAAWPGETFSGTVIKIA
                     DYVDPTARSIKVRLMVPNPERRLKAEMFVTAKLPAASFKGIAVPSKAVFLAENRNYVF
                     VRTAANTFERRLVRVGVTLPGTTELLEGVKDGETVITDGNLYLQDILRDATAVNAARA
                     SEKK"
     gene            560559..563681
                     /locus_tag="CNE_RS20680"
                     /old_locus_tag="CNE_2c05260"
     CDS             560559..563681
                     /locus_tag="CNE_RS20680"
                     /old_locus_tag="CNE_2c05260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal transporter CzcA"
                     /protein_id="WP_013952224.1"
                     /db_xref="GI:503718148"
                     /translation="MISRIVSFALHQKLFVWLGLLIFVGGGLAAFKNLPIEAFPDVSD
                     IQVNVITLYPGRAAEEVERQVTIPIETALAGTPNAVRVFSHTQFGLSFMMVTFNDKAT
                     DVTARQQILERLRSVDLPDGVHPDLAPLSTAIGEIYRFRLTGKGYTAQELRTLQDWVV
                     EKNLRQVPGVADLVTIGGTIKQYEVNPNLARMRDAKISLSQLFTALQRANANAGGGAV
                     AHGRQQFLLRSLGSFRTSADIANVVVAENNGTPILVKDIADVRVGSAPPQGLMGQDNE
                     DDIVSGIVVMRKGENPSLVLEALKKRIDLLDDQILPKGVKIVPYYDRSTLIDKTLHTV
                     FGNLVEGALLVMAVLYLFLANVRAAAIVALIIPLALLSTFIGLTWVGIPANLLSLGAM
                     DFGIIVDGAVIVVENIFKRLGELKEQQIKDSKARLLAILQATTEVGRPTVFSMVIIIA
                     AHIPIFTLQRHEGKIFAPMAYTVTGALIGSLILSLTLVPLLCHLLLTKNIAHDDNFIV
                     RHCKRLYEPMLAWALDHKKLVVGAAVGLLVVTVGVGKFLGSEFLPELDEGSMWVSFDL
                     PASVSIDEARDQARLLRGVIRKTPEVNTTISKVGRPDDGTDPKLINTVEILVDLKPEK
                     QWRDGFNKRGIIGEIDKNLRQLPGIEPNFSQPVRDNILESISQIKGQIVIKVQSDSLE
                     HNKQVADQILANVQSVKGVMRAFIDRDGELPQYVLEFDRAQAARYGINVADVQDLMET
                     ALAGKAATELWEGEKHFSVAVRLKPSERALPNLPNIFMQTADGAQVPLSQLVTFRAAS
                     GAMNISRENGQRTTSIGIFIHDRDMGSVVKDMQALVAKNVKAEDVKISWSGEFENQER
                     AMARLSIVVPLSVLVIFLLLFNAFKSFKSATLIISNIPFALIGGVFALFLTGIPLSVS
                     AAIGFIALFGQAVLNGVVMVTYFNQLRDEGMPVRQAVLTGSMDRLRTVLMTALLAMLG
                     LFPMAISRAIGSETQRPLAIVIIGGLITATMLTLIVLPTLYEWMVGRNWPDEEGDKPD
                     ESRLTPSIAG"
     gene            563985..564593
                     /locus_tag="CNE_RS20685"
                     /old_locus_tag="CNE_2c05270"
     CDS             563985..564593
                     /locus_tag="CNE_RS20685"
                     /old_locus_tag="CNE_2c05270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952225.1"
                     /db_xref="GI:503718149"
                     /translation="MLKKWLTAAVCSMMVAAPAGFALAQMTAPATTTGTAATGTKADY
                     DAAVKQADADYKAASAKCDGMKANAKDVCKAEAKRDRDVAKAQAEARRDGTQKSMAKA
                     EKVKADRDYDVAKEMCDDKKGNDKDVCKKDAKAAHEKALMAAKVDKAAATGSRADVAE
                     ARADAKKDATDAAYKADKERCDALSGESKDKCQADVKAKYSK"
     gene            564696..564899
                     /locus_tag="CNE_RS20690"
                     /old_locus_tag="CNE_2c05280"
     CDS             564696..564899
                     /locus_tag="CNE_RS20690"
                     /old_locus_tag="CNE_2c05280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general stress protein CsbD"
                     /protein_id="WP_041228550.1"
                     /db_xref="GI:752557318"
                     /translation="MNWDQIEGKWEQVKGKVKEKWGKLTDDDIAQINGKRDQLAGRIQ
                     ERYGYTKERAEEEMKAWERDTRW"
     gene            565140..566558
                     /locus_tag="CNE_RS20695"
                     /old_locus_tag="CNE_2c05290"
     CDS             565140..566558
                     /locus_tag="CNE_RS20695"
                     /old_locus_tag="CNE_2c05290"
                     /EC_number="2.7.13.3"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952227.1"
                     /db_xref="GI:503718151"
                     /translation="MYAALPAFVSSIFLGYGLYVLVTKGVTRVSTSFFLLCVTTFAWQ
                     GTWVFLFQASHPDVALALARLGYLFILFLPTTFYHFIAEVTECRRERPLLLASYGLSL
                     VLAVLLLTTNQVVSGYYSYFFGDYPKAGPLHPLHLLQTVLVALRSAWLLVAARHNATA
                     ERRKRYKLCLVAVALYSLAAVDYAVNYGAAFYPPGVVFVAASLGILAVSVVRYDLMHP
                     YSLAATVAHEVRTPLATIRMQAQELARTWPQVLHGYQLAVQQGLYEDRMRPGQLERVS
                     SLVGAITREVDGTSTVIDMALASVTLERLDRSSFAPHGIADCVHAALERYPFQGEERG
                     CVQVRGIDQDWRFVGSDTLLVYVLFNLLKNALHAIRAAGGGHIDITGATEGQYHVIRF
                     RDTGPGIPADVMPRIFDPFFSTKAHGTGAGLGLAFCRRVIETFGGRIECESVPAVHTT
                     FTLRLPRFTAMADSRLRTSTAG"
     gene            complement(566610..567107)
                     /locus_tag="CNE_RS20700"
     CDS             complement(566610..567107)
                     /locus_tag="CNE_RS20700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA thioesterase"
                     /protein_id="WP_041228551.1"
                     /db_xref="GI:752557319"
                     /translation="MLMRDVIPQILNRGTAQLAPDAFETASHKTFHHAIDIYLKDSNA
                     FMNTYFARYFEWQGICRERWFHECIHDNLLAAGGVFVTKRAHQEYVEETFPFQRVDCY
                     LNTFQVRQCSAYLLFRFCVGGKPVSLGYQQIVFADREKRITRFPAGIIERVREYELVL
                     PALAS"
     gene            567413..568189
                     /locus_tag="CNE_RS20705"
                     /old_locus_tag="CNE_2c05310"
     CDS             567413..568189
                     /locus_tag="CNE_RS20705"
                     /old_locus_tag="CNE_2c05310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013952229.1"
                     /db_xref="GI:503718153"
                     /translation="MADTTSSELLSRSRQPVYLQLATIFRRQIESGAWRQGERIPSLE
                     ELCRQYGVARMTMHHALSMLDEEGLVERARGRGTFVRAPCQARRQVSLSTSWDEAVAV
                     GAQLDTEAMVESAGNVPLPADLGMPCPGERAADYHFLRRLHRLEGRPFAVGEVYIEAG
                     VFAREPEAFRQGASVPVLDRFPGLSVSTARQRLSIVAAGAESAAALALAVGAPVAELR
                     RFACVPGERGELIVYYARIEFPTEFVCLDFDLLAARPRPA"
     gene            568266..569810
                     /locus_tag="CNE_RS20710"
                     /old_locus_tag="CNE_2c05320"
     CDS             568266..569810
                     /locus_tag="CNE_RS20710"
                     /old_locus_tag="CNE_2c05320"
                     /EC_number="2.2.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314446.1"
                     /note="thiamine-pyrophosphate requiring enzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952230.1"
                     /db_xref="GI:503718154"
                     /translation="MNGAESLVKTLLANGVDTCFANPGTSEMHFVAALDRIPGMRCVL
                     GLFEGVVTGAADGYARMAGKPAATLLHCGPGLANGLANLHNARRAQTPVVNIIGDQAT
                     YHRPLDAPLTADTEGWARPVSVWTRTATQAASVGADASSAVQAACAAPGGVASLILPS
                     DVCWDAGGVVAAPLPPLAVPKVSPDAVQQAARVLRSGQPTLVVLGGSALREAPLADAH
                     RIAAATGARLISPMSNARVSRGSGRLAVDRVPYSGDVARDKLAGIRNVILVGAPAPVT
                     FFAYPGKSPRPYPEDAVIHVLARPEEDLAEALSRLADEVGARNAPLPAAAAPASVEPA
                     RGAVTSEAVARTLTALLPEQAIVVEESISFGRAFYPGTVHAAPHDWLQLTGGAIGEGL
                     PLAVGAAVAAPDRRVVALQADGSAMYTLQSLWTMAREQLDVTVVLLANRKYAILLGEL
                     AGVGANPGKTALDMLDIGNPDLDWVKLANGMGVEGAQARDMESFADLFRMANARKGPF
                     VIELVI"
     gene            569942..570334
                     /locus_tag="CNE_RS20715"
                     /old_locus_tag="CNE_2c05330"
     CDS             569942..570334
                     /locus_tag="CNE_RS20715"
                     /old_locus_tag="CNE_2c05330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013952231.1"
                     /db_xref="GI:503718155"
                     /translation="MPQQEAAVGPDKAYAEQLAAGQFRIQHCQDCKRHVFFPRNICPH
                     CGGDTLAWVAPKGSGTVYSTSVIRRKPEAGGDYNVVLVDLDEGVRMMSRVEGIAPASV
                     RIGMRVQARVAQGKEGEAALVVFDPVEG"
     gene            570339..571511
                     /locus_tag="CNE_RS20720"
                     /old_locus_tag="CNE_2c05340"
     CDS             570339..571511
                     /locus_tag="CNE_RS20720"
                     /old_locus_tag="CNE_2c05340"
                     /EC_number="6.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiolase"
                     /protein_id="WP_013952232.1"
                     /db_xref="GI:503718156"
                     /translation="MSLSNLRGSVAIVGVGQSGMGEAHGKTEMEILVEAAKAAVRDAG
                     LSMRDIDGIATASVGASMWVMPVAEYLGIKPKFVDSTMIGGSSFVSHMLPAMMALESG
                     QCDAVLVCYGSNQRTSTVGRAGISKVRAVLDPQPYEHPYSPLQPITSYALAAARHMHQ
                     YGTTREHLAEVAVAARKWAQLNPEAMMRDPLSIDDVLNARMVSDPLSVRDCCLVTDGA
                     GAYVMVRADRARDLAKPPVYVLGNATATWHRQISCMPDLTVTAAKESGERAFAMAGLK
                     PSDVDVAELYDAFTINTLLFLEDLGFCAKGEGGQFVSGGGIAPGGRLPVNTNGGGLSC
                     VHPGMYGMFITIEAVRQLRGECGERQVEGAEVAVVHGNGGTLSSQATAILGTAATV"
     gene            complement(572051..573310)
                     /locus_tag="CNE_RS20725"
                     /old_locus_tag="CNE_2c05350"
     CDS             complement(572051..573310)
                     /locus_tag="CNE_RS20725"
                     /old_locus_tag="CNE_2c05350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013952233.1"
                     /db_xref="GI:503718157"
                     /translation="MPRKTKTSQAADRELPAIPEDLIAHFVKGPMTAEAVQDASMAFK
                     KALIERALGAELGHHLGYQPGAERPAGTANQRNGKSAKTVLTEDGPLRVDIPRDRDGS
                     FDPILIPKHERRFTGFDDKIIAMYARGMTVREIQAFLAEQYGTEVSPEFISSVTDAVM
                     DEVTAWQARPLEVMYPVVFFDALRVKMREDGVVRNKAVYLALGVLPDGTRDILGLWIE
                     TTEGAKFWMKVFNDLKTRGTQDILIAVTDGLKGMEQALAAVFPNTTLQTCIVHLIRNS
                     LEYASWKERRAVAAALKPVYTAPTVEAALAELAAFEQGEWGKRYTPIAASWRRAWDQV
                     IPFFTFPPAIRKIIYTTNAIESVNAQLRKIIKTRGHFPSDEAATKLLWLALRNITGKW
                     GSSTHDWKAAMNQFAILYEERFTHPHR"
     gene            complement(573593..574003)
                     /locus_tag="CNE_RS20730"
                     /old_locus_tag="CNE_2c05360"
     CDS             complement(573593..574003)
                     /locus_tag="CNE_RS20730"
                     /old_locus_tag="CNE_2c05360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952234.1"
                     /db_xref="GI:503718158"
                     /translation="MEPLSFEFVTVEEAKKVLDGAPPLQAEPDWSGVRRAPSPEDTLL
                     SDVAMRWLASLPAEARPVELCRRYARIGNQLAALAANPAALHAFLVELLIDKRGGRQG
                     FPDGIAFELSRLHEYVVRLLPGLGGEQGWSELAD"
     gene            complement(574134..575195)
                     /locus_tag="CNE_RS20735"
                     /old_locus_tag="CNE_2c05370"
     CDS             complement(574134..575195)
                     /locus_tag="CNE_RS20735"
                     /old_locus_tag="CNE_2c05370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-D-glucanase"
                     /protein_id="WP_041228552.1"
                     /db_xref="GI:752557320"
                     /translation="MRRTLTGLTRWLLAGALACASLAAPAASAPVCKWADWDAFRQTL
                     LSADGRVIDASTENQATVSEGQAYGLLFALAANDRASFDKLLAWTENNLAQGDLIAHL
                     PAWIWGRLPPEQARSAGKAADSWGVIDANPASDADLWLAYTLLEAGRLWQERRFTALG
                     TLMARRILREETAVLPGLGRTVLPGTQGFKLSERRWRLNPSYVPMQVMRRLATLLPDE
                     PAWQQLVASSARLMLDTAPRGFSPDWVEYETGRGFLPDAQTQAESAYNAIRVYLWAGM
                     LASDAPQRAALLRAFTPLADYVAAKGFPPERVDTQTGQPGYYTQVLTLFGLGYLDGQF
                     RFARDGALVPAWETGCPAR"
     gene            complement(575629..576291)
                     /locus_tag="CNE_RS20740"
                     /old_locus_tag="CNE_2c05380"
     CDS             complement(575629..576291)
                     /locus_tag="CNE_RS20740"
                     /old_locus_tag="CNE_2c05380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952236.1"
                     /db_xref="GI:503718160"
                     /translation="MGKDLRSWRHLVLACGVAAVAACGDDHVPEVSGTAAVGAALAGA
                     TVQLRDAQGQVRNASTDAKGAFRLARVPGGALMVRCEGGLAQGEPNPLRLHGLVLGGR
                     TVNCSPLTELALWKLLGGPPGQAFDSFGQGRARDLSADAMAEAESSVLAALATGAGVD
                     IDPAAVPRRWHDTPLEAGNASDPHDAALDALRDAIADQASMDFMGEMVARGVCVADGT
                     CG"
     gene            complement(576303..577295)
                     /locus_tag="CNE_RS20745"
                     /old_locus_tag="CNE_2c05390"
     CDS             complement(576303..577295)
                     /locus_tag="CNE_RS20745"
                     /old_locus_tag="CNE_2c05390"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase"
                     /protein_id="WP_013952237.1"
                     /db_xref="GI:503718161"
                     /translation="MLRLRACLRLASLGIAAAALAAAASPAQALNVLLTNDDGCAAPG
                     ISAVRKALQDAGHRVITVGPASNQSGSGAAYAVPDGRTRLVVDPLAGSADTFCVHRVK
                     TTFVAGSALNATNPDYLGSGSPVDATAMGLKIVGPESSFVPDLVVSGANFGENLSDSI
                     PHSGTVMNVLFAARRGVPGIALSVGVDFAEARTGFGSTVAAFPKAGAFLARVIASLEA
                     TRTAGQPLLPVAHPLSINYPIVAGGTPAGVRLTTPGTVDSFTTAYKRNADNTVSIDVG
                     APETELAALARIAETPAFLAKFITISPLDVDFRPTPLARGLFNRSRRELATLAP"
     gene            complement(577388..578413)
                     /locus_tag="CNE_RS20750"
                     /old_locus_tag="CNE_2c05400"
     CDS             complement(577388..578413)
                     /locus_tag="CNE_RS20750"
                     /old_locus_tag="CNE_2c05400"
                     /EC_number="4.1.3.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311906.1"
                     /note="catalyzes the formation of pyruvate and
                     acetaldehyde from 4-hydroxy-2-ketovaleric acid; involved
                     in the degradation of phenylpropionate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hyroxy-2-oxovalerate aldolase"
                     /protein_id="WP_013952238.1"
                     /db_xref="GI:503718162"
                     /translation="MVQRITLHDMTLRDGMHPKRHQISLEQMKGIARGLDAAGVPLIE
                     VTHGDGLGGASVNYGFPAHSDEEYLRAVLGELKQARVSALLLPGIGTVDHLRMAHEIG
                     VHTIRVATHCTEADVSEQHIGMARKLGMDTVGFLMMAHMAPVQTLVQQALLMESYGAN
                     CLYITDSAGHMLPHDVTEKLGAVRQALRPETELGFHGHHNLAMGVANSLAAIACGASR
                     IDAAAAGLGAGAGNTPMEVLVAVCERTGIETGVDVYRIADVAEDLVVPIMDHPIRIDR
                     DALTLGYAGVYSSFLLFAKRAEAKYRIPAREILVELGRQRLVGGQEDMIEDTAITLAR
                     KRGLLVP"
     gene            complement(578424..579332)
                     /locus_tag="CNE_RS20755"
                     /old_locus_tag="CNE_2c05410"
     CDS             complement(578424..579332)
                     /locus_tag="CNE_RS20755"
                     /old_locus_tag="CNE_2c05410"
                     /EC_number="1.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Acetaldehyde dehydrogenase 2"
                     /protein_id="WP_013952239.1"
                     /db_xref="GI:503718163"
                     /translation="MNKIRCALIGPGNIGTDLLYKLRRSDILEPVWMVGVEPSSEGLA
                     RARELGLKTTSDGIDGLLPHLEADDIRIAFDATSAYVHAEHSAKLTARGVRVIDLTPA
                     AIGPFCVPPVNLDAHIGSNEMNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSR
                     SVGPGTRRNIDEFTRTTAGAIEAVGGARQGKAIIVINPAEPPLIMRDTIHCLTDDAPD
                     VAAITASVHDMIAEVRKYVPGYTLKNGPVFDGKRVSIFLEVEGLGDYLPKYAGNLDIM
                     TASAARTAECIAAAMRAGSAQEAANA"
     gene            complement(579386..580168)
                     /locus_tag="CNE_RS20760"
                     /old_locus_tag="CNE_2c05420"
     CDS             complement(579386..580168)
                     /locus_tag="CNE_RS20760"
                     /old_locus_tag="CNE_2c05420"
                     /EC_number="4.2.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="WP_013952240.1"
                     /db_xref="GI:503718164"
                     /translation="MNADLITTLSNELHHALVTRSPVPPLSGRGLGLDVHAAYRIQQG
                     FIAHRLAAGDCITGKKIGVTSEAVQQMLDVHQPDFGILLQSMQYAAGQPIPTDTLIQP
                     RAEGEIAFFLRRDLRGPGVTRDDVLDATEAVAACFEIVDSRIRDWRIRIEDTVADNAS
                     CGVYVLGEERVCPHALDLGACAMTLEKNGECVATGLGSAALGHPADAVAWLANTLGSF
                     GIPLLAGETILSGSLAALIPVQAGDRLSMHITGIGGCSAMFC"
     gene            complement(580236..581798)
                     /locus_tag="CNE_RS20765"
                     /old_locus_tag="CNE_2c05430"
     CDS             complement(580236..581798)
                     /locus_tag="CNE_RS20765"
                     /old_locus_tag="CNE_2c05430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952241.1"
                     /db_xref="GI:503718165"
                     /translation="MHHPPSGPLKRRNRLRPIAAAAALAALLATPARAGETIDLGHDT
                     TLDYSVTASYGAAVRTGHQSNTLLSPANINGDDGNRNFKRGDMIANRVSLLGEAHVKH
                     DAFGALVRGSVFQDWAYSGTNSNNAPFTVNHSGPFNQFTGSAQDYHEHRAQLLDAYVY
                     GATPIGDTQLSFKLGNQVVAWGESLFFANIAGAQGPADATKAFVPGAEVKDILLPVPQ
                     ASLQLQVTPAFSVMGYYQFTYKPNQIFAPGSYFSTSDVVGPGAEFIIGPGFNIPRGPD
                     IRPSDWGQWGVGARFRVFESTEIGLYQLRYHDKNPSVVTSLFPTLQYQQKFYGGINLT
                     GASFSTQVLGANVAGEVSYKDGVPMLVDVAGSPTATRGRALQGQLSAIYSVGPTFLAD
                     SQTLLGEVAYLHVLGVDPVMGFGKLSNTRNSAAFQVGWSLTYNNVFDGWDMSVPLTYA
                     QQFSGQSAVAGAFGTLMGYGDKRASVGLTFKYLNNLELNLTYAAFIGGANIANRPLAD
                     RDYVAFNAKYSF"
     gene            complement(581938..582726)
                     /locus_tag="CNE_RS20770"
                     /old_locus_tag="CNE_2c05440"
     CDS             complement(581938..582726)
                     /locus_tag="CNE_RS20770"
                     /old_locus_tag="CNE_2c05440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_041228553.1"
                     /db_xref="GI:752557321"
                     /translation="MTGFNYTGQTVLVTGGMRGIGRAIGEAFLRAGAQVFVCGRTAPA
                     DDSELPAADGRSARFIPADIRDIEQADAMLAQIAQASPTLDVVIHNAGGSPFALVAEA
                     SPRLLESVIRLNLVAPLQLAQRANARMQQQAGGGTQLFVGSVSALRPSPGTAAYGAAK
                     AGILNAVRTLAVEWAPKVRVAAVSPGMVLTDTSQQQHYGDPEALRTMAATVPLGRLAH
                     PDDIAGACLFLASPQASYVSGANLVIDGGGERPAFLNAASLNRS"
     gene            582853..583725
                     /locus_tag="CNE_RS20775"
                     /old_locus_tag="CNE_2c05450"
     CDS             582853..583725
                     /locus_tag="CNE_RS20775"
                     /old_locus_tag="CNE_2c05450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_041228801.1"
                     /db_xref="GI:752557569"
                     /translation="MSATSQHTPLSPHPNLPVGRFTTTSTGLRLHCLDSGSGEPLVFI
                     HGSGPGASGHSNFRHNAPAFAEAGFRTVVVDLPGYGLSSKPDDVEYTLDFFVAALREQ
                     LLALELPRCVLVGNSLGGAIALQYALDFPEHVSRLVMMAPGGVEERETYFQMEGIQRM
                     VSLFTGGHMNPDTMRQLLQLLVHDASLVTDALVDERMAVCSEQPREVLATMKVPNLTA
                     RLGEIRCPVLGFWGTEDHFNPASGATKFLAGCADARFVMINRCGHWVMVEHAAYFNRE
                     CLGFLADTAQGGAA"
     gene            583765..584550
                     /locus_tag="CNE_RS20780"
                     /old_locus_tag="CNE_2c05460"
     CDS             583765..584550
                     /locus_tag="CNE_RS20780"
                     /old_locus_tag="CNE_2c05460"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta-hydroxysteroid dehydrogenase"
                     /protein_id="WP_013952244.1"
                     /db_xref="GI:503718168"
                     /translation="MEYPYSLFDLRGEVAAITGAARGIGAETARVLAAAGAKVAVLDV
                     LEADGKATAEAICAEGGEAAFWKLDVTSESDVARVFAEIAACFGGLGILVNNAGIEGP
                     NAPTHELALEQWQQVMAVNVTGTFLCTKHAIGHMERTGGGAIVNVSSMYGIAGGPDVP
                     PYHASKAAVRMMAKTDAMLYAGKGIRANSIHPGYIRTPMLEHVAQASGQSEALFDYLG
                     GQTPAGKVGQPRDIAAGILYLVSDAGRYVTGAELVIDGGYTAR"
     gene            584569..584946
                     /locus_tag="CNE_RS20785"
                     /old_locus_tag="CNE_2c05470"
     CDS             584569..584946
                     /locus_tag="CNE_RS20785"
                     /old_locus_tag="CNE_2c05470"
                     /EC_number="5.3.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="steroid delta-isomerase"
                     /protein_id="WP_013952245.1"
                     /db_xref="GI:503718169"
                     /translation="MPDSAAMKATLLAYVDRFNAGDAQGVAALYADDATVEDPVGAQP
                     IAGKPAILAFYQHTTALGARLEVVVPPRGSHGDSAALTFAVRARLEGRPARIDVTDIM
                     TFGADGRIRSMRAHWGPDDVHFL"
     gene            584960..585613
                     /locus_tag="CNE_RS20790"
                     /old_locus_tag="CNE_2c05480"
     CDS             584960..585613
                     /locus_tag="CNE_RS20790"
                     /old_locus_tag="CNE_2c05480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013952246.1"
                     /db_xref="GI:503718170"
                     /translation="MARHTREDAAVTRARILASALQLIRHRGLHCVTVDDVARAIGMT
                     RGAVYGHFHSRTELLGALLSCAEADFTARLALLAQGRAGSGPGTLEQALAALLHGDDL
                     ARHVSLLAALLQHKCGDDCELCPLRARVLTGVETLRATFAGLLPAPGLASLLVAHLWG
                     LLSAHAMHLAPSGLSGCAAALARLYQGPDVPPHPSLSAIPSCRPDATFDPALLRDTP"
     gene            585701..585937
                     /locus_tag="CNE_RS20795"
                     /old_locus_tag="CNE_2c05490"
     CDS             585701..585937
                     /locus_tag="CNE_RS20795"
                     /old_locus_tag="CNE_2c05490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952247.1"
                     /db_xref="GI:503718171"
                     /translation="MKRLGFRWAAGLAGAGAAMGAAWAIAVGGDLATAHGSQGEMPAV
                     SVASADAAQDHCNDACVRSRGTAALVVLSQRPPQ"
     gene            complement(585986..586465)
                     /locus_tag="CNE_RS20800"
                     /old_locus_tag="CNE_2c05500"
     CDS             complement(585986..586465)
                     /locus_tag="CNE_RS20800"
                     /old_locus_tag="CNE_2c05500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase"
                     /protein_id="WP_013952248.1"
                     /db_xref="GI:503718172"
                     /translation="MAKAENLVTSIQVEIDAPVALVWEVLTDFARYAEWNTFCPGLET
                     TGRLGDMVYMQVRIPGTDQVIPVNEYLVAWEPERLLSWEQRPTDENKDAARRDQYLEA
                     AGPGRTRYFTTDLFLGLNAETIMREHGAWVKQGFDQVARDVKARAEALNAQRQAGRR"
     gene            586800..587174
                     /locus_tag="CNE_RS20805"
                     /old_locus_tag="CNE_2c05520"
     CDS             586800..587174
                     /locus_tag="CNE_RS20805"
                     /old_locus_tag="CNE_2c05520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lyase"
                     /protein_id="WP_013952250.1"
                     /db_xref="GI:503718174"
                     /translation="MFDHVKFGVSDYAASKAFFLKALEPLGVAVASEGPPTYGVELCP
                     KGKASLCLFQTEEKPAHLHLAFTAENRQQVEAFHRAALEAGAKDNGAPGLRPHYHANY
                     YAAFVIGPDGHNIEVVCHQPEA"
     gene            complement(587194..587904)
                     /locus_tag="CNE_RS20810"
                     /old_locus_tag="CNE_2c05530"
     CDS             complement(587194..587904)
                     /locus_tag="CNE_RS20810"
                     /old_locus_tag="CNE_2c05530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952251.1"
                     /db_xref="GI:503718175"
                     /translation="MNTTAKLIPSTELAQQNPVRFPNESAEYRKARNALLAEEIELRR
                     HIERVAEQRRGLPAGGEVAKRYTFQGERGPVTLAELFGDKDTLVIYSYMFGPQREQPC
                     PMCTSVMASWDHKVPDIEQRVALAMIARSPIDRLVAAKKARGWTKLKVYADVDGDFTR
                     DYVSAEDADVPAYSVFTRRDGKIRHFWSSEMYALSADPGQDPRGAPDLDPLWTLLDTT
                     PEGRGADWYPKLGYPEGK"
     gene            588246..589202
                     /locus_tag="CNE_RS20815"
                     /old_locus_tag="CNE_2c05540"
     CDS             588246..589202
                     /locus_tag="CNE_RS20815"
                     /old_locus_tag="CNE_2c05540"
                     /EC_number="1.1.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952252.1"
                     /note="Catalyzes the reduction of hydroxypyruvate to form
                     D-glycerate, using NADH as an electron donor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate dehydrogenase"
                     /protein_id="WP_013952252.1"
                     /db_xref="GI:503718176"
                     /translation="MKIVFLDRSTISPQTTLRALPFPHELELYGETADEDVAARIAAA
                     DVVIINKVKLDARQLEQAPNLKLIAIAATGTDVVDLQACAARGIVVSNIRNYAVHTVP
                     EHTFALIFALRRSLAAYHDAVRRGRWQESGSFCFFDYTIKDLHGSVLGIIGDGVLGQS
                     VARMASALGMRPLFAAHKGREGMGPLYTPFDEVLRRSDIITLHCPLVAQTRNLIDAAE
                     FSKMERRPLLINTARGGLVNEAALVEALQSGMVAGAGFDVATQEPPGAEHPFHQLKDA
                     PNFILTPHVAWASDEAVQGLADQLIDNICAFAQGAPRNVVGG"
     gene            589222..590386
                     /locus_tag="CNE_RS20820"
                     /note="glycerate kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(590434..591402)
                     /locus_tag="CNE_RS20825"
                     /old_locus_tag="CNE_2c05570"
     CDS             complement(590434..591402)
                     /locus_tag="CNE_RS20825"
                     /old_locus_tag="CNE_2c05570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952255.1"
                     /db_xref="GI:503718179"
                     /translation="MKRMTIAAAALAALAAAAPAHSANAYPSKPVTLVVPSAPAGSTD
                     IVARLVGEQLQAALGQPVVVDNKPGASGNIGTEAVARAAPDGYTLLLQYSGYHVGNPA
                     LFPQIRWKPSNFVPVALVMRAPHVIAVSGKLPVTSIAELVAYGKSNGKGLFYASSGNG
                     SIQHIAGEMLARQTRVPMTHVPYKGAGPVITDLISGQVDMFITTPPSVIGHVQAGKIK
                     ALAYAGPKRHPSMPNVPTTAEAGLPGYEVESWFALFAPANTPPAIVERLSQEVKKIVA
                     SDTYRKKIEEQGAFAAYMGPQELGKFIDQELASWSRVVKASNIRAD"
     gene            complement(591441..591826)
                     /locus_tag="CNE_RS20830"
                     /old_locus_tag="CNE_2c05580"
                     /note="lactoylglutathione lyase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(591846..592799)
                     /locus_tag="CNE_RS20835"
                     /old_locus_tag="CNE_2c05590"
     CDS             complement(591846..592799)
                     /locus_tag="CNE_RS20835"
                     /old_locus_tag="CNE_2c05590"
                     /EC_number="4.1.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /protein_id="WP_013952257.1"
                     /db_xref="GI:503718181"
                     /translation="MTARKVYIHEVATRDGFQNEARFVETDDKVALIDALSACGYARI
                     EVTSFTSPRAIPALRDAEAVMHRIARREGVVYTVLVPNVRGAERALSCQVDEVNLVMS
                     VSESHNRTNLRMSREQSFAQLADVIRVVRETPTAINISLSTAMGCPMEGDVPLENVLG
                     WMQRFADLGAHGVTLCDTTGMAFPSQVARLCEAARRQFPSLALTLHFHNTRGLALANT
                     LAALDQGIDRFDASLGGLGGCPYAPGATGNVCTEELVHMLELDGYDTGVDLAAILDAA
                     ARLPGLIGHDVPSQLLKAGRRLDLHPMPAADAIPEQRAFQP"
     gene            complement(592813..594015)
                     /locus_tag="CNE_RS20840"
                     /old_locus_tag="CNE_2c05600"
     CDS             complement(592813..594015)
                     /locus_tag="CNE_RS20840"
                     /old_locus_tag="CNE_2c05600"
                     /EC_number="5.1.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013952258.1"
                     /db_xref="GI:503718182"
                     /translation="METSKSKPLAGVRVLELGQLIAGPFAARMLAAFGAEVIKVEPPG
                     TGDPLRKWRLLHEGTSVWWEAQSRDKQSVTLDLRTAQGQEVVRKLAAQSDVLIENFRP
                     GTLENWGLGWDSLRAANPGLVMLRVSGYGQTGPYRDRPGFGVIGEAMGGLRHLSGEPG
                     RTPVRVGVSIGDSLSALHGVIGILLALRHREQNGGQGQVVDVALYESVFSMMESLLPE
                     YSVFGTVRQAAGSSLPGIAPTNAYRCADGKYVLIAGNGDGIFRRLMDMIERPDLRDDP
                     ALAHNDGRVSQVAMLDAAIGEWAAQRSLEAALDALNGARIPAGKIYDIADIASDPHYR
                     ARDMILDAQLPDGTPVQLPGIVPKLSATPGALPNPAPALGQHTDAVLEGLGIGAAQRE
                     AWRAAGII"
     gene            594295..595212
                     /locus_tag="CNE_RS20845"
                     /old_locus_tag="CNE_2c05610"
     CDS             594295..595212
                     /locus_tag="CNE_RS20845"
                     /old_locus_tag="CNE_2c05610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013952259.1"
                     /db_xref="GI:503718183"
                     /translation="MINPAHFDLQSLRVFQLVAQCGGLTQAANKSHMTLSALSKRIAD
                     LERTVGCALFLRVRRGLELTPAGHELVQHARMVLDKVNQMAGEMSDFATGVRGHVKVW
                     ANTSAVIQFLPHDLASFLVSQPLIRISLEERLSQDVVVALLSGETDIGVFADNVPAYD
                     IRKSVYRRDRLVVLVPAGHPLAGRSEVSFDETLEYDFVGLNQGSSLLQRLTAAASALD
                     KVVRLRIQVSSFDAICRMIEAGLGIGVLPDGAVRPELLGAGLHAVYLSDAWASRILWL
                     GVRDEAGLLPEARTLLEHLRAAGSASASC"
     gene            complement(595311..596222)
                     /locus_tag="CNE_RS20850"
                     /old_locus_tag="CNE_2c05620"
     CDS             complement(595311..596222)
                     /locus_tag="CNE_RS20850"
                     /old_locus_tag="CNE_2c05620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952260.1"
                     /db_xref="GI:503718184"
                     /translation="MHLKHLKHLLMVADMASFSQAAQRLHLTQSALSRSIQTLEDELG
                     GRLIDRHGKRNVLTPLGELIANRARRIVFEEAELHRSVELFHHHHLGAIRVGLGAGPG
                     AVLATPFLRFMARHHPGIQVSVSLGTSDALMIQLRQRSLDAVVVEVSSVAPATDLRHE
                     LLNALQGRFICRTGHPLVQQAAGGDAVTFDDVMRYPLASAPLSTEVARNLVKRFGPRA
                     DPEHCLSLRCENVRSLVEAVLDSDAILFSIVAAVRAEIAAGKLCELDTTPAVDDGPRY
                     AFFTLAGRTEAPSMEIFRKFMDEHLRD"
     gene            596337..597335
                     /locus_tag="CNE_RS20855"
                     /old_locus_tag="CNE_2c05630"
     CDS             596337..597335
                     /locus_tag="CNE_RS20855"
                     /old_locus_tag="CNE_2c05630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952261.1"
                     /db_xref="GI:503718185"
                     /translation="MTRFKNVGRRWLGGLVAALLFAGLAPAHGFPDRPVTLMVPFPAG
                     GLSDVVARNLNGPLARQFGQPVIVENLGGAGGAIAAQKVLHAPADGHLLLQAGPGELI
                     TTPLANAAIKFRSEDFRLVHMVGAVDLAILVRRDLPVKDVDELAAYAAQAAKAGKPLT
                     YASVGIGSLYHLLGAHMSQTIGAPMTHVPYKGGAPVIQDLVGGIVDIFISPFGKPDIE
                     RMRTGQVRMLAVLSPTRVDAVKSVPSVNESKALRGFNYSTWAGIFVKKDTAEPVVQAV
                     HNAIVHTLADPSVRASLDTANLPASKPVSLAESQKAYQQSIEQYRGIARAIGLQPQ"
     gene            597343..598518
                     /locus_tag="CNE_RS20860"
                     /old_locus_tag="CNE_2c05640"
     CDS             597343..598518
                     /locus_tag="CNE_RS20860"
                     /old_locus_tag="CNE_2c05640"
                     /EC_number="3.5.1.32"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010810229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013952262.1"
                     /db_xref="GI:503718186"
                     /translation="MHPILAALRDSAEEFVAVRRDLHRHPELGFEEHRTSDIVASLLA
                     EWGYEVERGLGTTGVVARLRRGTGNRSLGIRADMDALPIEEATGLPYASCHPGVMHAC
                     GHDGHTTMILCAAKYLARRGGFSGTLNLIFQPAEEGLGGAKKMMEDGLFRKYPCDAVF
                     AMHNVPGTASGRLLLREGAAQASADNVTITLEGVGGHAAIPHHAADPVVAGASIVMAL
                     QTIVARNVDPLQAAVITVGAFQAGTVSNIIPSHAVLRLSVRALDRDVREQIEQRVRDL
                     VSAQAQSYGVTAQVDYQRGYPVLVNTPAETAFASQVALELLGPSHVNCQASPIAASED
                     FAFMLDAVPGCYLWIGNGEGGKVGGCSVHNPGYDFNDGNIAVGAAYWALLCERFLVD"
     gene            complement(598598..600073)
                     /locus_tag="CNE_RS20865"
                     /old_locus_tag="CNE_2c05650"
     CDS             complement(598598..600073)
                     /locus_tag="CNE_RS20865"
                     /old_locus_tag="CNE_2c05650"
                     /EC_number="6.3.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_013952263.1"
                     /db_xref="GI:503718187"
                     /translation="MGMVSIEPGSYHVAPPQNPGEVIDLIRTHAIQVVDLRFTDLPGV
                     WQHFSITLPEVNDDLFSAGIGFDGSSIRGFQEIHESDMLVRPDPATAFIDPFCAAPTL
                     ALICDVLDPVLHQPYSRDPRHIARKAELYLRQTGLATVCYLGPELEFFIFDSIRFGQD
                     QHSGYYHVESAEGEWTSGRDEGAYGGGNLGYKQRYKGGYFPVPPSDTLQDIRSEIVLA
                     LMQAGIQVEVHHHEVATAGQNEIDMRFAPLMRMADNVMMYKYICKNVARRHGKVATFM
                     PKPLFADNASGMHCHQSLWRDAENLFYDKNGWAQTSQMCRWYIGGLLSHAPALMAFCA
                     PSTNSYKRLVPGYEAPVNLAMSQRNRSAAARIPMVSDSPSARRVEFRCPDPSANAYLA
                     FSAMLLAGLDGIENQTDPGDPLDKNIYDLPPEEAARIRQVPGSLEESLCALEADSAFL
                     RKGDVFTEDLISTWIDYKRTREIDTLKVRPHPWEFQLYFDI"
     gene            complement(600224..600703)
                     /locus_tag="CNE_RS20870"
     CDS             complement(600224..600703)
                     /locus_tag="CNE_RS20870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylacetic acid degradation protein"
                     /protein_id="WP_041228554.1"
                     /db_xref="GI:752557322"
                     /translation="MEYRYGLASPADVANMNGRAILQAIVDGHLPQPPISQVLDFWLV
                     EVGDGFAAFEGEPSSRLLNPMGSVHGGWPLTLIDSAAACAANSLLPAGTGYTTVETKG
                     NFSRPIKPDTGRVRVEGRVVSHGRQIITAEARVLARDGRVLAHGTSTLLVLSPAREQ"
     gene            600772..601230
                     /locus_tag="CNE_RS20875"
                     /old_locus_tag="CNE_2c05660"
     CDS             600772..601230
                     /locus_tag="CNE_RS20875"
                     /old_locus_tag="CNE_2c05660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013952264.1"
                     /db_xref="GI:503718188"
                     /translation="MEKRRQGARSLRADAAAVLDVDLGWWSRLLARRITAELDEALAS
                     SGLSSTQFGLMCLIASATDDTLGSLAQRAGLNQSTMSRNVDQLVSTGLVEVVTSEADR
                     RRRAVWLTEAGAFKLQQALALWQPAHRALRQKLGSELHDMVGEVAARLAE"
     gene            601310..601600
                     /locus_tag="CNE_RS20880"
     CDS             601310..601600
                     /locus_tag="CNE_RS20880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015767950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228555.1"
                     /db_xref="GI:752557323"
                     /translation="MYKGLLVVATVAAAFIYYKTHAPLVNPVAQAEPQQIEVSAVAAT
                     AEPAFRCEGKQHCSQMASCAEARFYLKNCPAVKMDGDGDGIPCETPPLQCMF"
     gene            complement(601696..602664)
                     /locus_tag="CNE_RS20885"
                     /old_locus_tag="CNE_2c05670"
     CDS             complement(601696..602664)
                     /locus_tag="CNE_RS20885"
                     /old_locus_tag="CNE_2c05670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013952265.1"
                     /db_xref="GI:503718189"
                     /translation="MDLVDIPAKSREATILELRDFSRRLVRELGFMRATLADSDLAPS
                     AVHAIMEIGAQPGISAKDLGNILRLDKSNTSRQVARLEAGGLVERKTASEDARSSELY
                     LTEAGQKLRKKIDRFATDQVSNALRRMVPADQQALVRSLALYADALTQGNAVKTAPAD
                     AVPGRILEGYQPGCIGDVASLHARFYSEHWGFGAFFEKKVATELAEFIGKMPADDKAL
                     WLYAENGRSLASLAIDGDDEQGIAHLRWFIVDDTLRGSGVGRQLMSHAMKFVDERYRE
                     TYLWTFKGLDAARHLYESFGFQLVDESEGTQWGTRVTEQRFSRCLA"
     gene            602892..603494
                     /locus_tag="CNE_RS20890"
                     /old_locus_tag="CNE_2c05680"
     CDS             602892..603494
                     /locus_tag="CNE_RS20890"
                     /old_locus_tag="CNE_2c05680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006158164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_041228556.1"
                     /db_xref="GI:752557324"
                     /translation="MESAADAHSVTMQIPAIVPAKTALVVMHYQTDILALFPSVAPAL
                     LSNTRKLCDAARARGVSVYFAKIHFAPGYPEVSPLNRNGQGIKQLGLFVDDQISPELG
                     QQATEPLIIAHRASVFFGTDLQVRLSAQGIDTLLMVGIASTGVVLSSVAYASDADFRL
                     FTVKDCCSDPDQVVHDHLFSTAFDSRTTVLSLADALRLLA"
     gene            complement(603540..603980)
                     /locus_tag="CNE_RS20895"
                     /old_locus_tag="CNE_2c05690"
     CDS             complement(603540..603980)
                     /locus_tag="CNE_RS20895"
                     /old_locus_tag="CNE_2c05690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_013952267.1"
                     /db_xref="GI:503718191"
                     /translation="MTDDAVQLANLLYIYAERMDAGDLPGVAALFEHAEIETGDAVQR
                     GSAAMLKLWQAYVKLHADGTPRTRHVISNPIIEIAPDRLTATVRSYYTVLQATDRIAL
                     QVIAAGRYHDAFEKVEGRWRFSRRNYAVLDLRGNLTDHLLVPSA"
     gene            complement(604059..605198)
                     /locus_tag="CNE_RS20900"
                     /old_locus_tag="CNE_2c05700"
     CDS             complement(604059..605198)
                     /locus_tag="CNE_RS20900"
                     /old_locus_tag="CNE_2c05700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_041228557.1"
                     /db_xref="GI:752557325"
                     /translation="MLPDPLPAAELSALLAQLYQGPTEAVPWAGFLESVRQRLGATFV
                     TLVLRHPATDRPGLIVNASDYGPHLPGEPSYSEQYYALCPFLDLHPDRLFSADELFGE
                     AGWLAHPFYTQYLQPLGLRYILAANLVTPDGVECALFISRTDAGQDFGEADKALLHGL
                     LPHLKRAVDLHAALDVLASERSLYADAVDRLQVGTVILDEHGRTIRTNDVAGRLLQAR
                     DGLYLSDGALHAHCPVENRRFRKILEGAAQAHALAAPRSEVTTLSRPAAPTPLSVLVR
                     PIPLSYRSEDKSRRPAVAVFIRDPAGSPRNTHANLRKLFHLTPTEIELALLMVDGLTL
                     DEAAMRLGVKKNTARAHLRGIFAKTGATRQAVLVKMLLSSVVGMG"
     gene            complement(605452..607386)
                     /locus_tag="CNE_RS20905"
                     /old_locus_tag="CNE_2c05710"
     CDS             complement(605452..607386)
                     /locus_tag="CNE_RS20905"
                     /old_locus_tag="CNE_2c05710"
                     /EC_number="2.7.7.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952269.1"
                     /note="in Rhizobium meliloti this protein is involved in
                     the synthesis of nodulation factors that are active on the
                     roots of alfalfa; catalyzes formation of activated sulfate
                     intermediate; converts ATP and sulfate to diphosphate and
                     adenylylsulfate and then ATP and adenylyl sulfate to ADP
                     and 3'-phosphoadenylyl sulfate; the activated intermediate
                     is transferred to the nodulation factors by NodH; may
                     interact with NodP and NodQ; similar to the CysD and CysN
                     proteins from EScherichia coli involved in cysteine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylylsulfate kinase"
                     /protein_id="WP_013952269.1"
                     /db_xref="GI:503718193"
                     /translation="METLIDTAPALAQDAAQATGTSGEIAHYLRAQQSKSLLRFITCG
                     SVDDGKSTLIGRLLYESKMLFEDQLAQLEADSKKMGTQGQNLDFALLVDGLAAEREQG
                     ITIDVAYRFFATDKRKFIVADTPGHEQYTRNMVTGASTADLAILLVDARRGVQTQTRR
                     HSYLVATLGIRRVVLAVNKLDMVDYSREVHTRIENEYREFARQIGLTDITCIPMSALR
                     GDNITEPSANTPWYHGPTLMAHLENVPIDNAPVQGESFRLPVQWVNRPNLDFRGFAGT
                     VSAGEIRRGDRVRALPSGRESRVAGIVGAAGACEHAMRGQAVTLTLEDEIDISRGDVL
                     ACPEDPPAVADQFEATLVWMNEDAMLPGRPYLLKLGTRTVGVTVAQPKYKVNVNTLEH
                     LAARTLELNEIGVCNLHLDQPVAFDPYARNRELGGFIIIDRLSNNTVGAGMLRFALRR
                     AQNVHWQAIDVDRRAHAALKHQSPRIVWFTGLSGAGKSTIANLVEKRLHTLGHHTYLL
                     DGDNVRHGLNKDLGFAEADRVENIRRVAEVARLMLDAGLIVLVSFISPFRSERDMARA
                     LAGNGDFVEVFIDTPLAVAEQRDPKGLYRKARRGELKNFTGIDSPYQPPERPEIRIDT
                     TVDTAEQAAERIVAWLREKP"
     gene            complement(607386..608282)
                     /locus_tag="CNE_RS20910"
                     /old_locus_tag="CNE_2c05720"
     CDS             complement(607386..608282)
                     /locus_tag="CNE_RS20910"
                     /old_locus_tag="CNE_2c05720"
                     /EC_number="2.7.7.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011297696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit 2"
                     /protein_id="WP_010814009.1"
                     /db_xref="GI:498513580"
                     /translation="MLTHLEQLEAESIHIMREVVAECENPVMLYSIGKDSAVMLHLAM
                     KAFHPARPPFPLLHVDTTWKFGEMIAFRDQTAARLGLDLRVHVNPEGLARNISPHEHG
                     SAVHTDVWKTQGLKQALDHYGFDAAFGGARRDEEKSRAKERVFSVRTAQHRWDPKMQR
                     PELWRQYNTRKRKGESLRVFPLSNWTELDIWQYIYLNDIPIVPLYYAKERPVVERDGT
                     LIMVDDERLPLRPGETPQLRKVRFRTLGCYPLTGAIESEADTLGGIIQEMLLATTSER
                     QGRLIDSDSAGSMEKKKQEGYF"
     gene            608495..609613
                     /locus_tag="CNE_RS20915"
                     /old_locus_tag="CNE_2c05730"
     CDS             608495..609613
                     /locus_tag="CNE_RS20915"
                     /old_locus_tag="CNE_2c05730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952270.1"
                     /db_xref="GI:503718194"
                     /translation="MANSAEEQLLCGQTWAEFCEVLKRSGQQILRPEAPADALTRAEG
                     FRYLSRLLRIALEMHVEFADPAFPDFFSPSHETAKIGADNPDNLYRYARLDGGAEYRI
                     RGRRGTVAYLSFGTQKGGYETDGRMVQTGFLDSNKLAVAADGSFEIVLSARQHEGNWV
                     RMEPGTNALVVRQTFMDRKAETPAELHIERLNGSDKPPVLDAERLHGGLLRAAGFVEG
                     TARIFADWAQGYGGHVNALPPADQAVCQAAGGDPNIFYYHSCWALADDEALVVEVDRV
                     PACDFWNFQINNYWMESLDYRYHDICLNKHSARLDASGGVTVILSARDPGLPNWLETA
                     GHRNGTMCWRWVGAAQPVHPRTRVVKLESLRNECRENV"
     gene            609610..610803
                     /locus_tag="CNE_RS20920"
                     /old_locus_tag="CNE_2c05740"
     CDS             609610..610803
                     /locus_tag="CNE_RS20920"
                     /old_locus_tag="CNE_2c05740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952271.1"
                     /db_xref="GI:503718195"
                     /translation="MNTIASEHTTVLDVERLLAQASEQAGGLTDFGPGDYREALEVLS
                     DSLAREAGLSPQGAQMLQGKLQAQLVNRLVIQDYCRRHPEILEEGVDDPLVIVGLPRT
                     GTTLLQRMLATDARFHSAAWWETRYPAPLPGEDVRDAGRRIGLAREEVAQMIRFIPDI
                     LAIHPLDAMAADEEFMLMEHSFLCAMDSYANVPSYTDWLARHDRTQVYAYLKTMLQFL
                     QWQKRQRGEAPAQRWVLKTPQHLHTLEILFRVFPGAQVVLTHRDPAQTIPSMASMAHT
                     LWKLYADAPDAVTVGRQWGGQMQRATAHAMTVRDSLPADRFLDVRFEDTVSDPFGVAQ
                     AVYRFAGMPLTESARAGIWAWMEGNPRNQRAAHAYTLEQFGLSQEQLERDFAGYRARH
                     ILKQN"
     gene            610837..611628
                     /locus_tag="CNE_RS20925"
                     /old_locus_tag="CNE_2c05750"
     CDS             610837..611628
                     /locus_tag="CNE_RS20925"
                     /old_locus_tag="CNE_2c05750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952272.1"
                     /db_xref="GI:503718196"
                     /translation="MLLKDKIVIVSGIGPGLGVKLAVEAAREGARAVAIAARTAAKLD
                     DAQARIDALGADCEVLKVVTDITDRAQSRHLASETMRRFGRIDALVNSAFQHGNFPEP
                     VEAADLDVWRQVFDTNVFGTMTLTQEVAALMKPQGGGAIVMINTQATRKPMPGESGYA
                     ASKGALAVAVKYLARELGPHGIRANSIFMGWMWGEPVQGYVRHAAAEQGVSEDTVIAP
                     VAAQIALGRMPTDDDCARAALFLVSDYARAITGASLDANGGDFMP"
     gene            611647..612612
                     /locus_tag="CNE_RS20930"
                     /old_locus_tag="CNE_2c05760"
     CDS             611647..612612
                     /locus_tag="CNE_RS20930"
                     /old_locus_tag="CNE_2c05760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013952273.1"
                     /db_xref="GI:503718197"
                     /translation="MTRYFAFNGDADGLCALQQLRLADAGDATLVTGVKRDIRLLERI
                     DAGPGDTVTALDISLEQNRDGLMRLLGAGARVDYFDHHHAGELPGHAGLRAHIDEGPE
                     VCTSILVDRHLDGCHRRWAITAAFGDNLGGVARALAAQAGLGECETAVLEQLGTCLNY
                     NAYGECVADLHFDPAELARHMLPFADPLAFAAQCGAYAVLCEGYEDDMARGRCLAPAH
                     EVPGAALLVLPDAPWARRAIGVLANELVRGRPGDAIGLLSPKSGGGFAVSVRVPAHSA
                     TGAADFCRGFETGGGRRLAGGINHLPDAEVERFTRSFADCFGCRS"
     gene            complement(612617..613717)
                     /locus_tag="CNE_RS20935"
                     /old_locus_tag="CNE_2c05770"
     CDS             complement(612617..613717)
                     /locus_tag="CNE_RS20935"
                     /old_locus_tag="CNE_2c05770"
                     /EC_number="4.1.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-Dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="WP_013952274.1"
                     /db_xref="GI:503718198"
                     /translation="MSPATPLPPMADVLAALVAGQRVLVIEDETDEATGCVLVAAERA
                     SEADVNFMAAEARGLVCMAITEARRALLQLPPMAANHRQRERYTVSIEAASGVSTGIS
                     AADRALTLRVAAAARAQPHDLVQPGHIFPVVAQPDGVLRRAGFAEACSDLPALAGRVA
                     AGAYAMLLDDDGDLLRGPALLAFARHHGLPAVSISGLIHHRLLTESALRRTHSTELAT
                     PYGCFTVHAYHDTPVDALHLALVLGQPDPGQPVLTRVQTVEMQRDVLGFGTPAQPAWN
                     LERSLARIGAEGCGVLVLLDERESPQQRLDRLAAPAGASPAPAFAQRALGVGAQILRD
                     VGAHKLRLLSHPVPYRAVTGFDLEVTEFVPPC"
     gene            complement(613714..614670)
                     /locus_tag="CNE_RS20940"
                     /old_locus_tag="CNE_2c05780"
     CDS             complement(613714..614670)
                     /locus_tag="CNE_RS20940"
                     /old_locus_tag="CNE_2c05780"
                     /EC_number="3.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_013952275.1"
                     /db_xref="GI:503718199"
                     /translation="MPLDPQARAVLEAMAAMPSPDFSTLRAADYRAALAAMPAFAPGD
                     TVATQQDLTIVGAAGPLQARLYRPDDSTALPLVVYFHGGGFVLCGLDSHDNICRSLAR
                     RSVALVLSVDYRLAPEARFPAAADDAVAAVRWAAAHAAQLGADPARLAVAGDSAGGNL
                     AAVACQQLRGSGIALRHQLLLYPYLDCSDAAAASASYRECAQGYFLGAAELDWYRAQY
                     LANPADATDVRASPLHQRELHGLPPATIITAEYDPLRDQGEAYGEALQRAGGGAAVRR
                     WPGQFHGFISMQGMIDAASDALDAAATSLRQAFGGNARQEAA"
     gene            complement(614704..615513)
                     /locus_tag="CNE_RS20945"
                     /old_locus_tag="CNE_2c05790"
     CDS             complement(614704..615513)
                     /locus_tag="CNE_RS20945"
                     /old_locus_tag="CNE_2c05790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_041228802.1"
                     /db_xref="GI:752557570"
                     /translation="MAADPRQQAAVITGAASGIGRALAQALAAQGYALALADIDARAL
                     EAVRETLAGQGANVIAVPTDVCDVRQIEHLCEESFLRLGRVDLLVNNAGVLATGRCWE
                     LPPEVFDHVMRVNLWSVLHALRCFVPRMAAQGAGHIVNVASMAGLAVGPWLAPYTLSK
                     QAVVALSEGLALELQAAGLPLGVSVVCPGPVATGIAAGLDGGGPQEVDQMNGALRSGI
                     AAGMTPDAVARYILDGVSAGRFWILPHEQAVQAALARAQGIAAGTPPAFAL"
     gene            615913..617097
                     /locus_tag="CNE_RS20950"
                     /old_locus_tag="CNE_2c05800"
     CDS             615913..617097
                     /locus_tag="CNE_RS20950"
                     /old_locus_tag="CNE_2c05800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013952277.1"
                     /db_xref="GI:503718201"
                     /translation="MLMEVSQNQATAHLFAQATVSLSEFSTLLGNIYQGPMEQVPWGK
                     ALEQIRRQLNANYCTLILRSPATDRPGLMVNASEHGSTLPGETSYNNYYYALDPFIGL
                     PSDRVVTIDEHLGPGAWCQSELYQQFLKDIGIRYILGADLRTDDGVECRFRVCREHDG
                     RDFSAADKALCTALLPHLKRAVDLHSRIDVVESERTVYASAIDRMLVGMVILDESGAI
                     IKTNAAADEILGAKDGIRVAKGGLDVEYGQENRKFQRLLRQAMMGHLGTTPALMEAMS
                     ITRPSGSARLGVLIRTIPLSEWSEDNRKRPASVVFIRDPERRSQASHEVVRQLFDFTP
                     AETQLALQLANGLTLDEAADELGISKNTARAHLRAIFSKTGVTRQATLVRMLLSSVIS
                     LG"
     gene            complement(617113..617457)
                     /locus_tag="CNE_RS20955"
                     /old_locus_tag="CNE_2c05810"
     CDS             complement(617113..617457)
                     /locus_tag="CNE_RS20955"
                     /old_locus_tag="CNE_2c05810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018009077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013952278.1"
                     /db_xref="GI:503718202"
                     /translation="MQARLLLYPVADIDTALPFFTEGLGLPVKFRDESRYCALDAGAL
                     TLALVAGEERLVDQPALAFKVDEGDDIAAAMARLVGAGASVTLPAAQGPHETRAVLET
                     PEGFALVLSAKP"
     gene            617669..618820
                     /locus_tag="CNE_RS20960"
                     /old_locus_tag="CNE_2c05820"
     CDS             617669..618820
                     /locus_tag="CNE_RS20960"
                     /old_locus_tag="CNE_2c05820"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5,N10-methylene tetrahydromethanopterin
                     reductase"
                     /protein_id="WP_013952279.1"
                     /db_xref="GI:503718203"
                     /translation="MRFSLIYEAQTVDASRAGDHKVFDEIMEQVVLAEDMGFDVVWAV
                     EHTALTNYAHMSAPETFLAFVAGRTQRIGIGHGVVCLPPAMNHPVKVAERIATLDILS
                     GGRVHFGVGKGGTQQEAGTFGYDLNSLHPMIDESMYLIPKIMTQDEIEHDGEFIKIPR
                     RPIHPKPRQDPHPLMYLACTNADTLQRAGARGMGALVLGFGGPEDVARKNEIYRTAWE
                     TRKPEDQVGFRPHQHLAALCPTIVLEDGLAARKIGIKGQRYFMESLSYWYAGGERPDP
                     STWDDEHVTATDAQGKAVINTKFASEKVSVDFSDPSMMMLNPNHAYGTVEDCIGYVQR
                     LIDSGADEILFICQMGTVPQWAQLETIRNIGEHVIPHFRKQGRKLRALA"
     gene            619096..620289
                     /locus_tag="CNE_RS20965"
                     /old_locus_tag="CNE_2c05830"
     CDS             619096..620289
                     /locus_tag="CNE_RS20965"
                     /old_locus_tag="CNE_2c05830"
                     /EC_number="1.14.14.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin-dependent monooxygenase oxygenase
                     subunit"
                     /protein_id="WP_013952280.1"
                     /db_xref="GI:503718204"
                     /translation="MHHDNNPKELAARLIARAEQMIPVLAQRAAQAEAEARIPAETIA
                     DMQAAGFFKVLQPRRHGGYELDPQTFFRIQMALAKGCMSTAWVYGVVGVHNWQLALFD
                     ERAQQEVWGSNPATLIASTYMPVGKVTPVEGGYRFSGHWKFSSGSELCDWIFLGGLVP
                     PAEPGGAYDYRTFLLPRSDYKIVRNWDVLGLRATGSHDIVVEDVFVPDYRTHRAVDGA
                     MGTSPGLAVNDAPLYRLPFAQIFVRAVCTACIGALEGTLDDFVAYADGRVSSNGGGKT
                     AEDGGAQMACANAQVAIDEMRTILERNFDELLAVAREGGQVQTPRRLHFRYQSAQVAE
                     RCAQLANGLLRYAGGNGIYRSNPMVRRFLDLHAARAHYANNLDRFGQNLGGVMMGRAN
                     TDFFI"
     STS             619247..620049
                     /locus_tag="CNE_RS20965"
                     /old_locus_tag="CNE_2c05830"
                     /standard_name="Rab13"
                     /db_xref="UniSTS:281110"
     gene            620316..622070
                     /locus_tag="CNE_RS20970"
                     /old_locus_tag="CNE_2c05840"
     CDS             620316..622070
                     /locus_tag="CNE_RS20970"
                     /old_locus_tag="CNE_2c05840"
                     /EC_number="1.3.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxosteroid 1-dehydrogenase"
                     /protein_id="WP_013952281.1"
                     /db_xref="GI:503718205"
                     /translation="MSQSRARMQPSEFDVVVVGSGAGGMLAACRAADRGLSVVVLEKS
                     SQYGGTSAVSGGGIWIPLNHHIAPAGGRDDYATALEYILACAGEHGDPQRVRAYLEQA
                     PRMLQYLEQQAGVRYYTLPRYADYFQKVPGAMPGYRALDPMPFDGAQLREEFSRLRPP
                     SPGTLVGGRVAVTSAEAHALLCRAPGWLGLAARQFSRYWLDLGWRRKTRRDRRLTLGN
                     SLVGGLRRAMMDRAIPLWLDTALQDLIVEDGTVRGVRAVQDGRVVEIRALRGVILAAG
                     GFERNQAMREQYLPQPTQAAWSATPPNNTGDGIRAAQAAGAGVALMSHVWGAPTVHVQ
                     GEEKQRALFIERAMPGCLVVNGQGRRFVNEAAPYSEFVPAMYRDHEKTGSSVPAWMVF
                     DATFRHKYPCGPILPGSVMPDRSIPASLSGILVRADSLAQLAQRIGVDAGGLADSVAR
                     MNRYAATGVDEEFGKGDNLFDTYYSDPAVQPNPCLAPIGKAPFYAVRLDAGDIGTKGG
                     LVTDASARVLRDDGTAIAGLFAIGNTSASMMGTSYPGAGSTLGPAMTFGFIAADVLSQ
                     NARQPAAAPHAQTVQEAL"
     gene            622067..622591
                     /locus_tag="CNE_RS20975"
                     /old_locus_tag="CNE_2c05850"
     CDS             622067..622591
                     /locus_tag="CNE_RS20975"
                     /old_locus_tag="CNE_2c05850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952282.1"
                     /db_xref="GI:503718206"
                     /translation="MSANLEPSTALRDDMLMAMRRMARSVAVISCRHGERRYSMSVTA
                     VDSLSADPPSLLICINRNSSIYPPLDAGADFCINLLAADHRDIAVDCSGRLKGEERFT
                     SGEWEDDLLGVPCLRDAQANLVCQQDGRFDYGTHAVFIGRLREVKLAGEVSPLVYVDG
                     AYTTSAPLGALCSA"
     gene            622611..624317
                     /locus_tag="CNE_RS20980"
                     /old_locus_tag="CNE_2c05860"
     CDS             622611..624317
                     /locus_tag="CNE_RS20980"
                     /old_locus_tag="CNE_2c05860"
                     /EC_number="1.3.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta 4, 5-alpha steroid dehydrogenase"
                     /protein_id="WP_013952283.1"
                     /db_xref="GI:503718207"
                     /translation="MYPPTDSATPVHAPLRLDDPAAHPWQAACDAVVVGFGAAGACAA
                     LEAAHGGARVIVAERFEGGGASARSGGVVYAGGGTPYQSAAGYADTPQAMADYLRQET
                     GGVVSDATLQAFCQRSREMIGWLEGLGVRFAATVPPRKTSYPAQPYYLYYSGNEAVAA
                     YAQHAAPAPRGHRVKGPGMSGRMLYGVLRAAVQARPEVTVMRQTAARRLILDQDGAVV
                     GIELWQLPPGRHQKRHARLARLAERLHNAAPALADLLRERVLQLELRHARPVAVRTGA
                     VVLAAGGFIFNRAMVARHAGKYLQTWRLGATGCDGSGIRLGESAGAATRHLERVSAWR
                     FINPPFDWARGCVVDAQGARIGNEETYGATLGHAICERHGGRAWLVLNRELARAALRE
                     CLGGRLWAFQALPAALLMLAGSRRAASLEALASKLGMPGAALRATVDAYNAAARGEIP
                     DPAGKSAPMCASLETGPWLAIDISANSRVFPCPAITLGGLSVEESSGRVLAAAGGAPI
                     PGLYAVGRTAVGIASNHYVSGLSLADCIWSGRNAGRHLTRQPAGDRQAHTNEETTHEP
                     TY"
     gene            624301..625065
                     /locus_tag="CNE_RS20985"
                     /old_locus_tag="CNE_2c05880"
     CDS             624301..625065
                     /locus_tag="CNE_RS20985"
                     /old_locus_tag="CNE_2c05880"
                     /EC_number="1.1.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta-hydroxysteroid dehydrogenase"
                     /protein_id="WP_013952284.1"
                     /db_xref="GI:503718208"
                     /translation="MSQRTEGKIAIITGAASGVGKEDALLLAREGARVVLTDLNEEAG
                     HALAREIGETALFVPHDIASEAGWQQVMARTEKQFGAPSVLVNNAAILMLGSVEDATL
                     EQWQRVMRINADGYFLGCKYGVAAMKAGGGSIVNMSSVAALGGMGAFCAYSASKGAVA
                     ALTRAVAGLCKQSGYRIRCNSIHPDGILTPMTAAFLPGGATALPEEVGGAEPMQRMCH
                     PRDVANLVLFLASDESRFINGAELRIDNAQTIMGVA"
     gene            625093..626157
                     /locus_tag="CNE_RS20990"
                     /old_locus_tag="CNE_2c05890"
     CDS             625093..626157
                     /locus_tag="CNE_RS20990"
                     /old_locus_tag="CNE_2c05890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketosteroid-9-alpha-hydroxylase reductase
                     subunit"
                     /protein_id="WP_013952285.1"
                     /db_xref="GI:503718209"
                     /translation="MAPVQFHRLQIAEVVTETDQAHSLVFALPDGLRDAFAYRPGQFL
                     TLRVPVDGVPLQRCYSLSSTPEVDNALRVTIKRVQSGRVSNWICDHLGAGDTVEVMPP
                     AGVFTPPALHGDFLLLAGGSGITPVLSIAKAALRHGRGAVTLVYANRDERSIIFREAL
                     AELVRSHPGRMRVIHWLDSVQGPPTQRQIEELVRPWSVAQCFVCGPGPFMDGAQAALQ
                     ALGVPRGQLHVERFVSLPDVPVAKAPASGPPARGTPPASPAPAMRGAALTVQLDGETH
                     HVSVAPDETVLDALQRAGVAAPNSCRAGLCGACMCQVTQGDVTLGENHVLDRADLEAG
                     WTLACQARPSSGEIHLKFPD"
     gene            626159..627799
                     /locus_tag="CNE_RS20995"
                     /old_locus_tag="CNE_2c05910"
     CDS             626159..627799
                     /locus_tag="CNE_RS20995"
                     /old_locus_tag="CNE_2c05910"
                     /EC_number="6.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid--CoA ligase"
                     /protein_id="WP_013952286.1"
                     /db_xref="GI:503718210"
                     /translation="MTPSDIIDAIAAPAGLDLDLAAANDDIAATIPELVRRAARRHGE
                     RIAIQEDGLRLTYAALDASRIQAARALMALGVQPCDRVAVWAPNFSEWIIAALATHSI
                     GAALVPLNTRMKGAEAGAVLADSGARLLFCVDGFLGESYPQMLAPHRPATLERLVILR
                     PGQGRAPGPDELAWEAFLALAPQADMAAFAKREEGVRGDTLMDIMFTSGTTGRPKGVM
                     TDHAQNLRAVDGWAAITGVRPGDRYLIVNPFFHTFGYKAGWLAALSRGATVLPHLVFD
                     AEAVMTRVENERITVLPGPPTLYQTLLNAPRLREFDLSSLRVAVTGASAIAPALIQRM
                     RDELGFDTIITGYGLTESCGFATLTRAGDDAETVAATSGRAMRGIEIRCIDGQGQPVA
                     TGEPGEVLVRGYNVMQGYFGLPEATAEAIDSDGWLHTGDVGTLDARGYLRITDRIKDM
                     FIVGGFNCYPAEVEKLLVAHPAVAQVAVVGMPHERLGEVGRAYVVLRHGARVDAETLI
                     AWARRHMANYKVPREVLFVTSLPVSAAGKVLKYQLREA"
     gene            627817..628263
                     /locus_tag="CNE_RS21000"
                     /old_locus_tag="CNE_2c05920"
     CDS             627817..628263
                     /locus_tag="CNE_RS21000"
                     /old_locus_tag="CNE_2c05920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228803.1"
                     /db_xref="GI:752557571"
                     /translation="MTDIAAIADRVARLEAAEAIRALKLRYLRACDDKDPDAMRACFV
                     PDNAHIHYDRIGSFAGREALVQCFAELACRPTLREMHFAGQADIRVLDDNTAQGSWDL
                     AYLALDDASGSRTFLTGRYADEYVRVDGAWLIRSTGFTTGLLSQGG"
     gene            complement(628361..629227)
                     /locus_tag="CNE_RS21005"
     CDS             complement(628361..629227)
                     /locus_tag="CNE_RS21005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_041228558.1"
                     /db_xref="GI:752557326"
                     /translation="MKQAEQAIVAVITGGSRGAGKGIALALGAAGATVYVTGRTEQEG
                     SAPLPGTIHATAREIDALGGRGIAVACDHRDDAQVARLFGRVREESGRIDILVNNATF
                     LHDELIMPGPFWQKPLEMAGILDVGLRSGYVASWHAAPIMAAQGRGLIVFTSSFGANC
                     YMHGPAYGAQKAGIDKFAHDMAVDLRPCGVAAVSLWMGPLRTARTLRVWEKHPDKYAG
                     FAPVAETPEFTGRIIDALYRDPTLMDKSGRVLIGAEAALAYGIVDAEGVQPPSYRQAL
                     GGPPPVHPAIVE"
     gene            629436..629855
                     /locus_tag="CNE_RS21010"
                     /old_locus_tag="CNE_2c05940"
     CDS             629436..629855
                     /locus_tag="CNE_RS21010"
                     /old_locus_tag="CNE_2c05940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952288.1"
                     /db_xref="GI:503718212"
                     /translation="MSELECKEAIHALTCRYAQAVDRRDFPKLAALFTADAWLSGPGF
                     RMDGPQAIADGMASLGQYSATQHHVHQQLVEVDGDTATGETYCVANHLYEQDCVPRKL
                     DWGIRYQDRFVRRDGQWRIAARELLVDWTQDLPLRGA"
     gene            629852..630706
                     /locus_tag="CNE_RS21015"
                     /old_locus_tag="CNE_2c05950"
     CDS             629852..630706
                     /locus_tag="CNE_RS21015"
                     /old_locus_tag="CNE_2c05950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-alpha-hydroxysteroid dehydrogenase"
                     /protein_id="WP_041228559.1"
                     /db_xref="GI:752557327"
                     /translation="MMTTRVLEGKTALVTGGAGGIGAASALALLRDGAAVVLMGRRRE
                     ALEAARRSLRAQVAGATVAISVGDACREDDVQAALQQAWELERRLDIVVATVGGGGFR
                     PLLMHDAASLMAELELNIASAFLAVRHASPLMAPRGGAIVCISSNAARMTCRWLSAYC
                     AAKAGLEAFVRAAAEELAGCGIRVNAVRPGLTRSGATGPMFDNPAILDKFVAQMPLGR
                     AGEPDDIASAVRYLAGPESGWVTGQSIAVDGGSELRGNPILDETVAAVYGEAALQAVL
                     AGRIPEAG"
     gene            630732..631490
                     /locus_tag="CNE_RS21020"
                     /old_locus_tag="CNE_2c05960"
     CDS             630732..631490
                     /locus_tag="CNE_RS21020"
                     /old_locus_tag="CNE_2c05960"
                     /EC_number="1.1.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta-hydroxysteroid dehydrogenase"
                     /protein_id="WP_013952291.1"
                     /db_xref="GI:503718215"
                     /translation="MNQVRDKVALVTGAASGVGRADALLLAAEGARVVISDVNQEAGQ
                     ALAREIGDAAMFVRHDIASEEDWRKAVAATQDRFGRLDVLVNNAAICPLGSIEETSLD
                     SWRQVMRVNADGYFLGCRFGVQAMKGNPAGGSIVVMSSVAALGGLPMMCAYSGAKGAV
                     TALTRSVAVHCKQSGYRIRCNSIHPDGVWTPMTQALVPDLDPAALGIGTDPMARMCQP
                     EDVANLVLFLASDASRFINGAELRIDNAQLISGL"
     gene            complement(631536..632435)
                     /locus_tag="CNE_RS21025"
                     /old_locus_tag="CNE_2c05970"
     CDS             complement(631536..632435)
                     /locus_tag="CNE_RS21025"
                     /old_locus_tag="CNE_2c05970"
                     /EC_number="5.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="WP_013952292.1"
                     /db_xref="GI:503718216"
                     /translation="MKILIVGGTGMIGGHAALHLRSRGHEVTIAGRNRPAAGTALGGL
                     DFLRCDYIANDVPAAQLGAFDALVFAAGNDVRHVPPGGDEAAHWERANIEGVPRFLRA
                     ARAAGIRVAVYVGSFYPQAQPQLAEDNAYIRSRKLADEGVRALATDAFRVSSVNAPFV
                     VGTVPGLMVPMFKAYTDYARGNFAPMPDFAPPGGVNFISATSLSEAIEGALLRGENGK
                     AYLVGDENLSFQDYFGAFFRDAGRPVPPVIDQEHPLLPDSAICFGRGNTLYYEPDAAE
                     TALLGYRRRDILRTVGEIVAQYS"
     gene            complement(632479..633309)
                     /locus_tag="CNE_RS21030"
                     /old_locus_tag="CNE_2c05980"
     CDS             complement(632479..633309)
                     /locus_tag="CNE_RS21030"
                     /old_locus_tag="CNE_2c05980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018009064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952293.1"
                     /db_xref="GI:503718217"
                     /translation="MDFTDKTVLVTGGGAGIGLAAAQAFLEQGARVALIEIDEQRAEQ
                     ARELLNKPGTEMLVVQGDATDAGIVRELAAQVEQRFGVLDVLVNNVGDFLRIAKPFEL
                     YADDEIASLYAANLGHVFTVTRAMLPLLRRSTAGSIVTVSSIEAFRGIPYCSVYGAFK
                     AAITGFTQSLALELAPAGIRVNLIAPETTETPQVPVSQMVAAEHQHHIPRWIPLGRFG
                     TPRDIADGILFLASPRAAWITGTALHVNGGALAAAGWYRDPKGAWTNMPVIGGNGMNL
                     "
     gene            633542..634729
                     /locus_tag="CNE_RS21035"
                     /old_locus_tag="CNE_2c05990"
     CDS             633542..634729
                     /locus_tag="CNE_RS21035"
                     /old_locus_tag="CNE_2c05990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018009063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013952294.1"
                     /db_xref="GI:503718218"
                     /translation="MLMATVEAQGVASPWFAQSGLSLPHFSALLAAVYEGPMEPVPWG
                     RALEMLRKQLGASYVSFILRSPASDRSGIAVHASQHGTSLEAEASYNTYYYAIDPFIN
                     LPTDRAVTVDEAMGPGNWCRSEIYRQFLQPLGVRYLLGADIRTEDGVECRLRVCRQHD
                     AQDFSEVDKAACATILPHLRRAVRLHSRLDVVESERSLYAGAIDRMLVGMVILDAAGA
                     ILKKNAEADEILAENDGIRLNGGNFEIAYAQESRKFQYLLRRAQMGHHGSAPALAEAM
                     SITRPSGRGKLGVLIRTIPLSEWSEDHRHRPACAVFIRDPERKSRASHEVVRKLFDLT
                     PAETALALVLADGMTLDEAAEALGTSKNTARAHLRAIFSKTGVTRQATLVRMLLSSVV
                     TLG"
     gene            634986..635702
                     /locus_tag="CNE_RS21040"
                     /old_locus_tag="CNE_2c06000"
     CDS             634986..635702
                     /locus_tag="CNE_RS21040"
                     /old_locus_tag="CNE_2c06000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952295.1"
                     /db_xref="GI:503718219"
                     /translation="MEKVIYIVWRESQTEPGEFARRLRTTLADKLLALGARGLQVNVA
                     DDAVLPAAGLRQANTRPQMDGLVSVWMDSAIDCLRQPFDQAIEAAVGRMAGYLVTESQ
                     PIRNTRFPAAPGERTPGFAQLAFLTRPPRLTPQAWLDIWHNHHTPVAVETQDNFLYVQ
                     NVVVRPVTYAAPHYDAIVEEGFPDAAMTDPQAFFDAAGDEGKFQRNLQAMMESCQRFI
                     DFDKIDVIPTSQYLVRPAAA"
     gene            635808..636704
                     /locus_tag="CNE_RS21045"
                     /old_locus_tag="CNE_2c06010"
     CDS             635808..636704
                     /locus_tag="CNE_RS21045"
                     /old_locus_tag="CNE_2c06010"
                     /EC_number="1.13.11.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl 2,3-dioxygenase"
                     /protein_id="WP_013952296.1"
                     /db_xref="GI:503718220"
                     /translation="MLDIRALGYIVVESTDLGQWRHYAEQVLGMACSGAPGGALYVKM
                     DERDYRYLVVPGARDRYLASGWELADESAYRHALDTLRQAKVEVVHASAAELAQRRVQ
                     AMAWFSDPSGNRHEISWGMRSDFLRFVSPLGVPRFITDPMGAGHAVLPAPAFDETYAF
                     LCEVMGFGLSDIFRVRFTNDPAEPEKRIHFLHCGNARHHSLAIFEMPSESGCIHVMAE
                     VPDMAEVGRALDRVQQHGVTLSATLGQHCNDRMTSFYMKTPGGFDLEFGHGGLVVDWS
                     HHAAYEATRVSLWGHDFSIGYR"
     gene            636712..637602
                     /locus_tag="CNE_RS21050"
                     /old_locus_tag="CNE_2c06020"
     CDS             636712..637602
                     /locus_tag="CNE_RS21050"
                     /old_locus_tag="CNE_2c06020"
                     /EC_number="2.8.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011297723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-transferase"
                     /protein_id="WP_013952297.1"
                     /db_xref="GI:503718221"
                     /translation="MTKTIDKTMSAADVVGRLADGMTIGIGGWGPRRKPMALVREILR
                     SPLKDLSVVAYGGPEVGMLCAAGKVRRLVFGFVSLDVIPLEPYFRQARERGVLEVTEL
                     DEGMLQLGLRAAAARLPFLPTRAALGTDVLDMNPQLKTVRSPYADGEVLVAMPAIKLD
                     AALLHVNDSDVLGNTRIDGPDPFFDEWFARAAHRCYVSCETLHPRLEDEDLARARNNA
                     FERSLVSGVVHVPGGAHPTSCAPAYGWDLPALKAYCASAEAEDGFRAYRDEVVGASEA
                     AYLERIGGLGHVHDLPLPVL"
     gene            637626..638426
                     /locus_tag="CNE_RS21055"
                     /old_locus_tag="CNE_2c06030"
     CDS             637626..638426
                     /locus_tag="CNE_RS21055"
                     /old_locus_tag="CNE_2c06030"
                     /EC_number="2.8.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl CoA:acetate/3-ketoacid CoA transferase
                     subunit beta"
                     /protein_id="WP_013952298.1"
                     /db_xref="GI:503718222"
                     /translation="MSATYEFTRAELMIAAAAREWRDDGEVLATGIGTGPRIAAGLAR
                     LAHNPGLLLTDGEAYLVETPVPLGPREPGYKVRASGWMGYSRVFDCLWGGRRHALVMP
                     TQIDRFGQTNISCLGGTHAQPKTQLLGARGFPGNSIHHANSFFVPAHGTRAFVAGEVD
                     MVCSAGYNPARQLEGMRSFVDLRVIVTDLCVMDFGGADHAIRVRSLHPGASFDQVQAA
                     TGFALANTPGEALPETAPPTPEELRLIAQLDPHNLRAAIVRGNPSGRV"
     gene            638434..639324
                     /locus_tag="CNE_RS21060"
                     /old_locus_tag="CNE_2c06040"
     CDS             638434..639324
                     /locus_tag="CNE_RS21060"
                     /old_locus_tag="CNE_2c06040"
                     /EC_number="4.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013952299.1"
                     /db_xref="GI:503718223"
                     /translation="MTTPAFEAISLGPNAEVLYQVADGIATVTMNRPQFHNAQNSKMT
                     YALDEAYRRAAADDAVKVIVLRGAGKHFSAGHDIGTPGRDINVSFERASLWYDHVNKP
                     GGEFLYAREQEVYLGMCRRWRELPKPTIAMVHGACIAGGLMLAWVCDLIVASDDAFFA
                     DPVVRMGIPGVEYFAHPYELHPRIAKEFLFLGERMGAERAERMGMVNRVVPRDALEDT
                     VYGMAAKVAQMPRLGLTLTKQAVNHVEDLQGKRTAMDAVFAWHHFAHAHNELVSGDKL
                     GGYDARAMAASQRTGGEDKA"
     gene            639321..640403
                     /locus_tag="CNE_RS21065"
                     /old_locus_tag="CNE_2c06050"
     CDS             639321..640403
                     /locus_tag="CNE_RS21065"
                     /old_locus_tag="CNE_2c06050"
                     /EC_number="1.13.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_013952300.1"
                     /db_xref="GI:503718224"
                     /translation="MSTASLHTVLCDLLGCRYPIVQTAMGWVADAKLVAASGNAGAFG
                     FLAGATIPPGEVEREILRVKALSDRPFGINFHMFQPNADEVIEMAIRHRLRAVSYGRG
                     PDAKMIGKLKAAGVVCMPTVGAAKHAAKAVALGADVVTVQGGEGGGHTGGTPTTLLLP
                     QVLDSVSVPVVAAGGFFDGRGLAAALAYGAAGVAMGTRFLMSAESPVPAPTLERYVKV
                     RDPASIRVSLAIDGLPQRMIDNDLLLALEKAGPLRRTWLALAAARKWQARTGMRSAQM
                     LATAWRAMREQDYSAAQTLMAANAPVLIQRAMVEGCPDEGVLPSGQAAAAIRAIESCE
                     QIVAGMAAQAQARLAALAGAALAAAA"
     gene            640423..641214
                     /locus_tag="CNE_RS21070"
                     /old_locus_tag="CNE_2c06060"
     CDS             640423..641214
                     /locus_tag="CNE_RS21070"
                     /old_locus_tag="CNE_2c06060"
                     /EC_number="4.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013952301.1"
                     /db_xref="GI:503718225"
                     /translation="MQTNKKTGPFRIDTADGIAELVIDHAPVNALDSAGWHALAAAID
                     QLGTDPAVRVIVLRGEGRGFCAGVDIKELAAHPQRIVDVNAGNYATFRAVHRNPKPVI
                     VAVHGFVLGGGIGICGAADIIVAADCARFGVPEIDRGAMGGGAHLQRMFGVQKVRAMY
                     FTGEMIDAAEAYRLGAVERVVPRSELRDAAMTLARQIAAKSPAMLQLAKEALNGVEDG
                     NLEDKYRWEQGFTLQAYMSADSGEARAAFVEGREARFAQGERDAA"
     gene            641204..642370
                     /locus_tag="CNE_RS21075"
                     /old_locus_tag="CNE_2c06070"
     CDS             641204..642370
                     /locus_tag="CNE_RS21075"
                     /old_locus_tag="CNE_2c06070"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952302.1"
                     /db_xref="GI:503718226"
                     /translation="MQLEYTDAQRAFRAEVRDWMAAHVPRTPLASFDTEAGFAQHRAW
                     EATLNQGRWSMVTWPAELGGRGCDLIEWLIFEEEYWRAGAPMRVNQNGIFLLGPTLME
                     FGTEAQKARFLPRMASGEHVWAQGWSEPNAGSDMAAIRCSAIRQGDDYVINGQKIWST
                     RAVWADWLFGLFRTDPASTRHHGLTFILMPLDTPGITVRPIRQLNGQTGFAEIFFDDV
                     RVPVENRLAAEGAGWQVAMATAGFERGLMLRSPARFQETARALVRLYQANREAADRDP
                     SLREAVLRAWMDAEAYTLSTYATASRLVRGGHIGAESSTNKVFWSELDIHMHDTALAI
                     LGQAAEVAPDGQPPGSLGHWLDGFLFSQAGPIYAGTNEIQRNIVAERLLGMPRA"
     gene            642392..643459
                     /locus_tag="CNE_RS21080"
                     /old_locus_tag="CNE_2c06080"
     CDS             642392..643459
                     /locus_tag="CNE_RS21080"
                     /old_locus_tag="CNE_2c06080"
                     /EC_number="1.3.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952303.1"
                     /db_xref="GI:503718227"
                     /translation="MDFALTEEQEQFAEAIRRFLMTEMTPELTRELWATESGRSDALW
                     RQLANQGLTAVMVPQEQGGLGLGEVEWAPLAQACGYFALPEPLLDTALVAAGLLRDAL
                     AAAPNASARERCATLLERIAAGDARVAVAHPQERLVADAHVADAILCAHEGAVHLLRP
                     DQAVLTARTGLDPSRRLFELAWTPAADSGLISSGSGLWDSALNRGALGVAAQQLGLTQ
                     RMLDLAIDYSAQRKQFGKAIGAYQAVKHLLADVAIQLEFARPVLLRAAAALAYGLPDA
                     GLHVSHARVAAARCAWSAARQAIQVHGAMGYTWELDLQIFTKRAWALAGSWGDRAFHK
                     ARIGAHILDGAHDIGAGATFA"
     gene            643480..644631
                     /locus_tag="CNE_RS21085"
                     /old_locus_tag="CNE_2c06090"
     CDS             643480..644631
                     /locus_tag="CNE_RS21085"
                     /old_locus_tag="CNE_2c06090"
                     /EC_number="2.3.1.174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616736.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013952304.1"
                     /db_xref="GI:503718228"
                     /translation="MKDAYIVDALRTPTGRRKGGLSHMHGADLGGFVLAELVRRNGIP
                     AEDYDDVVFGCVDTIGPLAGNIARSAWLAAGLPLTVPGVTVDRQCGSSQQAVHFAAQA
                     VMSGTQDVVIAGGVQTMTQIPISSAMLAGQALGFADPFSGSKGWQARFGDAPVSQFHA
                     AQRIADHWKLSREAMEVYALESHRRAAAAIEGGRFAREIVPCEGVKHDETPRPDTTLA
                     RMAALEPLMPGSSLTAAVSSQTADAAAALLIVSEDALKRYQLKPRARIAHMSVLGDDP
                     LWMLTAPIPATKRALERSGLRLADIDVVEINEAFASVAMAWLAETGYAAERTNPNGGA
                     IALGHPLGATGARLMTTLLHELERTGGRYGLQTMCEGGGLANVTIIERL"
     gene            644642..645517
                     /locus_tag="CNE_RS21090"
                     /old_locus_tag="CNE_2c06100"
     CDS             644642..645517
                     /locus_tag="CNE_RS21090"
                     /old_locus_tag="CNE_2c06100"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952305.1"
                     /db_xref="GI:503718229"
                     /translation="MGICDARTVIITGAGGGLGRAYALAFAAEGANVVVNDIRLEAAE
                     AVCAEIRAAGGSALASADDITQLAIAQRIVDAAVEAFGEVHVLVNNAGICRDRMFVSL
                     TEADWDDVMRVHLRGHFCLANLLAKRWRDAAKAGRAVDARIINTSSGAGLQGSVGQSN
                     YAAAKAGIAALTLVQAAELGRYGITANALAPAARTGMTEDVFADMMRAPAAGFDYYDP
                     ANVAPLVVWLGSAASAQVNGRMFEAAGGMVSVADGWRSGPKTDKGSRWQPAELGAAVA
                     ELLAQAQPPQPVYGS"
     gene            645529..646692
                     /locus_tag="CNE_RS21095"
                     /old_locus_tag="CNE_2c06110"
     CDS             645529..646692
                     /locus_tag="CNE_RS21095"
                     /old_locus_tag="CNE_2c06110"
                     /EC_number="1.3.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952306.1"
                     /db_xref="GI:503718230"
                     /translation="MDFSLSVEQQMVRDSARDYLAAHSDSEAVRRVTEVGPAHDEALW
                     QAVAGELGWCGIALPEAVGGAGLGAPGLVLLQEQLGQRLACVPFWSAVCVAAPWLQAS
                     LGPRGSAQWLERLACGELRAAAVLPDDGGWQYDGAAIGAQASTDGFVLRGCAAQVADA
                     VGADWLLVPARLEDGVPALFLLEPTALAQDARFMLAPLDTLDRTRPLAALRLDGLPVP
                     ASACLARADAAASGLAHAWWHGKLMLAAEQLGAAQQCLDLTVAYASERIQFGRAIASF
                     QAVKHRCAQMMVLVEAARSAVYGAAQAWEMSDVADGTGIRLDIAAASVAADDALRFCA
                     QEAIQLHGGVGFTWEYDPQLYFKRAQAASHWLGGAGAALAYLAANGPHAWRTA"
     gene            646689..647891
                     /locus_tag="CNE_RS21100"
                     /old_locus_tag="CNE_2c06120"
     CDS             646689..647891
                     /locus_tag="CNE_RS21100"
                     /old_locus_tag="CNE_2c06120"
                     /EC_number="1.3.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952307.1"
                     /db_xref="GI:503718231"
                     /translation="MTANHEAAFRAEVAQWMAANLAGEFACLKNRGGPGDEEAYPELR
                     KAWERRLAEGGWTGLGWPRAHGGRELPVMQQVIFHEEYARAAGPGRMGHIGEGLIGPT
                     LVAFGTEDQKARLLPGILNGTAFWCQGYSEPGAGSDLANVRTRAERDAASGDWLVSGQ
                     KVWTSLAHDSDWIFVLARCEPGSRGSKGLIFLMLPLDQPGIEIRPIRQMGGGAEFNEV
                     FFDGARAAAADVLGAPGDGWRIAMALLGFERGISTLGQQMQFTHELEWVAQTARDNGS
                     SRDALVRQRIARAWAGLRVMRANALRMLAGAAQAGQDGGTALQREALIYKYYWSNWHR
                     DLGQLALDVLGPLANVLDAGDTRRTRLQQMALFSRADTIYAGTNEIQLNIIAERGLGM
                     PREARGQP"
     gene            647888..648691
                     /locus_tag="CNE_RS21105"
                     /old_locus_tag="CNE_2c06130"
     CDS             647888..648691
                     /locus_tag="CNE_RS21105"
                     /old_locus_tag="CNE_2c06130"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018313017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952308.1"
                     /db_xref="GI:503718232"
                     /translation="MTLNTEIPSAPAYVPGHQLLAGKSVLITAAAGAGIGFAAARRCA
                     EEGCRALMISDVHQKRLDEAVGRLRAETGLQAIHGQLCDVSDEAQVRALVAAAEEVLG
                     GTDVLINNAGLGGSRRLVDMDDAEWSRVIDISLTGTFRMTRAMLPHMQARRRGAIVNN
                     ASVLGWRAQKEQSHYAAAKAGVMALTRCSAMEAAEFGVRINAVAPSIALHDFLKKSAP
                     ADLLRQLSEREAFGRAAEVWEVANVMVFLASDYASYMTGEVLPVSSQRA"
     gene            648732..649187
                     /locus_tag="CNE_RS21110"
                     /old_locus_tag="CNE_2c06140"
     CDS             648732..649187
                     /locus_tag="CNE_RS21110"
                     /old_locus_tag="CNE_2c06140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011297735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC family dehydratase"
                     /protein_id="WP_010813969.1"
                     /db_xref="GI:498513540"
                     /translation="MPRIFRSAEDIHAAVGQRLGESAWTQITQEQVNQFANATGDHQW
                     LHVDPERAAQGPYGACIAHGYLTLALVNQFLPELVTVEGMKWGVNYGCDKVRFPAPVR
                     VGARVRGVGELVRAETLQGGVQSVVRMTVEIEGGDKPACVAETISRYYF"
     gene            649201..650403
                     /locus_tag="CNE_RS21115"
                     /old_locus_tag="CNE_2c06150"
     CDS             649201..650403
                     /locus_tag="CNE_RS21115"
                     /old_locus_tag="CNE_2c06150"
                     /EC_number="2.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013952309.1"
                     /db_xref="GI:503718233"
                     /translation="MKEAVIVAVARTPIGKAFRGAFNDTEAPVLGGHVVRAVVERAGV
                     DPSEVEDVLIGAAAQQGTQGYNLGRLCAVAAGLPDSVPGMTMDRMCGSGLMTIAAGAR
                     AIQCSEADIIVAGGAESISLTQTKHKNSYRAQSEAVLARQPAAYMAMIETAEVVARRY
                     GISRAEQDAYAWRSQQRTAEAQRRGAFDDEIVPLETRRALFDKAGTLTGHETVRLAHD
                     ECNRPDTTASSLEALKPVWSGGQAVAAGEHITAGNASQLSDGAAAVLLMSADEARRRG
                     LRPLGRYRGMAVAGCAPDEMGIGPVFAVPRLLERHDMTVADVGLWELNEAFACQVLYC
                     QQKLGIPDARLNVNGGAISIGHPFGMSGARMTAHALIEGRRRGVQQAVVTMCIGGGMG
                     AAALFDIL"
     gene            650475..651440
                     /locus_tag="CNE_RS21120"
                     /old_locus_tag="CNE_2c06160"
     CDS             650475..651440
                     /locus_tag="CNE_RS21120"
                     /old_locus_tag="CNE_2c06160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952310.1"
                     /db_xref="GI:503718234"
                     /translation="MKRLIGVAMSLAVLATAVWAFAPRPLPPFAATTLRPDGLQVNGI
                     ARAGERLVAVGERGQILFSDDQGRNWRTAVVDHPQGAALTQVVFADSRHGMAVGHSGW
                     ILRTEDGGAHWQQVAFDARSSDPLLGAWAQAGGPWFAVGSFGRFLVSRDQGRHWEAAA
                     DKAMQDRHLNGIAGDGQGRLMLVGEAGLVLRSPDGGSRWEVVKSPYEGSLYGVQPLRD
                     GAWLAFGMRGNALRSEDFGATWQAADTGLKTSFFGGVELPDGRIVLAGQGGTLVMSAD
                     GGRQFTALPAGSPQTLAALAPAGKDTLALGGNGGLAGATLAANPR"
     gene            651479..653920
                     /locus_tag="CNE_RS21125"
                     /old_locus_tag="CNE_2c06170"
     CDS             651479..653920
                     /locus_tag="CNE_RS21125"
                     /old_locus_tag="CNE_2c06170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013952311.1"
                     /db_xref="GI:503718235"
                     /translation="MTRPHSSGRLGRLVDACASLLMHRRRLLLVLCLAVTVALGVSAT
                     RLRLDPGFNKMIPLQHRYMQVFTKYASTFSGANTVLLSLRWKGDGDIYNAAFMDKLRR
                     ATDDVFFIPGVDRSRVFSLFTPNVRYTEVTEAGFRGDVVVPGRFSGTPAELDKVRRNV
                     ARSGQIGRLVSNDLRSALIRAELRETDPATGKTIDYGSVARQLEKIRGEFSGTDVEVN
                     IVGFAKLVGDVEEGIAGVMGFFALAFAVTALLLWLYTRSLRITLLSLVVALLPVAWLL
                     GLLPLLGYGIDPMSILVPFLIFSIGVSHAVQMTNAWKQEVVQGHGALDSASAAFRKLF
                     IPGTVALLTNALGFMVIMRIEIDIVRELGITACLGVLLMIVTNKVFLPILLSYTRLEP
                     SALASAQARRAQGTGGLWQKFGALARPGPALGVFVAALALLAAGAIDSRGLKIGDVGS
                     GAPELRADSRYNRDSASIVSQYNIGSDALTVVVEPTGFDDGCLHYPVMSAVERFEMHM
                     RGVSGVQSVVSVSSLAKVVIGAYNEGNPRWEALPRSSEGLSQGAKAFDPDNGMNTSNC
                     QAIQVLIYTANHEGATIAHIIREIRRFTAADKTPNVAFRLAGGNIGVMAATNEAVEEA
                     EVTMLLSIFGAITLLCLLTFRSWRAVLCIIVPLTLVSVLCNALMARLGIGLKVSTLPV
                     ITLGVGVGVDYGIYLYERIQHQIREEGQALPQAFAEAMRQRGSAALFTALTMCIGVGT
                     WAFAALKFQADMGILLAFMFLVNLFGAVSLLPALAAWLGVEEEERARVAAGGAGGAAR
                     GETVTPAHALKSDVV"
     gene            653944..655185
                     /locus_tag="CNE_RS21130"
                     /old_locus_tag="CNE_2c06180"
     CDS             653944..655185
                     /locus_tag="CNE_RS21130"
                     /old_locus_tag="CNE_2c06180"
                     /EC_number="1.5.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin oxidoreductase"
                     /protein_id="WP_013952312.1"
                     /db_xref="GI:503718236"
                     /translation="MHDNQASAAAAFTPVRIGPLTLRNRLIKAGANEGMTPQGLPTQA
                     LVRHHRELAAGGVGMTTVAYAAVADDGLTFSHQLSMRPEQVAPLRVLTDAVHREGAAA
                     CLQITHAGSFTTMRHGGSRAPGSASAGLNAFGMLHGVYFQRAMREADMARVAGQFAAA
                     ARLAREAGFDAVEIHMGHGYLLNQFLSPLSNRRRDAFGGGVENRTRFPAAVLRQVKDA
                     VGAELAVCCKLSVSDGVPGGNEPADSAVTARLLEAEGADLLTLSGGRNVESPWALFGS
                     PMPTAQMKAAAPTAVARFGITMLEKRTPRALAFRELYFLEASRVVRRAVRMPLAYIGG
                     VKSIGNVAQLMEEGFDCVALARALIHDPALVANWRSGAVAHSACDSCNGCVARIYDPA
                     GVSCVHGPGNDPALTRIAALQ"
     gene            655306..656361
                     /locus_tag="CNE_RS21135"
                     /old_locus_tag="CNE_2c06190"
     CDS             655306..656361
                     /locus_tag="CNE_RS21135"
                     /old_locus_tag="CNE_2c06190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketosteroid-9-alpha-hydroxylase"
                     /protein_id="WP_041228804.1"
                     /db_xref="GI:752557572"
                     /translation="MESRPPEARFARGWHCLGLADGYRDGVPHTLNIFGRRLAAFADS
                     TGAIRVIDGYCPHMGADLSTGTVQGDNLVCPFHGWQWGGDGGCKSIPYCKRVPPKARV
                     GAWETCEQNRLLFIWHDPEGRPAPPEVAIPRIEACFSSDWSDWAIDEMLIRTNCRELV
                     DNISDMAHFGTVHGAPVDYFANLFEDHKATQLMIGRSARLSGDAQLTALSTYFGPAYH
                     ITEMSGQMGDQQIHSILLNCHVPIDLNSFALRYGVLVKKIPGLSEEQNRAMAQAYVEQ
                     AKQAFYEDVAIWDSKIRIDNPLLCEGDGPIYQMRDWYQQFYTDVEQVRPSSVARRTFE
                     LNPGGIEPPALRHVFEA"
     gene            656388..657179
                     /locus_tag="CNE_RS21140"
                     /old_locus_tag="CNE_2c06200"
     CDS             656388..657179
                     /locus_tag="CNE_RS21140"
                     /old_locus_tag="CNE_2c06200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-alpha-hydroxysteroid dehydrogenase"
                     /protein_id="WP_041228560.1"
                     /db_xref="GI:752557328"
                     /translation="MKTVVITGAASGMGAAVRQRMLADGCRVIGIDLRDADILADLSN
                     PQGRAAAIDAVLSRSGGRIDQLVCCAGLGPHVEPATLVASVNYFGVVALLDGLFEALR
                     QGSDPCAVVVSSNSATLQSWEGSPLRDAYLAGDESGVRAMVAAAAAAEATRDQAGYIA
                     YASSKHAVAAAARQRAAAWGQAGVRFNVVAPGAVETPLLQAGLKDPRYGDAIRDFLPP
                     LGRRAQPEEVAALIVFLCGPQAAYIHGNVVFIDGGLDAAQRPLNF"
     gene            complement(657480..658859)
                     /locus_tag="CNE_RS21145"
                     /old_locus_tag="CNE_2c06220"
     CDS             complement(657480..658859)
                     /locus_tag="CNE_RS21145"
                     /old_locus_tag="CNE_2c06220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952316.1"
                     /db_xref="GI:503718240"
                     /translation="MKSSTRQLIRGGLLLTSMALAAASWAKVTPEELKQLDGPLTPMG
                     AERAASKDGEVPAWSGKWLGTPAHVKYQRGERYPDPYADEKPLFVITAQNMAQYAERL
                     SDGQKALFKKYPDTFKMPVYPSHRDFRYEDAVYKDIRTYAATVSMTSDANGLKEAGPQ
                     VPYPIPKTAMELLWNQRFSSAIGTEKAQFDQAVVYPNGSIAWGRVSYSILSPRNNGKF
                     DPHNAINERSFFRTATDLPLRDRGQVIVGYAVWDQEGSDTNRTWIYNPGTRRVRQAPE
                     FGFDQPQGPGGFRTVDDDRLFNGSGERYNWKIVGKKEIFVPYHNYKLLSTSVKYKELL
                     TNGHANPDVMRYEPHRVWVLEATLKSGFRHQYAKRVLYLDEDSWLALAADNYDGRGQL
                     WRTNLQASVYTYDARRYYPTTVFYHDLISGAYLADRLTNEGPMATLNNSPEFNEAFFS
                     PDAARGSGT"
     gene            complement(659175..660302)
                     /locus_tag="CNE_RS21150"
                     /old_locus_tag="CNE_2c06230"
     CDS             complement(659175..660302)
                     /locus_tag="CNE_RS21150"
                     /old_locus_tag="CNE_2c06230"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952317.1"
                     /db_xref="GI:503718241"
                     /translation="MDFTYSEEQQMLADSLRRFIDTEYTFEARRKSARAGESLDRGMW
                     NKLAEMGVLGLTVPADFGGFGEGPASQLVVQRELGRGLVLEPVTPSGVMAAAILAAHG
                     SAAQKEEWLPAIASGERIVTLAYLEPTTRYRPESARASAERSGDGYVLNGIKSVVWHG
                     GAADAYLLTARVAGSNEIALFLVPRDSKGLGVTAYPTIDGLRAADLSLQDVTVPASAL
                     VGEPADGLAALGVGLEHGVAALCAEGAGAMEKLIEITAEYLGTRQQFGKPLASFQALQ
                     HRMADMLVQKELALSMAYVAVQALDEADPATRRRMLSAAKVTLARAGRFVGQQAVQLH
                     GGMGMTDELSVGDYFKRLTMLDQLLGDSDFHLQRFGEVMEA"
     gene            complement(660316..661509)
                     /locus_tag="CNE_RS21155"
                     /old_locus_tag="CNE_2c06240"
     CDS             complement(660316..661509)
                     /locus_tag="CNE_RS21155"
                     /old_locus_tag="CNE_2c06240"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952318.1"
                     /db_xref="GI:503718242"
                     /translation="MDLRFTAEEQAFREEVRTFAQASLPEDIRNKVLNHQRVEKDDYI
                     RWHRILQARGWGAPTWPRQWGGTGWTALQRLIFEIETFRAGAPRMLPFGLTMIGPVLM
                     KYASPEMQQRFLPRIPNIDDFWCQGYSEPGSGSDLASLKTRAVRKGDKYIVNGQKTWT
                     TMAHFADWIFCLVRTDPEAKAQEGISMLLIDMKSPGVTVRPIKTLDGGHDVNETWFED
                     VEVPVENLVGEENRAWTYAKYLLGHERTGIAGIGHCHRELRLLKHYASQATDGAGRPL
                     IEDVRMRDKIARVEMDIMALEMLLLRVATQAAGTPGPEASIVKIRGSEVQQDLGMLMM
                     EVAGPNAWPYSPDWLEPGATQPVAGPDWAAPAASTYYDMRKTSIYGGATEVQKNIISK
                     MILGF"
     gene            661854..663374
                     /locus_tag="CNE_RS21160"
                     /old_locus_tag="CNE_2c06250"
     CDS             661854..663374
                     /locus_tag="CNE_RS21160"
                     /old_locus_tag="CNE_2c06250"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018312993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_013952319.1"
                     /db_xref="GI:503718243"
                     /translation="MSSFRPEYIHDIPRYWAAQTPDAPCLHENGAVISYGELWRRIEA
                     ARDWLAAQGVGEGDRVMVVGENCNEMVVTLFASSLLHAWPIQVNARLSAREIDNIRDH
                     AQPALVLFTGHVSDVAAAHGERLGAQATGCPVFDAGMRVVRAATPPQREPAGLARSVA
                     TLIYTSGTTGAPKGVMVPHAGLTQFARISATSRDMGPADVAYGALPMSHIFGIATVLM
                     ATLYAGASLFLRPRFDANEVFESLASPGVTILQGVPTMFTRLMAVAPTVGAKPGAYPR
                     LRYLYTGGAPLDPTLKREVETLFGQALHHGYGITEYAGSLFITRMEAPRADCSAGYIV
                     EGVEIEITDAEGKPLPAGERGQIRVRGPGVMLGYYHNPEQTAEALLPGGWLNTGDLGY
                     LDADGALFISGRSKDLIIRSGFNVYPIEVESVINAFPGVRQSAVVGRTTADGNEEVVA
                     FIEMQDGAELDRKALDTYLRESLAPYKRPAEVRTVEVIPTTASGKLLKQPLRALLD"
     gene            663432..664403
                     /locus_tag="CNE_RS21165"
                     /old_locus_tag="CNE_2c06260"
     CDS             663432..664403
                     /locus_tag="CNE_RS21165"
                     /old_locus_tag="CNE_2c06260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952320.1"
                     /db_xref="GI:503718244"
                     /translation="MKTWTTLAALTATLLLQGAAWAADAYPSRPVKLLVGYAPGGPVD
                     TAARIYAEQLGRALKQPVVVDNRAGASGAIAADMTAKAAPDGYTLYFVASPTMTMTPL
                     IQHSVNFNPVKDFTYIGLITDYTNVLLVNKDFPAKNVGELVDYARKHPEGVSFGSAGI
                     GASNHLSAELLAQMNNVKMLHVPYKGNAPAMADVMSGKVTFMFDITGTAIGHINGGKV
                     RALAVTSKTRNPALPNVPTMIESGQKDYDLTGWYALVGPQKLPADVVDKLVKAQKAVG
                     EDAAFRQRMTAGGYDVNISTPKALGDRIQRELALWGGVVKAAKIQAD"
     gene            complement(664686..665945)
                     /locus_tag="CNE_RS21170"
                     /old_locus_tag="CNE_2c06270"
     CDS             complement(664686..665945)
                     /locus_tag="CNE_RS21170"
                     /old_locus_tag="CNE_2c06270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013952233.1"
                     /db_xref="GI:503718157"
                     /translation="MPRKTKTSQAADRELPAIPEDLIAHFVKGPMTAEAVQDASMAFK
                     KALIERALGAELGHHLGYQPGAERPAGTANQRNGKSAKTVLTEDGPLRVDIPRDRDGS
                     FDPILIPKHERRFTGFDDKIIAMYARGMTVREIQAFLAEQYGTEVSPEFISSVTDAVM
                     DEVTAWQARPLEVMYPVVFFDALRVKMREDGVVRNKAVYLALGVLPDGTRDILGLWIE
                     TTEGAKFWMKVFNDLKTRGTQDILIAVTDGLKGMEQALAAVFPNTTLQTCIVHLIRNS
                     LEYASWKERRAVAAALKPVYTAPTVEAALAELAAFEQGEWGKRYTPIAASWRRAWDQV
                     IPFFTFPPAIRKIIYTTNAIESVNAQLRKIIKTRGHFPSDEAATKLLWLALRNITGKW
                     GSSTHDWKAAMNQFAILYEERFTHPHR"
     gene            666362..666586
                     /locus_tag="CNE_RS21175"
     CDS             666362..666586
                     /locus_tag="CNE_RS21175"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228561.1"
                     /db_xref="GI:752557329"
                     /translation="MLLNLLDQADAVARGAACVLTLVTHSECDAQEEGSVALRPATLD
                     ALRGLCRASLGLLADRVEEVAEGIEEAMVG"
     gene            666871..667209
                     /locus_tag="CNE_RS21180"
     CDS             666871..667209
                     /locus_tag="CNE_RS21180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytoplasmic protein"
                     /protein_id="WP_041228562.1"
                     /db_xref="GI:752557330"
                     /translation="MEKEIRWVGSAYNDLLAFPAEARQQAGFQLGKVQAGLEPEDWKP
                     FDDIGTGTREIRLRDAGGAFRVMYVAKFEEAVYVLHCFQKKTQATNLKDKRIAEARYR
                     AIANARKGKS"
     gene            667206..667541
                     /locus_tag="CNE_RS21185"
                     /old_locus_tag="CNE_2c06300"
     CDS             667206..667541
                     /locus_tag="CNE_RS21185"
                     /old_locus_tag="CNE_2c06300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_013952323.1"
                     /db_xref="GI:503718247"
                     /translation="MKIDTEIRHVTKPGANLFLELGFSPEEAKRLQAASKKQINDTKL
                     LKEQLMAELAAWIEQHHLKQAEAAEILRVSRPRVSDVVNRKTAKFTIDTLVEMLSRIG
                     KPVRLAIGR"
     gene            complement(667734..668600)
                     /locus_tag="CNE_RS21190"
                     /old_locus_tag="CNE_2c06310"
     CDS             complement(667734..668600)
                     /locus_tag="CNE_RS21190"
                     /old_locus_tag="CNE_2c06310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018315441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952324.1"
                     /db_xref="GI:503718248"
                     /translation="MTDATPELERLRGWIGRSESRTETLSPEPVTGLAATFDLDPEAV
                     AAGPLPPLWHWLYFLPRAPQHELGRDGHPTLGGFMPPVPLPRRMWAGSELTFGHPLHI
                     GDTVTRTSTIKDVQYKTGRTGELWFVAVDHELTVNGKTAVNERHDIVYRAMPDPSKPQ
                     PPRPRLEQTAQWQRTLQADPVMLFRYSALTFNGHRIHYDRQYTREVEGYPGLVVHGPM
                     QAMLMLDLVAREQPQARVRRFGFRGLAPLFDQDTIIVGGAADPAQAGRLVLWTGDNAG
                     GQAMQGWAEVEG"
     gene            complement(668643..669461)
                     /locus_tag="CNE_RS21195"
                     /old_locus_tag="CNE_2c06320"
     CDS             complement(668643..669461)
                     /locus_tag="CNE_RS21195"
                     /old_locus_tag="CNE_2c06320"
                     /EC_number="4.1.3.34"
                     /EC_number="4.1.3.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="host specificity protein"
                     /protein_id="WP_013952325.1"
                     /db_xref="GI:503718249"
                     /translation="MSTAVTYLFVPGDRPERFDKAAAAGPDVMILDLEDAVHPDAKPA
                     AREAIAAWLAGRPAANAFVRINDSASQSFAADLAWLRALPPGTALAGLLVPKAEDAAA
                     LATIAQALHAINPQGELVAIIETALGLHQIDAVATGVARLAFGSLDYAVDLGCSHTRD
                     ALAFARARIVLASRVAGLPPPVDGVTTALKDEAVLASDVAYARELGFAGKLCIHPAQL
                     GAVRAGFLPSPEQLDWARRVLEATASGSHAVQVDGKMVDRPVIEQARRLLALAQ"
     gene            complement(669472..670854)
                     /locus_tag="CNE_RS21200"
                     /old_locus_tag="CNE_2c06330"
     CDS             complement(669472..670854)
                     /locus_tag="CNE_RS21200"
                     /old_locus_tag="CNE_2c06330"
                     /EC_number="4.2.1.79"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate dehydratase"
                     /protein_id="WP_013952326.1"
                     /db_xref="GI:503718250"
                     /translation="MSQPADTTYPTRQLCDFLADLKLADVPAPVIERTKDLFLDWIAS
                     AIAGKDAPAVRKLQEFAAAMGPAQGGAEVLVDRRRTSPYFAALINGASSHVVEQDDVH
                     NGSVLHPAAVVFPAVVAAAQAEGKTGAEVLLASIAGYEAGIRIGEFMGRSHYRVFHTT
                     GTVGTLAAAAAVAKLYGLDAEGINQALGSAGTQAAGLWEFLRDAADSKQLHTAKAAAD
                     GLQSAWLARAGFTGAKQILEGAQGMAAGMSSDANPACLTDGLGTRWATAETSFKFFAS
                     CRHTHPAADALKALMEREGISADQVASVTTHVHQGAIDVLGPVVNPTTIHQAKFSMGT
                     VLGLVAVHGHAGLGEFEQHALQDPKVTAFRGKVGMELDAEINAAYPRQWIGRVTVRTT
                     DGRTLAARVDVPKGDPDNTLSRPELEAKALQLGAFRHGASDAEMRAIIQRVWALEQAP
                     NVNDWLPAAG"
     gene            complement(670930..672129)
                     /locus_tag="CNE_RS21205"
                     /old_locus_tag="CNE_2c06340"
     CDS             complement(670930..672129)
                     /locus_tag="CNE_RS21205"
                     /old_locus_tag="CNE_2c06340"
                     /EC_number="5.1.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013952327.1"
                     /db_xref="GI:503718251"
                     /translation="MSHSPKGIRPLDGIRVVSLEHAVAAPFATRQLADLGARVIKVER
                     PGAGDFARGYDETVHGQASHFVWLNRGKESLTLDLKQDEAQKVLHQLLADADVLVQNL
                     APGAAARMGLDFDTLHARYGKLVVCDISGYGDAGPYRDKKAYDLLIQAAAGLIGITGG
                     PDEPSRAGISIADIAAGMYAYTGILSALLQRGRTGEGVRVEVTMLEALSEWMGYALYF
                     GHYGGTPPARFGASHPAIAPYGVHRTGDGGSVIFGLQNEREWRAFCEKVLEQPELLQD
                     ERFATNSGRVKNRPAMTEIIEHRFAAMTVSQAEALLDAAQIANAPMNDIEAVWNHPQL
                     AARNRWREVAVPGGTIGALLPPANLSGVEPVMGDVPALGAHSRQILAELGYADSDIAA
                     LADKQTI"
     gene            complement(672139..673308)
                     /locus_tag="CNE_RS21210"
                     /old_locus_tag="CNE_2c06350"
     CDS             complement(672139..673308)
                     /locus_tag="CNE_RS21210"
                     /old_locus_tag="CNE_2c06350"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011299667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952328.1"
                     /db_xref="GI:503718252"
                     /translation="MHAHQDPDQLYPEIREAVRDLCAGFDSAYWQRVEEQNAFPETFV
                     QALTQAGWLSALIPEAYGGSGLSLTAASVIMEEINRSGGNSGACHGQMYVMGCLLRHG
                     SEAQKQRWLPGIASGELRMQSMAVTEPTTGTDTTKLKTTAVRQGDKYIVNGQKVWISR
                     VQHSDLMLLLARTTPLDQVKRKSEGLSVFVVDLRDAIGKGLTVKPIRNMVNHETNELF
                     FDNLEVPAENLIGEEGKGLKYILDGLNAERILIAAECIGDGYWFVERASNYARDRIVF
                     DRPIGQNQAVQFPIARSYINVEAASLMRYKASQLFDAGKPCGKEANISKLLAADASWE
                     AANVCLQTHGGFGFAAEYDIERKFRETRLYQVAPISTNLILSYVAEHVLELPRSF"
     gene            673808..674275
                     /locus_tag="CNE_RS21215"
     CDS             673808..674275
                     /locus_tag="CNE_RS21215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_041228563.1"
                     /db_xref="GI:752557331"
                     /translation="MDGVWSEIFRVLRAEFADVPDAAEATRILTRLFMAMLLGGLIGY
                     QREVSGKAAGLRTHMLVALGSALFVLVPLQAGVPLGDISRVLQGLIAGIGFLGAGAIL
                     KHSDEAHIEGLTTAASIWMVAAIGVAAGLGRDTTALIATIFTLVILQVLHRWK"
     gene            674471..674977
                     /locus_tag="CNE_RS21220"
                     /old_locus_tag="CNE_2c06370"
     CDS             674471..674977
                     /locus_tag="CNE_RS21220"
                     /old_locus_tag="CNE_2c06370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952330.1"
                     /db_xref="GI:503718254"
                     /translation="MKSSIRDDAALAAFVGPRYAYYSQRWSLAETRGGMSWNWAACLL
                     GPFWMAYRRMYWQVGVFALIVCAEPVLHALFGLKMPLAVRPMLYAMALLLGMYGNQIY
                     RWHAEATIRHLREYHFSPELVYDSLARSGRTSWPGVFAMALLLVVMAVSLSPLAGLVV
                     QGSGLASG"
     gene            complement(674999..675901)
                     /locus_tag="CNE_RS21225"
                     /old_locus_tag="CNE_2c06380"
     CDS             complement(674999..675901)
                     /locus_tag="CNE_RS21225"
                     /old_locus_tag="CNE_2c06380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010813949.1"
                     /db_xref="GI:498513520"
                     /translation="MHYDLTDLRLFLNVGETENLTRAAERSFLSLPAASTRIKQLEEA
                     FQTQLLIRQVKGVRLTPAGDALLRHAREVFRELECLHADLRPYAKGVKGRVRLLANTT
                     ATNSFLATGVSRFLSENPDVDIELEEHLSQEIVSAISAGAADLGIVAGEVATQDLDAM
                     HLCSDELIVIAPVNHPLPAFKRLHFADLLDTCRFVGLNQFSAIQSFLDRIAGGMGKRI
                     SLRIQVGSFDAVCRMVEAGAGIAIVPNSCARRYASRKVLRFIQLEDEWAKRELRLVRR
                     PGRELPQFAETLIQYLVDAAREPV"
     gene            676092..677006
                     /locus_tag="CNE_RS21230"
                     /old_locus_tag="CNE_2c06390"
     CDS             676092..677006
                     /locus_tag="CNE_RS21230"
                     /old_locus_tag="CNE_2c06390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_013952331.1"
                     /db_xref="GI:503718255"
                     /translation="MSGLMAGKVALVTGAGGGIGRGIALELAAAGAKVVVNDLGVSMT
                     GEGGDAGPAQRVVEEIRAAGGEAVANTDSVSTWNGANAIVQCALDNFGRIDAVVNNAG
                     NLRDRMFFKMNEEEWRSVIDVHLHGTFFVSRAAANYFKDQESGAYVHMTSTSGLIGNL
                     GQANYSAAKLGIAALSKSIALDMQRFNVRSNCIAPFAWSRMTSSIPAETPEEKARVAK
                     LQKMEAGKIAPVAVYLASPAASEVNGQIFAVRANEIILMSQPRPVRSVHMSDGWTPET
                     VGEIAMPAMRSSFFKLERSPDVISWDPI"
     gene            677006..678249
                     /locus_tag="CNE_RS21235"
                     /note="CoA-transferase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            678396..678602
                     /locus_tag="CNE_RS21240"
                     /old_locus_tag="CNE_2c06420"
     CDS             678396..678602
                     /locus_tag="CNE_RS21240"
                     /old_locus_tag="CNE_2c06420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010813946.1"
                     /db_xref="GI:498513517"
                     /translation="MNEETFNLSIRKFLKVVGVSSQREIEQAIARAMADGTIAGNEHL
                     PVSVTLELAGVKLQARFEGEIQLE"
     gene            678908..681103
                     /locus_tag="CNE_RS21245"
                     /old_locus_tag="CNE_2c06430"
     CDS             678908..681103
                     /locus_tag="CNE_RS21245"
                     /old_locus_tag="CNE_2c06430"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013952332.1"
                     /db_xref="GI:503718256"
                     /translation="MHAAATTPARNIEDTGWNLPDPPGRHARPDDPLLACLLWLARRF
                     QRPVAAEALIAGLPLEADRLTAALFPRAAARAGMSARLVKRPLDDIPDLVLPAILLLD
                     QSEACVLLRRGDEGMLLVSQPEWGDGEQPVRQEDLLARYTGHAIFARPAHRFEAAGDA
                     GPASPHGWFWGVMRQSWPLYGEVLVASLLLSLFALVMPLFTMNVYDRVVPNHALETLW
                     ALAIGVGLVLGFELVMRTLRGYFVDVAGRRIDVTVSATVFEKVLGIEMKARPASVGSL
                     SSQLHEFESVREFLTSATITTLVDLPFAAVFIAAMFWVGGPLAWVPLLAVPLVIGTSL
                     LLQGPLSRAVRASSACAAQRQAALVETLVGLETIKTSGAEGAAQRKWEQVVGQMAQLG
                     LRARLLSACVINLSLFVQQAATLVVVVIGVYLIADDRLTTGGLIACTILAGRALAPLS
                     QVAGLTTRYHQARTALAGIDRMMALPVERPPGKHFLHRPPLRGEIEFRQVSFRYPGRD
                     IAALDGVSFRIGSGERVGLIGRIGSGKTTIEKLILGLYAPDAGTVLVDGAEVRQLDPA
                     ALRRDIGYVPQDVMLFSGTLRDNIVMGAPYADDEAVLRAARLGGVSDFVDRLPDGYDL
                     RLGERGEGLSGGQRQAIAIARAELLQPPLLLLDEPSSAMDNRTEEQFKARLALALGGR
                     TLILVTHRGSLLSLVDRLIVMDQGRIVADGPKAEVLNALAGRKLHVASA"
     gene            681114..682475
                     /locus_tag="CNE_RS21250"
                     /old_locus_tag="CNE_2c06440"
     CDS             681114..682475
                     /locus_tag="CNE_RS21250"
                     /old_locus_tag="CNE_2c06440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_041228805.1"
                     /db_xref="GI:752557573"
                     /translation="MGPVRRLIAALRPRADDTAFMCERDAAALAQPRYFTHWILWSAL
                     VFVLVALAWAALAQVDEVAVGEGKVIPSSQVQVVQNLEGGIIAEIMVRPGQVVNKDQP
                     LMRIDDTRFTASYQEGRTRDDALVARIARLSAEADGTAFVASAPADAEGRRFVSEERA
                     LFESRKRAFDANLAVLRQQSEQRRQELTEKRSREQQLRQSHRLVAQELAMMRPMVAQG
                     VVSEVDLLRLERQANDLKGELEAARLAMPRLEAAYRESQQKADELGTHYRAEAMKELN
                     QAKAEQAAQSATNTALQDRVDRTLVRAPLAGVIKQIKINTVGGVVQPGMDLLEIVPLE
                     DTLLVEARVRPADIAFLRPGQPAVVKLSAYDFSIYGGFAGTVEHISADTLTPERPGER
                     PESYYLVRVRTRDNRPGGSAVQVPILPGMVATVDVLTGQKTVLHYLLKPIIKTRELAF
                     RER"
     gene            682551..689552
                     /locus_tag="CNE_RS21255"
                     /old_locus_tag="CNE_2c06450"
     CDS             682551..689552
                     /locus_tag="CNE_RS21255"
                     /old_locus_tag="CNE_2c06450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RTX toxin"
                     /protein_id="WP_013952334.1"
                     /db_xref="GI:503718258"
                     /translation="MATLTGSNGSDSISGTTSADTILSGNGNDYVSAGDGNDYVDAGN
                     GDDIVEGGSGDDTLLGANGKDRVFGGLGNDNLSGGNGTDAVYGGSGDDVIGSIDGSSA
                     LYTGDNGGDTLYGDGYDSYADYLLGAGHESARPGNDRIYGGNGDDLIYGDNGNNAALG
                     GDDIIAGGNGKDTIYGEGGNDKISGGAGGDTLSGGSGADVFVYNAVSDSTAAGMDVIT
                     DFQRGVDHLDLRPVLGDAGFEWGGRQPTAHGAWFQQSGGNTYVYVDVDGNPATAEMVI
                     KLNGLHELTKSDFAGYDNHAPTAVADTHAIGENNSPNPITGNVLSNDSDVDAGNVLAV
                     ANPGTYAGQYGTLTLHADGSYSYELDNGKGQVQALRQGQQVQDTFNYEVSDGQAGAAS
                     SLSIRITGANDGATITASASEDKAVTEAGGAGNAETGDASASGKLTVTDVDTGEAHFA
                     AVAPESLAGQYGTFAFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQSAQQTI
                     KVDITGANDHATISASANEDKAVTESGGAGNTDPGDASASGKLTVTDVDTGEAHFAAV
                     APESLAGQYGTFAFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQSAQQTIKV
                     DITGANDHATITASASEDKAVTEAGGAGNTDPGDASASGKLTVTDVDTGEAHFAAVAP
                     ESLAGQYGTFSFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQTAQQTIKVDI
                     TGANDHATITASANEDKAVTEAGGAGNTDLGDASASGKLTVTDVDTGEAHFAAVAPES
                     LAGQYGTFSFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQSAQQTIKVDITG
                     ANDHATITASASEDKAVTEAGGAGNTDPGDASASGKLTVTDVDTGEAHFAAVAPESLA
                     GQYGTFSFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQTAQQTIKVDITGAN
                     DHATISASASEDKAVTEAGGAGNAETGDASASGKLTVTDVDTGEAHFAAVAPESLAGQ
                     YGTFAFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQTAQQTIKVDITGANDH
                     ATITASASEDKAVTEAGGAGNTDLGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYG
                     TFAFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQSAQQTIKVDITGANDHAT
                     ISASANEDKAVTESGGAGNTDPGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYGTF
                     AFDSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQSAQQTIKVDITGANDHATIT
                     ASASEDKAVTEAGGAGNTDPGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYGTFSF
                     DSNTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQTAQQTIKVDITGANDHATITAS
                     ASEDKAVTEAGGAGNTDLGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYGTFSFDS
                     NTGAWSYTLDNTKADALIAGQQVSDSLTVSSADQTAQQTIKVDITGANDHATISASAS
                     EDKAVTEAGGAGNAETGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYGTFNFDSNT
                     GAWSYTLDNTKADALIAGQQVSDSLTVASADQTAQQIIKVNITGANDHATISASANED
                     KAVTEAGGAGNTDLGDASASGKLTVTDVDTGEAHFAAVAPESLAGQYGTFTFDTNTGA
                     WTYTLDNSKVQFLAAGQHVTDSLSVQSADLTATQAITVNITGANDAAVNAMPTAQVVN
                     EDAPLVFSTTNGNALSISDVDNGSHTVTLSATSGTISLNGFAGLQFLAGDGTSDSTMT
                     FTGSDAAINAALNGLRFVGDKDYAGAATLQMQTSDGASVDSDSVAIAINPVNDAPVAA
                     ADVIYASNNTNGILIPVSALLGNDGDVDGMALSVIALGSATGAVSNLAFAPGTNNSYV
                     MFNTDNGASGSFSYTIYDGAGGTSTATVTVNVSSTNGSADVSLAGLNYQASYLDGGSN
                     SDALTGGATGDVFIGGNAADTLKGGTGDDVLRGGIGDDTLDGGTGIDMLDFSDASGAV
                     TFTLTQSGSGTLVNLTSVGLDRDTYSNMEGVIGSRFSDTLTGSSSGDIIRAGAGNDTI
                     DGGAGIDLLDFSDATGAISLTLTQSSSATALNLVAVGLGTDSYKNMEGVIGSAFNDNL
                     IGSSGIDVLRGGAGDDNLTGGGGNDTLIGGAGVDTLTGGAGSDTFAFLRADSASVDKV
                     TDFDRAPVAAGGDVLDLSDLLSGVTVTAANAGQFIRLSEVDGNTVVSLDRDGSGTAAA
                     FQDVAVLQGVVGLDLNTLLSNGNIHTA"
     gene            689719..691071
                     /locus_tag="CNE_RS21260"
                     /old_locus_tag="CNE_2c06460"
     CDS             689719..691071
                     /locus_tag="CNE_RS21260"
                     /old_locus_tag="CNE_2c06460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="channel protein TolC"
                     /protein_id="WP_013952335.1"
                     /db_xref="GI:503718259"
                     /translation="MTTTWCRLAHVLLWAAMVVPHHAAAQALRQAVEQAVHTNPEVLA
                     AGSRRLAADEGLTQARAGYLPRVDVNAATGRVRLDSHSTRLMGLSDSSYASHAAGVTI
                     SQMLFDGFATSSDVERQGARIDGAAYRVGATAEDIALRTVGVYVEVLRRQETVVIGLA
                     NLEAHQHIYDQIRLGADNGVLRRADLYQVESRLALAKASLRAEQGSLQDAMTAYLRVV
                     GAPPEALSRPDSLSTLLPATEREAQQVANANHPALGAGQADIAEALAGRSLAKSALWP
                     RLDLEVGVARDRDRVLGTTDERSVMLRVRYNLFRGNADKARINEAGYQVQEAEQNLDR
                     LRRQVQEAVSQAYNAHLTAQDRLVSLKQYVEASDATRVSYGKQFRIGQRSLLDLLNAE
                     NEYFSARTAYVTGQYNELASQYRILAGMGLLLATLQVPPPQTGMVQVGQWAAPPVGQR
                     "
     gene            complement(691145..692326)
                     /locus_tag="CNE_RS21265"
                     /old_locus_tag="CNE_2c06470"
     CDS             complement(691145..692326)
                     /locus_tag="CNE_RS21265"
                     /old_locus_tag="CNE_2c06470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013952336.1"
                     /db_xref="GI:503718260"
                     /translation="MHTAVLSSLRPPVPGKLHLAGSALPPALGHGHAPGCAEAPATPA
                     QAAPQASARHTIAIQHVDHILLGPRRLGHDIAALLRRAGISPALLASPNARVTQGQYA
                     ALIRTLRRVMRDELWGLLDRPVTPGVFAQACRNLIHCATLEDAIRAGLRLYRLHIDAF
                     APRLHVSADGKTASVVLHPRAPASACRSFAESTFVFHAYALLSWLVASHIPLARVDLS
                     AAPSQGGPETERVFKTAVHYGQPVSVLHFDAASLRLPVMQDAASLRAFLRETPRNLLI
                     RYRDNSCLAERIRQHLRSHLDDELPSLEQMAQVLRLTPQTLRRRLRDEGSGYQSIKDS
                     LRRDVAIGMMERPGMTLQDVALRLGFSEPSTFHRAFKKWTGVAPGEYRMRGLRGEAVP
                     G"
     gene            692645..693637
                     /locus_tag="CNE_RS21270"
                     /old_locus_tag="CNE_2c06480"
     CDS             692645..693637
                     /locus_tag="CNE_RS21270"
                     /old_locus_tag="CNE_2c06480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952337.1"
                     /db_xref="GI:503718261"
                     /translation="MQADRRSALWRFGAGLLAVAGVLGAGAAFAQGQFPSKTVRLVVP
                     YPAGGATDVLARAIADGLGKAWSRPVVVENRPGASSMIGSEAVARAEPDGHTALLTIT
                     TLVQAPSLYAKPPVDPVKDFAAVSELGTTNLVFAVHNSVPVTSLKEFIELVRAKPRQF
                     SYGSYGTGSSGHLYGEIFKESAKLDMVHVSYKGEAPELNDLLGGQVPAAIISVMGAKP
                     HNASGRLRALAVTGGGRSPQLPDVPTFREAGVAGMDGLGWFGLFLPAATPRAIVDKYS
                     ADVNRVLTQPDIRKRMNDMGIVLTGSTPDAFAQTVQADYARWGKVIRTNNIRLD"
     gene            693672..695384
                     /locus_tag="CNE_RS21275"
                     /old_locus_tag="CNE_2c06490"
     CDS             693672..695384
                     /locus_tag="CNE_RS21275"
                     /old_locus_tag="CNE_2c06490"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952338.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_013952338.1"
                     /db_xref="GI:503718262"
                     /translation="MKPATSTNQPFRSPAWPPGLPAALHTPRTSLFYNVEAAAHRYPD
                     KTAIQYFGTAISYAQLQDEIERMAGYLQQACGIQPGDRVLLFSQNCPQFIIAYYAILR
                     AEGVVVPANPMWLEVELAHVVQDSSAVAAFAGSELYQRVAPLHGPALRHVILHDYAGM
                     LRDDGGLAVPAWLREPLPAPQAAPSGAMPVAWDAASAAGHRPLPHQAGYDTLCMLAYT
                     SGTTGHPKGCMHSHGTLMTAAAGSVIWRGATPESVVLAVAPMFHLLGMQNCMNSPLYL
                     GATVVLMPRWDRALAADLIERYRVSVWGAPPAMMVDFFSQPGIDARDLSSLAYVGGGG
                     AAMPEAVANMLQERFGLPYVEAYGMTETAAFILSNPRNQPKRECLGIATFGVDARVVD
                     PETLQELPHGETGEIVVHGGQVMQGYWHNPEANAATFIEIGGKRFLRTGDLGFMDEEG
                     YFFMRDRLKRMINASGYKVWPAEVENLLYGHPAIHEACVIAARDQRRGETVKAVVALR
                     PEARGTAEADPERIMAWCREHMAAYKVPRIVDVVDALPKSATGKILWRALQEREMQAD
                     NPSA"
     gene            695419..696402
                     /locus_tag="CNE_RS21280"
                     /old_locus_tag="CNE_2c06500"
     CDS             695419..696402
                     /locus_tag="CNE_RS21280"
                     /old_locus_tag="CNE_2c06500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952339.1"
                     /db_xref="GI:503718263"
                     /translation="MQQSRRNWLAQAGTLAGAAILGGAGSAFAQQPYPGKPIRMIVPY
                     PAGGGTDTVGRLIGQRLAESLGQPVVVENKPGASGMLGNDTVAKAPADGYTILLAITA
                     LIQSPALYKRTPYDVARDFTPVSLIAKSSDLFVVPNRVPASNMREFLALAKAGKLSYG
                     SYGNGTSSHLHGELLKQQAGIDLVHIPYKGAAPLMSDLLGGQVDSAFVDVTSANPYLG
                     SNKFKILGITGTQRYKALPNVATFTELGLPGFEPNGWYGLFLPANAPKDVTAKLAAET
                     ARIVRLPEVTQKLAGMGLQPVGSTPQELAAVVTGDTPKWARIVRDANIQLD"
     gene            696427..697206
                     /locus_tag="CNE_RS21285"
                     /old_locus_tag="CNE_2c06510"
     CDS             696427..697206
                     /locus_tag="CNE_RS21285"
                     /old_locus_tag="CNE_2c06510"
                     /EC_number="4.2.1.55"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013952340.1"
                     /db_xref="GI:503718264"
                     /translation="METIRFAVEDGVATLTLDSPARKNALSLPMRDEIGEVIRRVRAD
                     DSVRALILTAAGTDFSSGGDISSMQVEINAEQGRKRLHKVHGWLEDLIQLDVPVIAAV
                     DGAAYGAGFSLALTADIILATPRARFGLPFLRMGLIPDCGVLYTLPRMIGLQRAKALM
                     FSMRELNAQAAQDLGIVMEIVPADSLQERARALAQAFTEASPVAVGLTKQALNASLNQ
                     DLHTMLAMEADGQGIAFSTAYRREAADRFMAKQPLRYRWPD"
     gene            697333..698520
                     /locus_tag="CNE_RS21290"
                     /old_locus_tag="CNE_2c06520"
     CDS             697333..698520
                     /locus_tag="CNE_RS21290"
                     /old_locus_tag="CNE_2c06520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_041228807.1"
                     /db_xref="GI:752557575"
                     /translation="MGSHDQHTAPAVRQTPWMTEDLGMFQETVRRFIERELAPNEARW
                     ADQGYIDREVWRRAGQIGLLCASIPEEYGGGGGTFAHEAVITQEMSRAVCTSLGNNVH
                     SGIVAHYLLNYGTEAQKKKWLPQMASGEMVAAIAMSEPGAGSDLKAIRTRAVREQTEN
                     GDCYRINGAKTFITNGYHADLVCVVAKTDPEAGSRGVSLVMVETRDLPGFRRGRILEK
                     IGQKGQDTAELFFDDVLVPCANLLGTQEGQGFYQLMQQLPQERMIIALGAVATMQRAI
                     ELTTEYVRQRKVFGQPLADLQNTRFKLAECKTVATIAATFVDDCMLRLMDGKLDAATA
                     AMAKWWCTQQNCQVIDECLQLHGGYGYMLEYPIARMYANARVSKIFGGSNEIMKELVA
                     RTL"
     gene            698947..700869
                     /locus_tag="CNE_RS21295"
                     /old_locus_tag="CNE_2c06530"
     CDS             698947..700869
                     /locus_tag="CNE_RS21295"
                     /old_locus_tag="CNE_2c06530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020205986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PrkA family serine protein kinase"
                     /protein_id="WP_013952342.1"
                     /db_xref="GI:503718266"
                     /translation="MDIFGHYATRFEARKEEEYSIQEYLEICKKDPTAYATAAERMLA
                     AIGQPELVDTHHDPRLSRLFFNKVIRIYPAFRDFYGMEDTIEQIVSFFKHAAQGLEER
                     KQILYLLGPPGGGKSSLAEKLKALMEEIPIYALKGSPIHESPLGLFAPEEDGKILEED
                     YGIPLRYLNTIASPWAVKRLHEFNGDITRFRVVKLRPSVLSQIAISKTEPGDENNQDI
                     SSLVGKVDIRKLEDFPQDDPDAYSYSGGLCLANRGLLEFVEMFKAPIKVLHPLLTATQ
                     EGNYKGTEGFGAIPFDGIVLAHSNEAEWTTFKADKNNEAFLDRIYIVKVPYVLRVSDE
                     VKIYDKLLRSSSLSAAPCAPNTLKMMAQFAVLTRIKEPENSNVFSKMRVYDGESLKDV
                     DPKAKSYQEYRDYAGIDEGMNGLSTRFAFKVLSKVFNFDNTEVAANPVHLLYVLEQQI
                     EREQFPPEQESKLLSYIKEYLTTPFVEFIGKEIQTAYLESYSEYGQNIFDRYVVFADL
                     WIQDQEYRDPNTGEILDRNALNDELEKVEKPAGISNPKDFRNEIVNFVLRARANNSGK
                     NPVWTSYEKLRMVIEKRMFSTTEDLLPVISFNAKSSREDQDKHENFVNRMVEKGYTPK
                     QVRLLVEWYLRVRKSS"
     gene            700907..702169
                     /locus_tag="CNE_RS21300"
                     /old_locus_tag="CNE_2c06540"
     CDS             700907..702169
                     /locus_tag="CNE_RS21300"
                     /old_locus_tag="CNE_2c06540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952343.1"
                     /db_xref="GI:503718267"
                     /translation="MATVIDRRENGGNKSAVNQQRFIKRYREQIRQAVAKAVSGRKIM
                     DIEQSGQVSIPVKDISEPIFHHGPGGRREWIHPGNKKFVKGDSFDRQQQGGGGTGSRA
                     SDSGEGEDDFVFTLSREDFLNFFFEDMALPDLAKRHLAKIAEVRKVRAGFSIDGTPAN
                     LSVLRTMRSSLGRRIALSSPYQKRLRELELEYSEALEKDGPYAEGTLEVMEKMRHLRA
                     CIDRVPFIEKLDLRYNNRVLKKRPQAQAVMFCLMDVSGSMDESRKDLAKRFFMLLYLF
                     LKRNYERIDVVFIRHHTVAKEVDEEDFFHSRESGGTVVSSALKLMVEVIHDRYPPSQW
                     NIYCAQASDGDNWAGDSELCGRLLRDSILPLVQYYAYVEVASEEPQNLWEEYLTVKGQ
                     FDHFAMQRIIGADEIYPVLHDLFQKRAA"
     gene            702305..703858
                     /locus_tag="CNE_RS21305"
                     /old_locus_tag="CNE_2c06550"
     CDS             702305..703858
                     /locus_tag="CNE_RS21305"
                     /old_locus_tag="CNE_2c06550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVR family protein"
                     /protein_id="WP_013952344.1"
                     /db_xref="GI:503718268"
                     /translation="MAYLSTGSEWTFELIKRYDREIARIAGEFGLDTYPNQIEIITAE
                     QMLDAYASAGLPVGYSHWSYGKHFLASERSYQRGHMGLAYEIVINSNPCIAYLMEENT
                     MPMQALTIAHACYGHNAFFKGNYLFRTWTNADAIVDYLLFAKNYVAECEQRYGEREVE
                     LLLDSCHALQNYGVDRYKRPKKLSITEEKARQADRENYLQMQVNDLWRTLPKSRPHAL
                     ASDDDASEGEIIFPPEPQENLLYFIEKNAPKLASWQREIVRIVRKIAQYFYPQRQTKV
                     MNEGWATFWHYTIINQLYEEKLVNDAFMMELLQAHTNVIYQPPYNSPYYSGMNPYTVG
                     FLMFQDLRRMCENPTEEDYRWAPEFAGSDWRKTLDFAMRNFKDESFLLQFLSPRVIRE
                     LKLFSVLDDDREGKLRVTAIHNDEGYRAIRQLMAAQYDLSSMEPNIQVTNVDVGGDRS
                     LTLRHLQNDRRPLAHNFDEVIRHVTRLWGFTVRLEVAYEDGRTELKYECKPERRHRRP
                     HGGGLSLAA"
     gene            complement(703891..704889)
                     /locus_tag="CNE_RS21310"
                     /old_locus_tag="CNE_2c06560"
     CDS             complement(703891..704889)
                     /locus_tag="CNE_RS21310"
                     /old_locus_tag="CNE_2c06560"
                     /EC_number="1.3.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952345.1"
                     /db_xref="GI:503718269"
                     /translation="MHNAYSDALDALLRDCCPPATVRALEQQADPQPLWQALLESGFA
                     DCLLPESAGGAALPLRELAPVLFVTGRHALPLPLAQTIFARALLQAHGIALPAGPVAL
                     AGFEDGAGAALVADARHAQWFLLQDGERCLLLAAADARAEATGAHHDLTLRVPRPDAS
                     APAAFALPAGTLRTLGACLHTAQLAGALSHVLDLTLQYANDRQQFGRAIGKFQAIQHQ
                     VSEMAEHVAAARVAAQLACDSGTGTPDRLRAAIGKLRASDAVTPVAAIAHAVHGAIGI
                     TEEYDLQLYTRRLHAWRMADGSERWWSRVLGEAVCASAGRNAVELVREWCEPAPAA"
     gene            complement(704928..706088)
                     /locus_tag="CNE_RS21315"
                     /old_locus_tag="CNE_2c06570"
     CDS             complement(704928..706088)
                     /locus_tag="CNE_RS21315"
                     /old_locus_tag="CNE_2c06570"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011299682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952346.1"
                     /db_xref="GI:503718270"
                     /translation="MTALLSTFSLTSLPPHAVAFRGKVRAFLDAHLPALPPETRARSW
                     MGFDAAFSRALAARGWVGITLPAQFGGAGLDPFSRFVLVEELLACGAPVSAHWIADRQ
                     SGPLILRYGNDAQKARYLPAISRGEAFFCIGMSEPNSGSDLASVATRAVRQADGSWRL
                     NGRKIWTTNADRCHLMIALVRTSGTPQDRQTGLSQFIVDLHAPGVTVRPIHDLAGDAH
                     FSEVTFDDVALAPDTLVGQEGSGWEQVNAELAFERSGPERLYSSVVLLDTWLDAMRRL
                     PPARRDTVTAGRLAGHLAVLRAMSLAVTSRLAAGESPVVEAALVKDLGTTFEQSIPAL
                     VEAALGDEPALAADGALYRTLAYVTQIAPSYSLRGGTREILRGMIARGLGLR"
     gene            complement(706129..707118)
                     /locus_tag="CNE_RS21320"
                     /old_locus_tag="CNE_2c06580"
     CDS             complement(706129..707118)
                     /locus_tag="CNE_RS21320"
                     /old_locus_tag="CNE_2c06580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952347.1"
                     /db_xref="GI:503718271"
                     /translation="MKAKTFITTLAAAAAIVLPAVLAQPAAAADAAYPSHPIRMVVPF
                     PPGGPTDLVSRVIARRMSEALGQQVLVDNRPGANGNIGAEIVAKAPPDGYTVLYNTSS
                     IALSPALYHKLSYDVKRDFAPVALTAMVPLVLEVNAQLPVQNVKEFIQYLKANPDKLT
                     YGSAGNGNVTHLAAFMFLQANGLSAVHAPYKGSAPALTDLASGQVQFMADTINSSLPF
                     IRDKRMRALAVTSTTRSAQLSDVPTLAETVQPGFEVGAWQGMMVPARTPAEIVRKLNA
                     AATKALAHPETRASLAAQGAEPRGSTPEAYAAYLSAEMTRWQKVVKDSGATLD"
     gene            complement(707169..707630)
                     /locus_tag="CNE_RS21325"
                     /old_locus_tag="CNE_2c06590"
     CDS             complement(707169..707630)
                     /locus_tag="CNE_RS21325"
                     /old_locus_tag="CNE_2c06590"
                     /EC_number="4.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_013952348.1"
                     /db_xref="GI:503718272"
                     /translation="MTHAELPRLGQGFYWQDLQEGQAFRTFARTVTETDLVNFISVTG
                     MVEAIFIEAGYDGGAIQGRPVPAALTYTLIEGFILQTMIQGTGLAMLELTQQIHAPVM
                     VGDTIHATVTVTGIRPTSRSGRAVVDSRIEVFNQRGEQVMTYTARRLLAGR"
     gene            complement(707627..708850)
                     /locus_tag="CNE_RS21330"
                     /old_locus_tag="CNE_2c06600"
     CDS             complement(707627..708850)
                     /locus_tag="CNE_RS21330"
                     /old_locus_tag="CNE_2c06600"
                     /EC_number="5.1.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013952349.1"
                     /db_xref="GI:503718273"
                     /translation="MLPLAGIRVVDLSTVVMGPYASQWLADLGAEVIKVEPPEGDSTR
                     RTGPAAEPGMAAIFLGVNRSKRSVVLDLKQPAAQAALDRVLAGADVLMHSMRPQKLAA
                     LGLAPDDVRARHPELVFVSLLGFAEDGPYGGRPAYDDIIQGLSGNAALMAAQTGDSRY
                     FPTIAADKTSGLVAALSVCAALAGRARRNADGSTGHGTLVEVPMFESMVAFNLVEHFY
                     GRHFEPPRGPSGYPRVLAPLRRPYRSADGYVCMMPYTDVHWRDFFHAADRPGLAADAR
                     FADIAARTRHIETLYELTGEIVLGQTTAHWVELCERLQIPVARINELDDLPADPHLVA
                     TGFFETVEDPAMGTLRFPGAPVRFDSQRAPLGIPPRLGEHTGSVLAQAGLSAEAIAQL
                     QQSGAARCAPAKETP"
     gene            708957..709847
                     /locus_tag="CNE_RS21335"
                     /old_locus_tag="CNE_2c06610"
     CDS             708957..709847
                     /locus_tag="CNE_RS21335"
                     /old_locus_tag="CNE_2c06610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952350.1"
                     /db_xref="GI:503718274"
                     /translation="MDFRQLQQFVALAETGNFHRAAERLHMAQPPLSISIRKLEDQLG
                     TALFVRTSRGVRLTQAGEAALHDARRALFHAQQARAAAIAAGQGERGALRIGFIGSAT
                     YALLPKLIPAFRAAHPGIELILHESTTAAILDRLEKHQIDAGLVRFPILNTGNYSLTP
                     LENDVFVAAVPADSPLASADAIPLRALADEPFIMYPAAQVPNLHAVAMLLCQQAGFVP
                     RVTQEAVQVQTQVSLVESGLGVALVPSVAARYANRRVRFLPLSSPRPAGRIGIALAAR
                     PDDGDRQVQRFLAAAQAAVN"
     gene            complement(709872..711068)
                     /locus_tag="CNE_RS21340"
                     /old_locus_tag="CNE_2c06620"
     CDS             complement(709872..711068)
                     /locus_tag="CNE_RS21340"
                     /old_locus_tag="CNE_2c06620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013952351.1"
                     /db_xref="GI:503718275"
                     /translation="MGEHPTTDEDFHRLVDSIYESALDVAVMPAALDLFSRYTCTGSP
                     RYLIWDKLAGHARLGVTPHGCFTSGVSMPDWLPGPLDLPHPGACCPPNDAPALACDGT
                     SALAASHNGGMTDAATAALACSGLEQGIRLIENAEVCVLMSGTSAGSISTGQRERRLA
                     HVMPHWVRAARMQQRNFELSGLASLGLAGLDTLDFGVMVLQADLRVRYANSWAEALVQ
                     ADGHLSLQGGVLRAHSDTLQAVLRKLLDGAMRARGTEAASGSWMHITSGGQPVPIIVT
                     PLVSRQPVEGPWQLPAAMMLFGNSESRSVLDAGVLTSLFGLSRKESIIAIRLAAGETL
                     NEIAEREFLSPHTVRVHIRDTLRKTGTHRQSELVRLLHLLPGVNLERAGVTPPARPRT
                     PRTRAA"
     gene            711514..711768
                     /locus_tag="CNE_RS21345"
                     /old_locus_tag="CNE_2c06630"
     CDS             711514..711768
                     /locus_tag="CNE_RS21345"
                     /old_locus_tag="CNE_2c06630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_041228808.1"
                     /db_xref="GI:752557576"
                     /translation="MPILTVRNVPDDVHRALRVRAAQNGRSTEAEVREILASAVMPQK
                     RVRLGDALAMLGREIGLSNADVEAIEQGKDKAAAEPVRFE"
     gene            711765..712193
                     /locus_tag="CNE_RS21350"
                     /old_locus_tag="CNE_2c06640"
     CDS             711765..712193
                     /locus_tag="CNE_RS21350"
                     /old_locus_tag="CNE_2c06640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_013952353.1"
                     /db_xref="GI:503718277"
                     /translation="MIVLDTNVISEAMKPEPADSVRCWLNDQAAETLYLSSVTLAELL
                     FGIGALPAGRRRAMLAAALDGLVTLFEGRILPFDTNAARHYAELATAARSRGRGLPTP
                     DGYIAAIAAANGMIVATRDVSPFEAAGLQVLNPWLAPPPS"
     gene            complement(712221..714590)
                     /locus_tag="CNE_RS21355"
                     /old_locus_tag="CNE_2c06650"
     CDS             complement(712221..714590)
                     /locus_tag="CNE_RS21355"
                     /old_locus_tag="CNE_2c06650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_013952355.1"
                     /db_xref="GI:503718279"
                     /translation="MHKPEHHAPTPAPRWHAALRPVLRAFAVLAALLTLLCAIPAHAA
                     PAGSLAALLGKADKPAAPASAPAASVPLAQSLDQVIATLQNDGERRALVGQLQTMRQG
                     LGDSGAAPASAAAAPAGASAPGLIGAVAEVLDEVDTHLRKDRGPWQFWRWRTRFAGEE
                     WHAALTHNGARTTLASLREFALVLAAWAVSGGVLWEIGHRIRRRRARKPTRAERGKLP
                     ELPSWVDVGVFMLRHIGPWVVAFGLTSLLAQRVFAQSPASVAAVLVAYAIVAGAIAAA
                     VCQVIFTLFRSAHRQLAVRQLLARSPWLLICTGALAALGDGATDSRVIAVLGTNLCAL
                     VATVANIAAALGIGAFALCFRRQIGQLISQRPLAFRQAHPAATDLLRLAGQAWHLPVL
                     AVVVASVVGTILATGHADVFLRRTVASVALFLAGLLLTMVAGHSPKATARPPRIRDRR
                     RSAYLQRFGRFALALVRVLIWAVFIEMVMRIWGTSLVRLAESSAAGRHLTETVFSVTS
                     TVLLAWLVWLLIDTAIMQSLSPAHGRGAQPSLRVKTILPLVRNASLIGLLVITVIAVL
                     ANLGVNVTPLLAGAGVVGLAIGFGAQSLVQDLITGLFIVVEDSIAIGDSIELPDHAGV
                     VEAMTIRTVRLRDGRGALHTLPYSQIKAVKNLSRGYAYAVFNIGITYQSDLDQALELI
                     RTTGAELARDHRYARNLMSGLDILGLDRFDPNGPVVMAQFKTRPLMQAEITRAFNARL
                     KRNFDASGIRMASPSLTIQVGGGAAQLLDPESANEKATQRATDPTIQGQ"
     gene            714855..715637
                     /locus_tag="CNE_RS21360"
                     /old_locus_tag="CNE_2c06670"
     CDS             714855..715637
                     /locus_tag="CNE_RS21360"
                     /old_locus_tag="CNE_2c06670"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-2-methylbutyryl-CoA dehydrogenase"
                     /protein_id="WP_013952356.1"
                     /db_xref="GI:503718280"
                     /translation="MELNASVSAVVTGGASGLGAATARALAAQGVRVALFDLNVEKGE
                     ALARELGGVFCQVNVTSEAEVEAGFAKARAAIGQERILVNCAGTGNAIKTASRSKEAP
                     DQIKHFPTDAFERIIQINLIGTFRCIARSAAGMLTLDSAGGERGVIVNTASVAAQDGQ
                     MGQAAYSASKAGVVGMTLPIARDLAGEGIRVNTILPGIFNTPLLQGAAENVKAALAAS
                     VPFPKRLGQPEEFASLAVEMCRNGYFNGESVRLDGAIRMAPR"
     gene            715713..717296
                     /locus_tag="CNE_RS21365"
                     /old_locus_tag="CNE_2c06680"
     CDS             715713..717296
                     /locus_tag="CNE_RS21365"
                     /old_locus_tag="CNE_2c06680"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_013952357.1"
                     /db_xref="GI:503718281"
                     /translation="MDFSYLTTLPHAVRHFARLRPEAVAYAFEGRQTTYAEFERNTNR
                     VAQALLAEGAGVGERIGYIGKNSDHYFELLLGASKIGAVMTPASWRLAPPEVEFILGH
                     CDAVVLFVGAESAAMVRNLLPALPMVRKVVVMEPCAEQGDWQCYTGWRDAQPDTPPAH
                     QPAAHDVLLQLYTSGTTGRPKGAMLTHRNLTIGTEVSERENVRWSHWVADDVSLVAMP
                     VAHIGGSGWGLRNLLSGAKGVVAREFDPRAVLDFIEKERISKLFLVPAAMQIVLRDPR
                     ARQVDYSRLKYLLYGAAPIPAALLREGIEVFGCGFVQQYGMTETTGTIVALPPEDHTT
                     EEVPRMRAAGKPLPGVEIKVVDYEGRQLAPGEVGELVVRSQHNMAGYWKQPEETARTI
                     DAEGWLRTGDAGYMDADGYLYIHDRVKDMIISGGENVYPAEVESAIYGHPQVADVAVI
                     GVPDEKWGEAVKAIVVLKPGQAPDQAGIIAWTRQRLAGFKVPKSIEFVEALPRNPSGK
                     LLRRKLREPFWEGMNRRVN"
     gene            complement(717382..718374)
                     /locus_tag="CNE_RS21370"
                     /old_locus_tag="CNE_2c06690"
     CDS             complement(717382..718374)
                     /locus_tag="CNE_RS21370"
                     /old_locus_tag="CNE_2c06690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952358.1"
                     /db_xref="GI:503718282"
                     /translation="MKSVRRKVLATLAAATALVAATGGTALAQGAYPNKPITIVVAYP
                     AGGDVDVLARMFAEKLAPRLKQSVVVENRTGAAGTIGSAYVARANPDGYTLLLAPNTV
                     AIAPLVLKAGAGASYDVQHDFTPISQIGTQSLFVVVNKGTGITKVSDLVARAKAGKVE
                     TYATPGNGSPMHIMGELFNKSAGIKISQVPYRGLAPAIVDVIGGQVPVTYITYGAISQ
                     YVGNGSLVPLAVADQKRSPFAPNVPTLAELGYKDVEIGAWQALLGPKGMPADLVRTLN
                     THVNEILKMPDVVARMATIAVTPSGGEPAVLSKLIAADTARYTKVVKEFGIQAD"
     gene            complement(718487..719581)
                     /locus_tag="CNE_RS21375"
                     /old_locus_tag="CNE_2c06700"
     CDS             complement(718487..719581)
                     /locus_tag="CNE_RS21375"
                     /old_locus_tag="CNE_2c06700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952359.1"
                     /db_xref="GI:503718283"
                     /translation="MKLARIAAGLAAALPLLASAQSSVTLYGVIDTGVEYVSNVGANG
                     NGLVRMPNLTATVPSRWGIRGTEDLGGGLKSIFVLESGFSPDSGTSNQGGRLFGRQAL
                     VGLTNQYGTLSFGRQYTMLFWATLDSDVLGPNVYGSGSLDSYLPNTRADNAVSYKANF
                     NGFVVGATYSFGRDAVNAGPSPSGTNCAGENAADKKACREWSAMLGYDNKTWGVTAAY
                     DSQRGGPGAFGGLTNSNLTDDRLSLGGYMLFQRAKIGAGWIRRDNEGSRTPISDLYYA
                     GASYDITPAVNLAGQVYFLNYHGSDNQAMLYTLRAMYSFSKRTSVYATAGFINNGGQL
                     AMSVSGGSPGSNPRPGENQWGSMIGIKHVF"
     gene            719896..720780
                     /locus_tag="CNE_RS21380"
                     /old_locus_tag="CNE_2c06710"
     CDS             719896..720780
                     /locus_tag="CNE_RS21380"
                     /old_locus_tag="CNE_2c06710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013952360.1"
                     /db_xref="GI:503718284"
                     /translation="MEQNQPRKPTEPDRQLLEALDSGFAQRVVQVGAGGERVAYRCGG
                     GTGPAVVLLHGISSGAASWLPCASLLAAHARVIAWDAPGYGDSSPLAQARPLASDYAQ
                     RLDGLLQALGVQPALIVGHSLGALMAAAYVANARQLPARLLLLSVAQGYGGAGREAQA
                     REVARQRLEALESLGVDGLAQRGPARLLSEEADPGAQAWVRWNMQRLNPDGYRQAVAM
                     LCGDDIHAYLAQRPDALPTQIACGSHDVVTTPPACGTLAERFGLPFSLIPDAGHACYI
                     DQAAATARLIRSVLDDIT"
     gene            721017..721337
                     /locus_tag="CNE_RS21385"
                     /old_locus_tag="CNE_2c06720"
     CDS             721017..721337
                     /locus_tag="CNE_RS21385"
                     /old_locus_tag="CNE_2c06720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952361.1"
                     /db_xref="GI:503718285"
                     /translation="MEQSAMESLTYNPNLVPWERPAPNNVAGKGHIEQPGKVANIVWQ
                     TRAAAPTAYENALGDALEAAFEGGAQNPQDIVRAFNDAGFLGVDGQRWTEERFLSEMR
                     RLGA"
     gene            721378..722439
                     /locus_tag="CNE_RS21390"
                     /old_locus_tag="CNE_2c06730"
     CDS             721378..722439
                     /locus_tag="CNE_RS21390"
                     /old_locus_tag="CNE_2c06730"
                     /EC_number="1.14.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phenylpropionate dioxygenase"
                     /protein_id="WP_013952362.1"
                     /db_xref="GI:503718286"
                     /translation="MESNKQARTEARLNTGLRNYWYPVAASWAVSHAPIGITRLSQNI
                     VLWRDGEGQVHALEDRCPHRGARLSMGWNLGDRVACWYHGVEVGGDGQVKSVPAVESC
                     PLEGRTCVRSYPVQEKAGAIFLWFGDQAPQGEGSPDELRLPEELVSEEHSNFLCVAHW
                     DCNYRYAIDNVMDPMHGAYLHAVSHSMASGEKSAVMQVRETEHGLVFEKTGQRGVNFD
                     WVEFGETGTLWLRLAIPYRASVGPGGPFGIVGMATPVDEDHCMVFFWRTRHVQAWERD
                     VWRFLYRNRLEQLHWDVLEQDRVVLEMMAPNARDHEMLYQHDAGITRVRRLLKRRAEQ
                     EVADEPVAMLQPAGAASHA"
     gene            722432..723205
                     /locus_tag="CNE_RS21395"
                     /old_locus_tag="CNE_2c06740"
     CDS             722432..723205
                     /locus_tag="CNE_RS21395"
                     /old_locus_tag="CNE_2c06740"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311848.1"
                     /note="member of a large family of NAD or NADP-dependent
                     oxidoreductases; paralogs occur in many bacteria; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_013952363.1"
                     /db_xref="GI:503718287"
                     /translation="MPEANTNNTLLAGRKVLVTGAARGLGLAFVKALAEAGATVAMAD
                     ILAERLQQEADALRARGLKVVPVTLDLSDPASVQACAEAAVKALGGLDGLVNNAAVTD
                     SGGRDAATIDIATWDRVMNVNVRGTWLMTTACLPALRASGRGAIVNLASDTPLWGAPN
                     LLAYVASKSAIIGMTRSLARELGKDQITVNAVAPGLTLVEATEYVPQHRHDLYREQRA
                     ITREQLPDDVCGAVLFALSDLARFVTGQTLAVNGGFVMH"
     gene            723240..723776
                     /locus_tag="CNE_RS21400"
                     /old_locus_tag="CNE_2c06750"
     CDS             723240..723776
                     /locus_tag="CNE_RS21400"
                     /old_locus_tag="CNE_2c06750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006157660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_013952364.1"
                     /db_xref="GI:503718288"
                     /translation="MSDLSQPQNIKRSWDQPEDASFDQWMESRVARFSTRKYDWDALK
                     FQADYDPKYRRAQMRYLGTGGTGVAADTNTVPSEHFTFSTMIIPAGHEGPSHIHTDVE
                     EVFFILRGKVKLILEKDGERFETILTDRDLVSVPPGVYREEINIGEEDALMCVMLGAK
                     KPITPTYPPEHPLTKIKR"
     gene            723815..724669
                     /locus_tag="CNE_RS21405"
                     /old_locus_tag="CNE_2c06760"
     CDS             723815..724669
                     /locus_tag="CNE_RS21405"
                     /old_locus_tag="CNE_2c06760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_041228809.1"
                     /db_xref="GI:752557577"
                     /translation="MSSNPIPATPAANETPDKYIVPGLERGLRLLSEFSSKDRTMSAA
                     ELARRLKVPRSTVFRLLATLEMLGFVERADGGRDFRLGMAVLRLGFEYLASLELTELG
                     RPLLERLRDEIGYPSNLVVRDGRSIVYVAKAVSPRPFASSVNVGTRLPAHATVLGRVL
                     LEDLSLAELRTLYPETHLAVFSESTPRTVDELHEIVQRDRERGYVLQEGFFEASISTI
                     AAPVRDRTGKVVAALGATIPAAHIDPAQLDAMVEKVRDTAGELSRLLDYRPSLHSSGA
                     KVVNLYRE"
     gene            724675..725478
                     /locus_tag="CNE_RS21410"
                     /old_locus_tag="CNE_2c06770"
     CDS             724675..725478
                     /locus_tag="CNE_RS21410"
                     /old_locus_tag="CNE_2c06770"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011299699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013952366.1"
                     /db_xref="GI:503718290"
                     /translation="MSMIELGGKVAVVTGGSSGIGLATVELLLEAGAAVAMCGRDESR
                     LRSAEAQLREKFPGCRLYAATCDVLKPEQVAAFAAAVQATLGNVDMLVNNAGQGRVST
                     FANTEDAAWMEELQLKFFSVIHPTRAFLPQLEKSGQGAIVCVNSLLAQQPEPHMVATS
                     AARAGVLNLVRSMATEFAPKGVRVNGILIGLVESGQWRRRFEARPEADRHLDWAAWTA
                     RLAQQKHIPLGRLGLPVEAARAILFLASPLSSYTTGSHFDISGGHSRHA"
     gene            725471..727186
                     /locus_tag="CNE_RS21415"
                     /old_locus_tag="CNE_2c06780"
     CDS             725471..727186
                     /locus_tag="CNE_RS21415"
                     /old_locus_tag="CNE_2c06780"
                     /EC_number="2.2.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952367.1"
                     /db_xref="GI:503718291"
                     /translation="MPNQHQYEQQQVTVGCAITAFLEQCGVKAAFGVISIHNMPILDA
                     MGERGKIRFVPARGEAGGTNMADAYARTTGGLGVCLTSTGTAAGNAAGAMVEALTAGT
                     PMLHITGQIETPYLDQSLAYIHEAPDQLTMLKAVSKAAFRIRSADTAISTIKLAVQTA
                     LTAPTGPVSVEIPIDIQAALIDMPADLQPLPVPQHVPSAHALDALAERLVKAKRPLLW
                     LGGGARHASKQVQRLLDLGFGVVTSTQGRGIVPEDDPRSLGAFNLHKPVENFYQTCDA
                     MLVVGSRLRGNETLKYELKLPRPLLRIDADPAAEGRCYLSDYFVSGDAALALDALADR
                     LEKRMQIDPAFAADLRRAHDTAVNSLVDGLGPYSALVQALQGAVGRSFNWVRDVTVSN
                     STWGNRHLRIFDSRAGVHALGGGIGQGLAMGIGAAIGAAATASGKKTFTLAGDGGFIL
                     NLGELATAVQERADMVIVLMNDKGYGVIKNIQDAQYGGRRHYVDLHTPDYATLAKSLS
                     LRHARVSNLAEVDAALEAATAESGPFLLEIDMLSIGSFKTIFAGPPVNKDNEEPAREQ
                     TTVTA"
     gene            727199..727999
                     /locus_tag="CNE_RS21420"
                     /old_locus_tag="CNE_2c06790"
     CDS             727199..727999
                     /locus_tag="CNE_RS21420"
                     /old_locus_tag="CNE_2c06790"
                     /EC_number="1.4.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B3R8S4.1"
                     /note="catalyzes the formation of L-aspartate to
                     iminoaspartate in NAD(+) biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate dehydrogenase"
                     /protein_id="WP_013952368.1"
                     /db_xref="GI:503718292"
                     /translation="MLHVSMVGCGAIGRGVMELLKSDPDVVFDVVIVPEHTMDEARDA
                     VCALAPGARVATHLDDQRPDLLVECAGHHALEEHIVPALERGIPCMVVSVGALSEPGM
                     AERLEAAARRGGTQVQLLSGAIGAIDALAAARVGGLDEVIYTGRKPARAWAGTPAEQL
                     FDLNALTEATVIFEGTARDAARLYPKNANVAATVSLAGLGLDRTSVKLLADPHAVENV
                     HHVEARGAFGGFELTMRGKPLAANPKTSALTVFSVVRALGNRAHAVSI"
     gene            728040..729518
                     /locus_tag="CNE_RS21425"
                     /old_locus_tag="CNE_2c06800"
     CDS             728040..729518
                     /locus_tag="CNE_RS21425"
                     /old_locus_tag="CNE_2c06800"
                     /EC_number="1.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_013952369.1"
                     /db_xref="GI:503718293"
                     /translation="MKTQEVLPICIAGEWRLGTGDRYGTRYPATGEVVAELNAANLSD
                     VEEAVQGAHQAFLTSGWAQRKPHERAAVLYRVAELIRAQGEQLAQRQRLDNGKPISET
                     RALVASAAGTFQFFAAACETLEETITPQRGDCLTMSVYEPMGVVAAITPWNSPIASEA
                     QKMAPALAAGNAVVVKPAEVTPLMALELARICEEAGVPKGLVSVLPGKGSVIGDAITK
                     HPLVRRVSFTGGTTTGKHIAHIAADKMMPVSLELGGKSPTMVFDDADLDHAVNGVLYG
                     IFSSSGESCIAGSRLFVARSQYEAFIDRLAAGAAHLRVGDPADERTQMGPLITDRHRD
                     SIESYVAAGVEEGGQLRTGGLRPDVAGLPNGYFYTPTIIEGLDNNARICQEEIFGPVL
                     VAIPFDDEDDLIAQANDSVYALAAGIWTRDYKRAWRVARAVQAGNVWINTYKQFSIAT
                     PFGGWRDSGLGREKGRLGILQYMEQKSVYWGLNEQPLPWANH"
     gene            729542..730516
                     /locus_tag="CNE_RS21430"
                     /old_locus_tag="CNE_2c06810"
     CDS             729542..730516
                     /locus_tag="CNE_RS21430"
                     /old_locus_tag="CNE_2c06810"
                     /EC_number="1.14.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013952370.1"
                     /db_xref="GI:503718294"
                     /translation="MIKVLGIDEIVYGADDFDACRGFFTDWGLAIKRDDAQGLDFETL
                     NGCRVLVRRIDDATLPPAIEAGPTLREVVWGVDSQASLDQLAKTIADAPGFVKQGEGD
                     TMRIGCTDPNGLAVRFQATRKHDVQVECALMNTWNDKPRLNQRSPIYDHATPIEVGHV
                     VFFVKDVKATERFYVEKFGFVPSDRYPDRGAFLRCTPEGGHHDLFLLQLPEPKSGLNH
                     VAFTVRDIHEVFGGGMHVSRKGWDTQLGPGRHPISSAYFWYFRNPAGGLIEYYADEDQ
                     LDEHWEPRAFEPGPTMFAEWAIEGGIDGNTRRQKNAGGPAGKFLTEKR"
     gene            730543..731499
                     /locus_tag="CNE_RS21435"
                     /old_locus_tag="CNE_2c06820"
     CDS             730543..731499
                     /locus_tag="CNE_RS21435"
                     /old_locus_tag="CNE_2c06820"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011299704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_013952371.1"
                     /db_xref="GI:503718295"
                     /translation="MSAHQSLTLRVHAMRYEARGVVSIELQDPEGKTLPEYSPGAHID
                     LHLGNGLVRSYSLCGAPEARQRYTVGVLLDRGSRGGSRYVHEQLRVGTTLTVGAPRNN
                     FALDESAAHTVLVAGGIGVTPIVCMARRLAELGKSFTLIYCARSRAEAAFVEQLSAHG
                     DAVRFHFDDEAGVPPDLNAMLAGQDPQTHFYCCGPGPMLKAFEAACEAHSYPNVHIER
                     FAADPSTEAVQEGEYTVSLSRTGTTVKVPSGKSLLDALLDAGVQMDYSCREGVCGSCE
                     TAVLEGCPDHRDSVLSSSERASNKTMMVCVSGCKGSKLVLDL"
     gene            731760..733157
                     /locus_tag="CNE_RS21440"
                     /old_locus_tag="CNE_2c06830"
     CDS             731760..733157
                     /locus_tag="CNE_RS21440"
                     /old_locus_tag="CNE_2c06830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_041228810.1"
                     /db_xref="GI:752557578"
                     /translation="MTTADSAGQSAAAARSGPLTRGNIVARIERMPGNAMHIRARLLI
                     GLATFFDGFDVIAIAATLPLLIAQWSLTPGQIGFLIAAPSVGQLVGALLFPGLAERFG
                     RLRSIGWSAGIIGLMSLACGFAPSFEIFALLRIVQGLGLGGELPVAATYINEVTRAHG
                     RGRFVLLYEVVFPIGLMVSNGIGAWLVPHYGWELMYFIGGVPLVLFFILRRVIPESPR
                     WLAEKGRLDEADAALWAFEARARTPLPPLGDTSAYERMAQHPRRRVRDLVSKPYIGRT
                     LAVWMLWATCGFIQYGLSTWLPTVYKTVYHAPLQLALNLAAGASVLGVVGSLVCAMIV
                     DKVGRKPVINVSFLLCALSLVLAGVFHASNVYVVATLCALAMGFLASGFITAYVYTPE
                     LYPTSVRAMGCGLGGAWLKLAAIFAPGLIASTIGSGDLSIAFFALSVVPALAAVTVHF
                     LGIETKGRVLEELEV"
     gene            complement(733233..734190)
                     /locus_tag="CNE_RS21445"
                     /note="MFS transporter; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(734316..735203)
                     /locus_tag="CNE_RS21450"
                     /old_locus_tag="CNE_2c06850"
     CDS             complement(734316..735203)
                     /locus_tag="CNE_RS21450"
                     /old_locus_tag="CNE_2c06850"
                     /EC_number="4.1.3.32"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="WP_013952374.1"
                     /db_xref="GI:503718298"
                     /translation="MSGDSTHSPSLKERLRRPEPVLAPGVYDALSALLAEQAGFEALY
                     LSGGAVAYTLLGHSDVGLTTATETADVLARITDRVSLPVIVDGDTGYGNALNTQRTVR
                     AFERAGAAMIQLEDQGFPKRCGHLAGKSLVTVREMCGKLRAALDARHSADTLILARTD
                     AVAVEGLDAAIERAEAYLACGVDALFIEAVVSAADMDRVCGRFAARVPLLANMVEGGK
                     TPIQSAAELGGRGYRIVIYPGGTVRFASRQLQRYFAGLRADGSTRAFMEEMNDFDALN
                     RLIGTPQLLDAGRRYADDD"
     gene            complement(735200..736372)
                     /locus_tag="CNE_RS21455"
                     /old_locus_tag="CNE_2c06860"
     CDS             complement(735200..736372)
                     /locus_tag="CNE_RS21455"
                     /old_locus_tag="CNE_2c06860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952375.1"
                     /db_xref="GI:503718299"
                     /translation="MSVIAASQRPVAWTAQQAREDRSWVLRMNEAEVQGMRDALDHAR
                     TLNKPLLAMQQADFPLNDAARAVLRRAIDITQGGWGMCLLKGFPVDEWTEEESRLAYW
                     GMSLYMGVGRTQNRASQFMNDVRNEGGEYKVKGGRGYNTNAGLDFHQDSCDVVGLLCR
                     RTARAGGTSKVTSSIALYEEVQRRRPDLIPVLKDTFFHSYQGTQDPSQPPYYRCPVFG
                     SHPEYFSARTNRKNTDAAQRDFAELPRLTPAQVEALDLLDELMPSELLCFTMELEQGD
                     MQLLNNYVTLHSRTPFEDHEEPDRKRHLFRLWLAVPGSQPLPEDWKEYYGDVRAGSVR
                     GGVRGSEITQEFLDYEKRQAAALGMLFETWRPQLRQEDMVRILAGHAAKAAAGATA"
     gene            736509..737408
                     /locus_tag="CNE_RS21460"
                     /old_locus_tag="CNE_2c06870"
     CDS             736509..737408
                     /locus_tag="CNE_RS21460"
                     /old_locus_tag="CNE_2c06870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013952376.1"
                     /db_xref="GI:503718300"
                     /translation="MKIETFHTLEGVLQTGTFAGAARQANVTPSAVSMQMKQLEQYLG
                     KPLFDRSGLQARPNQLAREVADTMRQALQNLEALRSGSGLAVEGVVRLGVIESLQPVV
                     LPGIVRYVRERHPRLELRLVRGRSSTLTASVKAGDIDAALVAQPAAGGSARLRWTPMM
                     RRELMLIAPPASTETNVASLFRLYDWIRYDRNTVSGAMAAQYVHAHVSEIRGTLEFDS
                     APAIVAMVSAGLGVSILQGPDPTLVQNYPVRLVRLGRSAPVLTLSLVTRKGDDDNRSV
                     AAVRDAMRLTLASYQRQSVAARH"
     gene            complement(737501..738019)
                     /locus_tag="CNE_RS21465"
                     /old_locus_tag="CNE_2c06880"
     CDS             complement(737501..738019)
                     /locus_tag="CNE_RS21465"
                     /old_locus_tag="CNE_2c06880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013952377.1"
                     /db_xref="GI:503718301"
                     /translation="MPRDAAPAKGQPAPDTDITSPWTDLDEAGSGLTVDNFLTTMLSQ
                     LVTALRSTVTKPYAEQFGLTVPEWRILALLAHARELPFAELVTQSTSDKALVSRTLRL
                     LEERGLVQLTSAGNTPRKKLICAISEAGAALHDQVMPLARRGQAQVIRQLSPEEREAV
                     YQGLRKLLRAQA"
     gene            738337..739329
                     /locus_tag="CNE_RS21470"
                     /old_locus_tag="CNE_2c06890"
     CDS             738337..739329
                     /locus_tag="CNE_RS21470"
                     /old_locus_tag="CNE_2c06890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013952378.1"
                     /db_xref="GI:503718302"
                     /translation="MRHERPRRLFLAATAMAALALAAGSALATAAYPAKTVTMVVAYP
                     PGGDTDAMARLYADKLSARLKQPVIVENRPGAGGVVGASFVSRAPADGYTLLYTPNPF
                     TLAPMVLRLAPSASYDPLYGFTPVIQTAVQAVLLVANPQAGIKTVGEMIAAAKGGKTL
                     TYGSPGAGSPMHIAGEMLNRAAGVKIQHVPYKGVAPAVNDVVAGHVNFAYVTLGPVAQ
                     YINTGRLIPLAITDAKRSPLLPNVPTLAELGYKDVVVGAWHGVMAPKGTPPEVVKVLN
                     QQLNDVLRLPDVTEKMATFGASPVGGVPAALEKVNAADYERLGKVIRDLAIAAE"
     gene            739374..741665
                     /locus_tag="CNE_RS21475"
                     /old_locus_tag="CNE_2c06900"
     CDS             739374..741665
                     /locus_tag="CNE_RS21475"
                     /old_locus_tag="CNE_2c06900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA reductase"
                     /protein_id="WP_041228811.1"
                     /db_xref="GI:752557579"
                     /translation="MSKAIVGSSTPQVTAREKVMGRARYAGDIKLPGMLHAKVLRSPH
                     PHARIVRIDTAAAKALPGVKLVVTGQDVPTRNWGPHRKEQRILACGVVRHVGEEVAAV
                     VAVSEEIARDALDLVRIEYEAQPALLTPAAALAEGAPEIHAGTRNIGHEMHIVRGDVD
                     AAFEACAAVYEATYDMHSQYPGYLEPMASVAAQDGNGRLTLWASTQSVFLARARLAEA
                     LDRPVSTIRVVQATTGGGFGAKIVEENNSLICAFLASRLERPVRLVNNRLEDFQGARA
                     SVPMKVWLRMGLSADGVILAKDVRITAECGAYSGLAGDVMHVTVMRSDNMHRVQNVRS
                     HAVMAYTNNPPRGAFRGFGGQQMQFPLNCHLTVLAGMVGMDPVEVHKRNAIGAGETSV
                     HGWKISSTGMAECLDMTRKAIGWDENRAAPRSTGTRRRGVGIAAAMHVSGNRTLGNWD
                     GSTILLKVNEDGRVMLQTSECDMGQGANTMLSQICAQELGIPLSHITVMAPDTDTAPF
                     CLGSLASRVTIIAGNAVLRAAREARQKLLALAAEKLGVDAEQLEIADGRIAAPDQPDK
                     SATLAEIARLHIFRHGGEGIHVRATYDAPTVMHDADYYGNVAPAHSFAAQAVEVEVDT
                     STGQVTVIDSFVADDCGKAINPLAVHGQTHGATVQAIGWTLYENLQYEDGRLMNGNFA
                     DYTMPTADAVPMLRTDVVESNDPNGPYGAKGASETAILPGAAAIANAVFDAVGVRIQS
                     LPITPEKVLAGLRELKQKEAAHA"
     gene            741658..742524
                     /locus_tag="CNE_RS21480"
                     /old_locus_tag="CNE_2c06910"
     CDS             741658..742524
                     /locus_tag="CNE_RS21480"
                     /old_locus_tag="CNE_2c06910"
                     /EC_number="1.3.7.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA reductase subunit beta"
                     /protein_id="WP_013952380.1"
                     /db_xref="GI:503718304"
                     /translation="MRDFAFLEPATVAEASQMLADLGDSCRILAGGTALMLGMRQRML
                     TPGHLVSLGRLDALRGITFDAREGLRIGALTLHAEVARSPLVQAHYPMLASMASRVAN
                     PQVRNQGTIGGNLCYADPATDPPGCMMALGARIVVSGRGGEREIDIEDFLVDYYVTAL
                     APDEILTQIRVPAPGAGADGRYARFLRTAAEHRPLASVALAVRREGAFCVEAHLAVGA
                     STPIPARLRRAEALLAGKAVTAELAEEAAAIVAADINAVSDMRGSESYRREMVRVVAR
                     RTIAELFGVASE"
     gene            742534..743010
                     /locus_tag="CNE_RS21485"
                     /old_locus_tag="CNE_2c06920"
     CDS             742534..743010
                     /locus_tag="CNE_RS21485"
                     /old_locus_tag="CNE_2c06920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_010811673.1"
                     /db_xref="GI:498511219"
                     /translation="MNQVSIELTVNGEEHQVEVPARRLLSDLLRDDLNLTGTKRGCET
                     GICGACSVLVDGEVVKSCLMLAVQARGRHVMTVEGLAADGQLHPLQQCFMDNGGLQCG
                     YCTPGFLMASCALLANNPNPTEDEVRHGLNGNLCRCTGYVGIVESVLSAAEKMRGN"
     gene            743000..743740
                     /locus_tag="CNE_RS21490"
                     /old_locus_tag="CNE_2c06930"
     CDS             743000..743740
                     /locus_tag="CNE_RS21490"
                     /old_locus_tag="CNE_2c06930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA reductase subunit gamma"
                     /protein_id="WP_013952381.1"
                     /db_xref="GI:503718305"
                     /translation="MEIEKTLVTAAPPARVWELLLDPNVMGACVPGMESIEVLSDVEY
                     IAHMAVKIAFINARFRLHTKIVETRAPHYLRTEGTGEDASVASSLRQSSELFLTALDD
                     GGTQVRIKVQVDVLGRLGTFGLSVMKTKADRMWDEFGANLLARLSPQEAQAAPEPAAK
                     SAPAAPVASAAAVNGHAVLPAQSTPPAPAAAGLFSRLFGRGEAARGPLSDICVELRRR
                     DETIVVRWPAAQGEQCAAWLRDYLRPGA"
     gene            743843..744694
                     /locus_tag="CNE_RS21495"
                     /old_locus_tag="CNE_2c06940"
     CDS             743843..744694
                     /locus_tag="CNE_RS21495"
                     /old_locus_tag="CNE_2c06940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_018311864.1"
                     /db_xref="GI:517123046"
                     /translation="MTTDSPQEDTQESGQEGAQESAQDKYIVPGLERGLRLLAEFSSR
                     ERTLSAAELARRLKVPRSTVFRLLATLEMMGFVERTDGGREFRLGMAVLRLGFDYLAS
                     LELTELGRPLLDRLRDEIHYPCNLVVRDGRSIVYVAKSVASRPFASTVNVGTRLPAHA
                     TVLGRVLLEDLSLAELRALYPEERLEVYSESTPRTVEELYDMVQRDRQRGYVLHEGFF
                     EASISTIAAPVRDRSGKVVAALGATIPASRIDPDQLDNVVEQVRRAAAELSRLLDYRP
                     EVPKPFA"
     gene            744733..745749
                     /locus_tag="CNE_RS21500"
                     /old_locus_tag="CNE_2c06950"
     CDS             744733..745749
                     /locus_tag="CNE_RS21500"
                     /old_locus_tag="CNE_2c06950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952383.1"
                     /db_xref="GI:503718307"
                     /translation="MQQCKRYNRSPRRRQWLVGTALAAAVAACVPWQAVQAAGCANVR
                     IVVPFPAGGPADQLARTLAHGLQQRRGTPFVVDNKPGANGNIGIDTVRRAPGDGCTLL
                     VAPAGNLTINPTLMPALTYNVERDFRPVSLLAGSPNVLAVHPSVKANSVQELVRLAQQ
                     AEKSGKPLGYASPGVGSGLHLAGELFRNKAGITLLHVPYKGTTQALNDVVGGQVPVLF
                     GTWPTLAPFIQSGALRALAVTQPRRSPAAPNVPSLAEQGVPGIDVSSWYALLVPKATP
                     QPAADALSADVRALLATPAVRAELQRQGMEPVGSTPQALEARIREETAAWAKLIKAYG
                     ITAE"
     gene            complement(745736..746575)
                     /locus_tag="CNE_RS21505"
                     /old_locus_tag="CNE_2c06960"
     CDS             complement(745736..746575)
                     /locus_tag="CNE_RS21505"
                     /old_locus_tag="CNE_2c06960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013952384.1"
                     /db_xref="GI:503718308"
                     /translation="MPKSRPQPDLADDADTEDAREAQLVSPVIRGLRLLRFIAEGGAT
                     ANLSEVGRRIDVNRVTVMRLLDTLEHEGMVERLPQGGHQVGFNFLKLASRVLATNDLT
                     SFAARVLARLSASLQLSAYLAVRDGGDALYLLRQMPAASLVSNIQVGSRVAAHLTTPG
                     RMLIAELPPETLRELLGPDPLPTVTGQSPATHARLADILAADRERGCAWSFSAYEPGI
                     DSCAAPVRGADGDVIAAISVAGPQQRFEADGALRERVAKEVRQAARDLSGLMGYRCAT
                     TPR"
     gene            complement(746645..747781)
                     /locus_tag="CNE_RS21510"
                     /old_locus_tag="CNE_2c06970"
     CDS             complement(746645..747781)
                     /locus_tag="CNE_RS21510"
                     /old_locus_tag="CNE_2c06970"
                     /EC_number="1.14.13.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="salicylate hydroxylase"
                     /protein_id="WP_013952385.1"
                     /db_xref="GI:503718309"
                     /translation="MPLKIGINGAGIGGLAAAIALRKLGMDAIVYEQAPRFARVGADI
                     NLTPNAVRALDGLGIGAALRETAARPCHRISRMWDTGEETSRLPMQEDAERRYGAPQL
                     TMHRADLMTALEAAVPSECVRLGHKAVAIEPHADGATLRFANGAKERVDVLVGADGIH
                     STVRTALFGQESPIFTGVVAYRAVVPAERLAGVSNLGAFTKWWGPESATQIVTFPLNR
                     GRDIFIFATVAQEAWRHESWTTPGRVEDLRSAYAGFHPEARALLDACDEVLISALYVR
                     DPLPAWSAGPVTLMGDACHPMMPFMAQGAGMAIEDGVVLARCLADSARGGAAGVPAAL
                     ARYQAARHERTSRIQIGSRSNAWLKEGGNADWVYDYDAWNVALG"
     gene            complement(748367..749602)
                     /locus_tag="CNE_RS21515"
                     /old_locus_tag="CNE_2c06980"
     CDS             complement(748367..749602)
                     /locus_tag="CNE_RS21515"
                     /old_locus_tag="CNE_2c06980"
                     /EC_number="1.3.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952386.1"
                     /db_xref="GI:503718310"
                     /translation="MNLDFSPQDQQFREDVRAWIAQAYDADLRAMMAQSKNGYLDKAA
                     QLRWQKALHARGWAAPNWPKEYGGPGWSSTERFIFQSELAAAGCPPVSPMGLKMVAPV
                     IMKYGTPEQKQRFLPPILSSDVWWCQGYSEPNSGSDLASLQMRADHGTDSDGEHYILN
                     GSKIWTTHAQWADWMFCLVRTSRESKRQEGISFLLLDLHTPGITVSALPTLDGPMTGQ
                     QEVNQVFFENVRVPVANRIGEEGKGWTYAKYLLEFERGGTYSPMLRKQLSKIADIAAE
                     QPADDGGRLLDDPAFRRKLAALHLRAAALEAVELRVFSGVESGTSIGAASSMLKLTGT
                     ETLQAASELAVEAAGPAALPFVQDTWAQLQGREAAPRVGPEYAAVLAPRYFNYRKASI
                     YGGSNEIQRNIIAKLVLGL"
     gene            complement(749648..750799)
                     /locus_tag="CNE_RS21520"
                     /old_locus_tag="CNE_2c06990"
     CDS             complement(749648..750799)
                     /locus_tag="CNE_RS21520"
                     /old_locus_tag="CNE_2c06990"
                     /EC_number="1.3.8.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013952387.1"
                     /db_xref="GI:503718311"
                     /translation="MDFQFSEEQSMLRDTLARYLADHYDFEARRAAVQSAAGWRPDCW
                     RAFARELGILGAAYPETLGGLGGGAAEHMIVMEQLGRHLVLEPYLGTVVLGGGALMHS
                     SPELAAQWVPAIIGGEATAAWAHAEPTSRYCRHDVQASAARQGNGYKLSGHKRAAVGA
                     PFATHLVVSARTSGARRDRDGISLFWIARDTPGVTLREYPTFDGLRAAEVLLDNVQVP
                     ASQRIGAEGEAFALIEQLCDEAMVALSAEANGAMARMLADTIDYARQRKQFGVPIGTF
                     QVLQHRMADMYMQLEQSVALTQVAAMQAASAPQARAQAACAAKIQAGQAGAFVGQAAV
                     QIHGGMGVTEELAVGHYFKRVTAIDLQLGSAEHHLRRYADLLYPAQAAA"
     gene            751055..752602
                     /locus_tag="CNE_RS21525"
                     /old_locus_tag="CNE_2c07000"
     CDS             751055..752602
                     /locus_tag="CNE_RS21525"
                     /old_locus_tag="CNE_2c07000"
                     /EC_number="6.2.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952388.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_013952388.1"
                     /db_xref="GI:503718312"
                     /translation="MHPHIHAQRTPDKPAVIMGSSGAVVTYRELDERSNQVAHLFRSQ
                     GLQPGDRVAFMIENHPRLFELCWGAQRSGIVYICLSTRLNVADAAYIINDSGAKLLVT
                     THAQAEVAAALAGQTPALRGRLMLDGTVPGYDAYETALARCPATRIDDEVTGGDMLYS
                     SGTTGRPKGVYAPPSSANIEDPTTLTSLCQRLYGFDAETRYLSPAPLYHAAPLRYNMT
                     VQALGGTAVVMEHFDAEHYLQLVQQHRITHTQLVPTMFSRMLKLPEAQRQAYDVSSLR
                     VAIHAAAPCPVQVKEAMIAWWGPVIWEYYAGTEGNGVTVVSTPEWLERKGTVGRAMVG
                     KLRICGPDGALLPPGESGTIYFAEGRAFAYHNDEAKTAESRHPQQPDWSTIGDVGYAD
                     ADGYLYLTDRKANMIISGGVNIYPQEAENLLMTHPKVMDVAVIGVPNEDFGEEVKAVV
                     QPADMGQAGPELAAELIAFCRASLSAIKCPRSVDFESELPRLPTGKLLKRLLRDRYWA
                     GHANKLV"
     gene            752757..755519
                     /locus_tag="CNE_RS21530"
                     /old_locus_tag="CNE_2c07010"
     CDS             752757..755519
                     /locus_tag="CNE_RS21530"
                     /old_locus_tag="CNE_2c07010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_041228564.1"
                     /db_xref="GI:752557332"
                     /translation="MASIEETGRRPPPPAGAASLAAKLRPPLLTPFQVERAAICEAVC
                     AAGFVKLVLVRAPAGFGKTTAMLQCRARLEAAGGRTAWLTLDRSDNDASRFLGSVEAA
                     IAQGLGGGGPGRSAHGALAQDPGEQALALIDRLASHNGAFTLFLDDFEAIQNAAVTGL
                     VWQLVESLPPGCRVVIGTRWVPESGLGRLRARGELLEIEPAQLRFSAGETASFLRHAR
                     GLKLEQAAISVLHRRTEGWATALWLASVALERRSQPEGFIAGFSGSNAAIADYLVEDV
                     FLHLPEPVRDFLLRTSILDQLCGPLCDAVCEPATAGSSDEILAWLERANLFLLPLESE
                     RYGERGSGSASEQWYRYHSLFSGFLRGQLAQAMPDAVPQLHLSASRWYESQGRPVPAI
                     EHAFAAGALARALPLLDGAADDLLAQGRMRLLTRWLEAVPAEELARWPKLQIARVWAV
                     SFTRGPAEAIALLQQIPTEGAAGDLLAHIRALRHMLLNMMDRFDDARAFARNELPPLP
                     MGYAFPDAILGTSMARLAAVAGDYPEARRLLQVARHAVRGSDSNFNKIFSESVEGLID
                     LRQGRLQQALARFRIAASTMLPNRFGPTNGNAMAGILLAEGLYESGDSERASRLLNVY
                     LPLSRDLGLPDQIITGHTVLARIAFERGEADQAHEWLAQLEALGHHRGLTRLVMAAML
                     ERARLALRQGNVHAAQEAIERAADPALWRTRPGVSSFASDVEDITLGRLRLDLYARPG
                     TPVREAIERELAAAAGNQLMRRALKLRILLAQACQRTGDGAHALVVMGEALRFGAAEG
                     FVRIFADEGDDVRRLVADACSRQSASLPAPYVEKLLQACGQAGGEQAAGAGRPAPAAL
                     VEPLTPKEQKVLQLLAEGYSNVAMAERLFVSETTVRTHLRNISAKLHASNRTQAVAIA
                     RQLGLL"
     gene            complement(755559..756230)
                     /locus_tag="CNE_RS21535"
                     /old_locus_tag="CNE_2c07020"
     CDS             complement(755559..756230)
                     /locus_tag="CNE_RS21535"
                     /old_locus_tag="CNE_2c07020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_013952390.1"
                     /db_xref="GI:503718314"
                     /translation="MNVSQAVASRKSVRGFLPRAVAPDTIRRVLDAAARAPSGGNLQP
                     WHIHVVGGEALEGLRAIMRERIAQAPAGDEREYDIYPRELVSPYRDRRFQVGEALYHY
                     LGIPREDKARRLAQFANNFTFFGAPLALFCTVDRRMGPPQWSDLGMYLQTVMLLLREE
                     GLDSCAQECWAMYPQTIGKFLSLPAERMLFTGMAIGYEDPEAPANQLRAVRAPLDEFT
                     EFMGI"
     gene            complement(756265..757140)
                     /locus_tag="CNE_RS21540"
                     /old_locus_tag="CNE_2c07030"
     CDS             complement(756265..757140)
                     /locus_tag="CNE_RS21540"
                     /old_locus_tag="CNE_2c07030"
                     /EC_number="4.2.1.116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314543.1"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013952391.1"
                     /db_xref="GI:503718315"
                     /translation="MTQATPSFETLRYAVEDGVATITLHRPDQLNAFTAQMMHELIAA
                     FDATDADDNVRAVIVTGSGRAFCAGADLSGGSATFDFEKRYGASPDTAHRDGGGRVSL
                     RIFRSLKPVIAAVNGAAVGVGVTMQLPMDIRLASTDAKFGFVFARRGITPEAASSWFL
                     SRVVGISTALEWCYTGRVFSAQEAHERGLVRSLHAPEDLLPAAQAIAREIAANAAPVS
                     VAISRQLIWRMAGASHPMEAHKLDSRAIQSRGRSADVKEGVSAFLEKRPAAFPETVSH
                     DMPDFFDWTSEPPFI"
     gene            757369..758340
                     /locus_tag="CNE_RS21545"
                     /old_locus_tag="CNE_2c07040"
     CDS             757369..758340
                     /locus_tag="CNE_RS21545"
                     /old_locus_tag="CNE_2c07040"
                     /EC_number="1.13.12.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitronate monooxygenase"
                     /protein_id="WP_013952392.1"
                     /db_xref="GI:503718316"
                     /translation="MKTRITELLGIRYPIIQGGMQWVGYAEMASAVSNAGGLGILTAL
                     TQPTPEDLANEIRRCREMTDKPFGVNLTLLPSINPPPYARYLDVIIESGVKVLETAGN
                     NPKEHIARAKAAGIKVIHKCVAVRHALSAERLGVDAVSIDGFECAGHPGEDDVPGMVL
                     IPQAVRKLSIPVIASGGIADGRGMAAALVLGAEGVNMGTRFCATREAPIHDNVKKALV
                     QASERDTNLIFRTLHNTARVLKNAVSDEVVSIERRPGGAQFEDVKHLVAGVRGKAALK
                     AGETDGGIISAGQCVGLIDDVPSCEELITRMVADCREHLSVASRFFA"
     gene            758345..758815
                     /locus_tag="CNE_RS21550"
                     /old_locus_tag="CNE_2c07050"
     CDS             758345..758815
                     /locus_tag="CNE_RS21550"
                     /old_locus_tag="CNE_2c07050"
                     /EC_number="3.1.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_013952393.1"
                     /db_xref="GI:503718317"
                     /translation="MAEAEIEAAMTQAIAEPGEAAGGDVPEGFAPLRRLSGYMAGFGQ
                     LYLHAGRRTLAVRIDESHLNNLGIPHGGMLATLADTAIGMMMSLETGRSKSAVTVNLS
                     LDYLDSARQGDWVEARVEFDKLGSRLRYGTCRLVSGERCLLRATAIFAVLAPRT"
     gene            758962..760137
                     /locus_tag="CNE_RS21555"
                     /old_locus_tag="CNE_2c07060"
     CDS             758962..760137
                     /locus_tag="CNE_RS21555"
                     /old_locus_tag="CNE_2c07060"
                     /EC_number="2.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012355443.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013952394.1"
                     /db_xref="GI:503718318"
                     /translation="MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGAD
                     PALVEDVIMGCVSQVGEQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQA
                     VMSGAMDIVIAAGVESMTRVPMGLSSQLPAKNGFGVPKSPGVEARYPGVQFSQFTGAE
                     MIARKYDLSREQLDAYALQSHQRAIAATKAGRFTAEILPVEVRTADGANGEMHTTDEG
                     IRYDATLESIGSVKLIAEGGRVTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHT
                     MTVIGHDPVVMLEAPLPATEVALKKAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPE
                     RLNVHGGAIALGHPLGGSGAKLMTTLVHALHTHGKRYGLQTMCEGGGLANVTIVERL"
     gene            complement(760310..760984)
                     /locus_tag="CNE_RS21560"
                     /old_locus_tag="CNE_2c07070"
     CDS             complement(760310..760984)
                     /locus_tag="CNE_RS21560"
                     /old_locus_tag="CNE_2c07070"
                     /EC_number="3.1.3.46"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-2,6-bisphosphatase"
                     /protein_id="WP_013952395.1"
                     /db_xref="GI:503718319"
                     /translation="MATLFLVRHGQASFGAANYDCLSPTGRQQARWLGEYFQERGVSF
                     SRVVAGTLVRQQDTASEILAGMGQPQAAIVSHPGLNEYDGEALYRCHTGGADHRAHQN
                     GDYNDYWRTFRAAYAAWTQDGLADMPESWADFGARIAGALAHASEGTTREDAILVVSS
                     GGAIGRATADLLGAPAQAAIEMNLQFRNTAFCEIIVGRGVQRLLSFNNVPHLERADRR
                     SAVTFA"
     gene            complement(761183..761869)
                     /locus_tag="CNE_RS21565"
                     /old_locus_tag="CNE_2c07080"
     CDS             complement(761183..761869)
                     /locus_tag="CNE_RS21565"
                     /old_locus_tag="CNE_2c07080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013952396.1"
                     /db_xref="GI:503718320"
                     /translation="MSATQSGFTANASFPRIDTPSILQPPRQRRARETEQALLGAGRE
                     LLASRDFAAVSVAQIAAACQVSVGAFYGRFRDKMAYFEALRALVMEETAASTERYLAQ
                     ERWEDVPTPVLLEKAARFMVLGTLANRGVIRASLRHASTRPEEWVPHRQSGEAIVERM
                     VQLLVPRLAMPAETAELRVRFAMQAVFSVLVNAVLNDSGPLHLDDEQMIPELNRLMAG
                     YLGITCAEPA"
     gene            complement(762030..762764)
                     /locus_tag="CNE_RS21570"
                     /old_locus_tag="CNE_2c07090"
     CDS             complement(762030..762764)
                     /locus_tag="CNE_RS21570"
                     /old_locus_tag="CNE_2c07090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952397.1"
                     /db_xref="GI:503718321"
                     /translation="MPLSSAPTPTGFGTRVRRLLHRPSGNALRAAVLGVNDGLVSSFC
                     LVMGLEGAAASREAVILAGLAGLTAGACSMALGEWLSVTNSREMNNKRLRDMAHELAH
                     DAARARQRLVAVIEGKGVLPADAGRAADEIMRNPRAALDTFAREVLGINPQERGGNPV
                     QAAVISFVLYSSGALVPLLPFFVTAGPSAQLGSIVACLAGLGLVGWGTSSFNGRPGWF
                     SALRQVLIGGMAAAFTYGLGTVFGSL"
     gene            complement(762788..763678)
                     /locus_tag="CNE_RS21575"
                     /old_locus_tag="CNE_2c07100"
     CDS             complement(762788..763678)
                     /locus_tag="CNE_RS21575"
                     /old_locus_tag="CNE_2c07100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018314537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041228565.1"
                     /db_xref="GI:752557333"
                     /translation="MDKLRAMQTFVRIVDEGSLTAAATTLHTSLPAVVRTLAALESEL
                     QVRLLNRTTRRLSLTGEGRSYLDSCRRILATIDEVEAGLTASHVEPSGQLTLTASVLF
                     GQMYVAPAVTRFVQRYPRVRCRMEFTDRVVNLLEEDLDVGVRIGPLADSTLVAQTVGR
                     IRRVVVATPAYLRKHGVPRHPEELASANCVRFTGNHAHWWTFQADGREFHVQVSGNLE
                     FNQTAPAVAACAEGAGFGHFLSYQVAQLVEARKLRIVLEDFEQPAWPLSLIYPHARLL
                     PARTRAFIEWMRDDLSPRFN"
     gene            763789..764430
                     /locus_tag="CNE_RS21580"
                     /old_locus_tag="CNE_2c07110"
     CDS             763789..764430
                     /locus_tag="CNE_RS21580"
                     /old_locus_tag="CNE_2c07110"
                     /EC_number="2.5.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010811654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013952399.1"
                     /db_xref="GI:503718323"
                     /translation="MQESNRPAKPLVLYRSPVSGHAHRAELFLGLLGLPYRLVDVDLR
                     GGEQRSEAFLRLNPFGQVPVLDDDGVVVGDSNAILVYLATRYDDGRWLPRDPVGAARV
                     QRWLSVAAGDIAFGPAAARLGVLFGRPVAMDDAIARAQRLFTLMETLLAGQPFLAADH
                     ATIADVAAYSYIARAEEGNVPLAPYPALNAWLRRIEALPGFVPMLVSKVGLAA"
     gene            764485..765459
                     /locus_tag="CNE_RS21585"
                     /old_locus_tag="CNE_2c07120"
     CDS             764485..765459
                     /locus_tag="CNE_RS21585"
                     /old_locus_tag="CNE_2c07120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_013952400.1"
                     /db_xref="GI:503718324"
                     /translation="MDLPTWPHAGLPFHAGELAAQERAGKRERMAASGPRVIRGEMPE
                     QHRTFFAQLPFLLVGAVDADGQPWATMLAGTPGFAHTPDATHLRIDAVPLPGDPAAPA
                     LAQGARIGLLGIELPTRRRNRMNGIIAARDEGGMTVEVEQSFGNCPRYIQLRDVSLAE
                     PAPAPPAWHGEALDEQAVAWLRGADTLFIATSHAASPQDEGEHTGGTDVSHRGGKPGF
                     IRVDEAGTLTFPDFNGNNFFNTVGNLLANPRAGILVPDFADGSLLHVGGRAEVIWEGE
                     DLASFTGAERLMRLHVERVIRRPAVLPLRFGFREYSPVLADTGAWPAR"
     gene            765638..766606
                     /locus_tag="CNE_RS21590"
                     /old_locus_tag="CNE_2c07130"
     CDS             765638..766606
                     /locus_tag="CNE_RS21590"
                     /old_locus_tag="CNE_2c07130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_041228812.1"
                     /db_xref="GI:752557580"
                     /translation="MLKHALLALAAAPLALAAGTAQAAWPEKPIRLVVAFPPGGPVDT
                     HARLLAEKLQPILGQTIVIDYKAGAAGNIGSDNVAKSAPDGYTLLLANTGQMAINNSL
                     YPKLPYSMPKDFAPVARTALIPLVMVVNNNVPARDLKTFISYAKANPGKLNFASGGNG
                     GISHLMPEMFKQASGTFIVHIPYKGSSPALTDVMGGQAQMMADSIPLFTQYIKAGKVR
                     ALAVTSPQRSPALPDVPTMQEAGLKGFEVVGFYGMLAPAGTPKDVVARLSGALRTVLA
                     DPDTKAKLEQQGAEPAWQSPEAFAATITVEQKRWGQAVKASGASID"
     gene            complement(766636..767076)
                     /locus_tag="CNE_RS21595"
                     /old_locus_tag="CNE_2c07140"
     CDS             complement(766636..767076)
                     /locus_tag="CNE_RS21595"
                     /old_locus_tag="CNE_2c07140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952402.1"
                     /db_xref="GI:503718326"
                     /translation="MPANPVPPAETAHGAASLRASLGVLWAAAITGACAGLEASAMQD
                     VFDSWKNVPIDEAKRQWGPPQAVQALPSGTAYVWNDSVAPARAPGSGPRDAGMERTPV
                     PGQCQRKLVTGQDGIVIGGEWRGDACCITTLIGHCASLKYRGHS"
     gene            complement(767190..768785)
                     /locus_tag="CNE_RS21600"
                     /old_locus_tag="CNE_2c07150"
     CDS             complement(767190..768785)
                     /locus_tag="CNE_RS21600"
                     /old_locus_tag="CNE_2c07150"
                     /EC_number="3.1.25.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine utilization protein"
                     /protein_id="WP_013952403.1"
                     /db_xref="GI:503718327"
                     /translation="MPDMPTYLPSRLPADGARLLDAQSLAAALSRPIVFVDLETTGAD
                     AQRDRITEIGVVEVGPDGIIEWDTLLDPGMSIPPFIQRMTGITEEMVHGQPTFESLAE
                     SLAERLQGRLLVAHNARFDYGFLKNAFRRAGVTFRADVLCTVRLSRSLFPSVERHGLD
                     ALIARFGLTPKGRHRALADAELLWQFWQKIHATYSVELVESAVRTLVRRASLPAGLDE
                     TALEDVPAAPGVYIFYGDQDVPLYVGKSVHLRQRIGAHFSGDYRYGKDMRLARLVRRV
                     EWRETGGETGALLLEARLVKAMQPVHNQLLRRNARLFAWELPQQLPVPRLRSDRDTDF
                     CRHRDLFGVFGNRGAAEARLRALAQEHGLCLATLSLEKTTRRGSPCFARQVHRCAGAC
                     VGAEPSSAHRARLAAALAPIALMPWPFDGPAAWREQHDGRAWWHVADDWCYLGCAATL
                     EEAQALAAAPAHFDLDTYQILAPRLAQWMPQAMPLSVHRPFTLTAPEAPAEAPRPARI
                     PAGQTARKAPPAAAQQPLGLFAD"
     gene            769272..770849
                     /locus_tag="CNE_RS21605"
                     /old_locus_tag="CNE_2c07160"
     rRNA            769272..770849
                     /locus_tag="CNE_RS21605"
                     /old_locus_tag="CNE_2c07160"
                     /product="16S ribosomal RNA"
     gene            770871..770947
                     /locus_tag="CNE_RS21610"
                     /old_locus_tag="CNE_2c07170"
     tRNA            770871..770947
                     /locus_tag="CNE_RS21610"
                     /old_locus_tag="CNE_2c07170"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:770905..770907,aa:Ile,seq:gat)
     gene            770959..771034
                     /locus_tag="CNE_RS21615"
                     /old_locus_tag="CNE_2c07180"
     tRNA            770959..771034
                     /locus_tag="CNE_RS21615"
                     /old_locus_tag="CNE_2c07180"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:770992..770994,aa:Ala,seq:tgc)
     gene            771313..774217
                     /locus_tag="CNE_RS21620"
                     /old_locus_tag="CNE_2c07190"
     rRNA            771313..774217
                     /locus_tag="CNE_RS21620"
                     /old_locus_tag="CNE_2c07190"
                     /product="23S ribosomal RNA"
     gene            774327..774439
                     /locus_tag="CNE_RS21625"
                     /old_locus_tag="CNE_2c07200"
     rRNA            774327..774439
                     /locus_tag="CNE_RS21625"
                     /old_locus_tag="CNE_2c07200"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(774518..775666)
                     /locus_tag="CNE_RS21630"
                     /old_locus_tag="CNE_2c07210"
     CDS             complement(774518..775666)
                     /locus_tag="CNE_RS21630"
                     /old_locus_tag="CNE_2c07210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose ABC transporter permease"
                     /protein_id="WP_013952404.1"
                     /db_xref="GI:503718328"
                     /translation="MPSPCLLPVLALAVCMVGAAEFMLSPMLAPLAGAFATTPARASG
                     LVSAYALSYAVAAPLIGWFSDRAGRRRVLLAALLLFALDGIVLTLAPTLHVAMALRIL
                     GGLAAAATIPTAFALIADLLPPARQAGAMGSVMLGMSAGIAAGPAVAGVLADGLGWRA
                     PFLVTAGGCLAAFLAGCHVLPCNLPRSGDSQEKLRNTATSSGILLPLIAKGAWNGSAV
                     AGYVLAGEVLRLRYGLGVAGVGAALSVFGLGLGVGNLLAGRASQCFVREESVLMVATA
                     LVAVAMTLFTTAILGLPGSLGCLLAWGAALGIAAPSSTAILARRAATAKGQVLAVSES
                     INNLAVLMLIPIAAGSLAVHGTVPAALLVGGCCLAGVALTVADRRMTA"
     gene            complement(775950..776957)
                     /locus_tag="CNE_RS21635"
                     /old_locus_tag="CNE_2c07220"
     CDS             complement(775950..776957)
                     /locus_tag="CNE_RS21635"
                     /old_locus_tag="CNE_2c07220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952405.1"
                     /db_xref="GI:503718329"
                     /translation="MKDAKDLHAAPRWLAGVMVMASALAGTSGAAAADAYPGKPITLV
                     VPYSAGGPTDVVARTLAQAMSQDLGQSVVVENRTGAGGTVAAAFVARAQADGYTLLIH
                     HNGMATAPALYKKLSYAPLKDFEYVGQVADVPMTLMGRKDLPAKTVPELIRYVTQNKD
                     KVSLANAGLGAVSQLCGVLFEQSVHVKLNAIPYQGAGPALTALLGGQVDLLCDQTTAT
                     LPHIQADRVRLFGVTTPARIKALPSAPTLQEGGLKGFDVKVWHGIYAPKGTSPAVVAR
                     LTKALQKGLQDPVVIKKLDGLGAEIVPVDKQTPEGLRTLLKAESDKWQPLLKSMQIEA
                     D"
     gene            complement(777132..779861)
                     /locus_tag="CNE_RS21640"
                     /old_locus_tag="CNE_2c07230"
     CDS             complement(777132..779861)
                     /locus_tag="CNE_RS21640"
                     /old_locus_tag="CNE_2c07230"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_013952406.1"
                     /db_xref="GI:503718330"
                     /translation="MNLSDIPVVSATLTTTTATTCPYCGVGCGVRATVRADGQVEIAG
                     DAQHPSNHGRLCVKGSALGETVDLEGRLLHPKVRGTDGSLQQVSWDHALDTVAQGFSD
                     IVRRHGPDSVALYVSGQLLTEDYYIANKLMKGFIGSANIDTNSRLCMSSAVAGHKRAF
                     GEDLVPGNYEDLELADLVVLVGSNTAWCHPILFQRLSQAKEARPEMKIVAIDPRRTAT
                     CELADLHLAIRPGTDVWLFNGLLSYLAREGRTSAAFVAASTAGLDEALQAADAACADP
                     AAVARACKLNVQDVLAFYQLFAQTEKTVTAFSQGVNQSSAGTDKVNSIINCHLLTGRI
                     GAPGMGPFSLTGQPNAMGGREVGGLANMLAAHMELANPLHRDVVQSFWQSPMVADRPG
                     LKAVELFEAIEAGRVKAVWVIATNPVVSLPDADQVRRALARCELVVTSDIIERTDTNA
                     AAHVLLPALGWGEKDGTVTNSERRISRQRAFLPAPGEARADWRILCDVARRMGFDGFD
                     YAGVHEIFDEHARLSAWRNDAAPRVFDIGALAGLDQAHYDALEPVQWPLPAGAPAGAG
                     TQRLFADGRYAHADGLARFVATPPRSPAHAPDDDFPLILNTGRVRDQWHTMTRTGKSA
                     KLADHLPEPFVDMHPQDALLSGVGEGKLARVSTRWGAMVARVRHGGGIPRGSVFVPIH
                     WNGQFSSDARVGALVNPVVDPVSGEPEFKHTPVRVEPFGVNWHGFVLSRGALPAEALT
                     YWTRVQGRQFQRYEFAGRDTVADRTAWARALLGVTDPDADWLEYEDRTAGVYHAGYVV
                     NDRLEACVYVSTRPELPSRAWLAGLFGREQLEDADRIGLLLGQPMEKGADTGPTVCSC
                     FGVGRNTICDAVRKHDLKTPAEITACVKAGGNCGSCVPELKKLLVEVRVAEVA"
     gene            complement(<779931..781148)
                     /locus_tag="CNE_RS21645"
                     /old_locus_tag="CNE_2c07240"
     CDS             complement(<779931..781148)
                     /locus_tag="CNE_RS21645"
                     /old_locus_tag="CNE_2c07240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015259181.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228813.1"
                     /db_xref="GI:752557581"
                     /translation="MTPSANPQARPRLVVVGNGMAGMRTVEELLRLAPDLYDITVFGA
                     EPHGNYNRILLSPVLAGEKSVADIMLNTREWYTERGIELLAGDPVVAIDRPRRIVRSA
                     SGREVRYDRLLLATGSKPFILPVPGHQLDGVIAFRDIQDVETMQQAARDHRHAVVIGG
                     GLLGLEAANGLLRQGMDVTVVHLPDSLMERQLDKPAATLLQSALERKGLRFLLGAQTA
                     EILGTDRVTGVRFKDGSEIPADLVVMTAGVRPNIELATGAGLHCERAIVVDDTLQTYD
                     PRIYAVGECVQHRQATFGLVAPIWDQARVCAAHLAGAGHRRYVQQATATKLKVTGVDL
                     YSAGDFIGAEGSEDLVLRDPRRGVYKRLVLQDGYLVGAVLYGDVQDGPWYFDMIQRRT
                     PVGALRQRLLFGQA"
     gene            complement(781207..781590)
                     /locus_tag="CNE_RS21650"
                     /old_locus_tag="CNE_2c07250"
     CDS             complement(781207..781590)
                     /locus_tag="CNE_RS21650"
                     /old_locus_tag="CNE_2c07250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011300975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_041228566.1"
                     /db_xref="GI:752557334"
                     /translation="MSHPHHPETWTAVCTVRDIVPNTGVCALVDDKQVAVFRIGRGDE
                     VYAIDNFDPNSQAAVLSRGLVGNLGERLVVASPIYKHHFDLRTGECLEAPEHSVNAYA
                     ARVYDGKIWIAAGVAVSEAEEELAA"
     gene            complement(781617..784178)
                     /locus_tag="CNE_RS21655"
                     /old_locus_tag="CNE_2c07260"
     CDS             complement(781617..784178)
                     /locus_tag="CNE_RS21655"
                     /old_locus_tag="CNE_2c07260"
                     /EC_number="1.7.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_013952409.1"
                     /db_xref="GI:503718333"
                     /translation="MKLIIVGHGMVGHKFLECLAEAGAQNVEVTVLCEEPRPAYDRVH
                     LSEFFAGKSAEDLSLVPAGFFEQHNNMLLRLNARAVEIDRAARTVKVSTGETLSYDKL
                     ILATGSYPFVPPVPGKDRKDCFVYRTIEDLEAMRECGARSKTGVVVGGGLLGLECAKA
                     LRDMDLQTHVVEFAPRLMAVQVDEGGGRMLRQKIHGLGVTAHTGKNTVEIIDGEDGTH
                     RMVFADGTHLDTDMIVFSAGIRPRDELARTSGLAVGERGGIVVDNQCLTSDPDIYAIG
                     ECALWQGKIYGLVAPGYDMARVAARHLQGEAAEFAGADMSTKLKLMGVDVASIGDPHG
                     TVPGARFYQFCDDRKEVYKKLVVSDCGKYLLGGVLIGDASEYGTLLQMMLNKIELPES
                     PEFLILPDSSGKAKPALGADALPDTAQICSCNNVSKSEICAAVCDGATSIGALKTCTK
                     AGTACGGCVPLVTQIMKAEMKKQGMAVNNHLCEHFPYSRQELYHLVRVGKFKTFDALL
                     EAHGKGMGCDICKPAVGSILASCWNEFVLKEEHASLQDSNDYYLANIQKDGTYSVVPR
                     MPGGEVTPEGLIAVGQVAKKYGLYTKITGGQRVDLFGARAEELPFIWEELIAAGFESG
                     HAYGKALRTVKSCVGSTWCRYGVGDSVGLAIELENRYKGLRAPHKIKFGVSGCTRECA
                     EAQGKDVGVIATDKGWNLYVCGNGGMKPRHAELLASDLDHDTLVRYIDRFLMFYVRTA
                     DRLQRTSVWRDNLEGGLDYLKAVVLDDKLGLAAELEAEMQHVVDTYEDEWKKAVTDPE
                     TRKRFRHFVNSDRRDDNVAFIEERGQIRPATPEERKLHRSRLSHIPVVSMPAKAA"
     gene            complement(784244..785563)
                     /locus_tag="CNE_RS21660"
                     /old_locus_tag="CNE_2c07270"
     CDS             complement(784244..785563)
                     /locus_tag="CNE_RS21660"
                     /old_locus_tag="CNE_2c07270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013952410.1"
                     /db_xref="GI:503718334"
                     /translation="MTAKATRIELLSFKTPQMRAFHLTWMAFFVCFFAWFACAPLMPV
                     LKGEFGLTPGQIANINIAAVAVTILVRLVIGPMCDRFGPRKTYTGLLALGALPVLGVA
                     LAQNYETFLTFRLLIGAVGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGAAQA
                     IMPLLLAAVLMLGADHAFGWRFALLVPGVLMLIMAVVYWRFTQDCPEGNYSDLRARGI
                     AITGKDGGKGGGWASFRAASANYRVWLLFITYGACFGVEIFIHNIAASYYVDRFGLSL
                     KAAGMAAASFGLLALFARALGGWLSDKAARRRGLDARATLLFVLILGEGLGLLWFAQA
                     GNVTLAVVAMLLFGLFTHMACGATYALVPFIDRKALGGVAGIIGAGGNVGAVAAGFLL
                     KGLGDLQHTLTVLGVLATIAALCAIAIRFSAEHKAQEQALYDSAMAN"
     gene            complement(785882..786367)
                     /locus_tag="CNE_RS21665"
                     /old_locus_tag="CNE_2c07280"
     CDS             complement(785882..786367)
                     /locus_tag="CNE_RS21665"
                     /old_locus_tag="CNE_2c07280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_013952411.1"
                     /db_xref="GI:503718335"
                     /translation="MLARIMTPNASDLRHCSIAATLSLIGEKWTMLILRDVFHGVTRF
                     DDFLRRLECSPAVLSARLKTLTDAGLLRKVGYREPGERERSEYRPTRAAVELLPVLVG
                     LMQWGDSHMAPSGEGPVQIRSRASGKLVRAALVDEDGAEVSPRDMLIVPVNAQSPASD
                     Q"
     gene            786446..787027
                     /locus_tag="CNE_RS21670"
                     /old_locus_tag="CNE_2c07290"
     CDS             786446..787027
                     /locus_tag="CNE_RS21670"
                     /old_locus_tag="CNE_2c07290"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_013952412.1"
                     /db_xref="GI:503718336"
                     /translation="MDDQSEARTGKAESWMVGRGVQVTLRRTRPQDSGALRALVDGLS
                     RESRYFRFLSGGRVVDAIVDGLAAPGPGGVALVVEAPDAEGVSAIVASAEYVVSGQVG
                     EFAVVVADGWQGQGLGRRLIARLCELACAAGLRTLRGDVLSENRRMLAILRGLGFASR
                     RNPEDSYLHEVTLALGQPARSELRLPADWFSAS"
     gene            complement(787037..787921)
                     /locus_tag="CNE_RS21675"
                     /old_locus_tag="CNE_2c07300"
     CDS             complement(787037..787921)
                     /locus_tag="CNE_RS21675"
                     /old_locus_tag="CNE_2c07300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041228567.1"
                     /db_xref="GI:752557335"
                     /translation="MSKLPQTAAHRRSTLIAVLALTGSMASLCIGTSFAKSLFSALGA
                     QGTTALRVSFSALILLCVWRPWRIPLTRANARAIALYGAALGATNLLFYMSLRTIPLG
                     LAIAIEFTGPLAVAVLSSRRAIDFLWIGFAVAGLLLLLPVGDAAGTLDPVGIGYALAA
                     GVGWALYIVFGQMAGNAHGGQATSLGLTMAALVVLPFGMAHAGTAMFSPTLLLFGLAV
                     GILSSAIPYSLEMVALKRLHRRTFGILLSMEPAMGALAGLAFLHEQLSALQWLAIASI
                     ITASVGCTMTSRGKREAG"
     gene            complement(788044..788466)
                     /locus_tag="CNE_RS21680"
                     /old_locus_tag="CNE_2c07310"
     CDS             complement(788044..788466)
                     /locus_tag="CNE_RS21680"
                     /old_locus_tag="CNE_2c07310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_013952414.1"
                     /db_xref="GI:503718338"
                     /translation="MERMTRQRGAVIDALREAGRPLSPAEILAAAQRQVPSLGLATVY
                     RNIRTLLDDAQVHAVELPGQPDRYELAGEPGAVTHRHYFQCLTCDRVFPLEGCPGHME
                     EITPPGFEVEHHELTLLGRCPDCASKSGKRRRAAARDH"
     gene            788566..790748
                     /locus_tag="CNE_RS21685"
                     /old_locus_tag="CNE_2c07320"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            790751..791968
                     /locus_tag="CNE_RS21690"
                     /old_locus_tag="CNE_2c07330"
     CDS             790751..791968
                     /locus_tag="CNE_RS21690"
                     /old_locus_tag="CNE_2c07330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013952416.1"
                     /db_xref="GI:503718340"
                     /translation="MLPAKSRTAAPLSSPTVFPSAAGTRPAGGRLLSIDALRGLVILT
                     MLLDHVRDMFFLHVQVADPMDVATTSPALFFSRLAAHLCAPVFIWLAGVSAWLYGAAG
                     HDRRAVSGFLLKRGVFLVLLEVTLVGFAWTGTLPPQVIYLQVIWAIGLSMMALAALVW
                     LPRAVLIAAGIALVAGHNLLSPLHFPVDSAWHVPWAILHDRTWFEVADGFRVRTSYPV
                     LPWIGVIALGYAAGPWFAATVPAGVRQRLLAGCGLAALAGFAVLRALNGYGQEQKWIS
                     GSDALHTAMSFLNATKYPPSLLFLLLTLGVGWLLLAWLERAQGGWIARRMAVFGAVPM
                     FFYLLHLYVLQGLYQACVHRWGLNQGKVFGLDHVWQLWLGAAVLALVLWPTVRWFAAL
                     KARRRDWRWLKYF"
     gene            complement(791996..793801)
                     /locus_tag="CNE_RS21695"
                     /old_locus_tag="CNE_2c07340"
     CDS             complement(791996..793801)
                     /locus_tag="CNE_RS21695"
                     /old_locus_tag="CNE_2c07340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_041228568.1"
                     /db_xref="GI:752557336"
                     /translation="MRSLPRPRTLPPPRLLLPAALVLALAACSLEPQYQRPDAPVPSA
                     WPEGAAYRTPQASAAQPGQPAQPAGPSAADLGWRDVFIDPQLRQLIELALANNRDLRM
                     ATLAIDEARALYQIERAAQFPTVEGNAGMVSQRLPQRLRAAGQSPQITTYNAGIGFTA
                     FELDFFGRVRSLKHAALEEYMATEEARRSAQISLVSEVANAYLTLLADRALLKLSQDT
                     LKTQQDAAEMVRRGRQVGAMAQLDQHRAQTQVQTSQVGVEQYTRQVAQDENALSLLIG
                     GPLPKSVTDAGAATANANAAAQDPLDARTLVSEFPEGLPSSVLVRRPDILNAEHRLKA
                     ANANIGAARAAFFPRISLTGALGVASSSLAGLFSGGMAWVFAPQLTVPIFDAGRNRAG
                     LDAANVRKDINVANYEKTIQTAFREVADSMAARATYERQVQAQEALVREGSETRRLSE
                     MRFKNGVDDYFGVFDAQRQLYTAQQALITYKLAGLTSRVSLYKSLGGGWREVTEAAPA
                     ANGGARQAPAARPQAAAQPQAAARPQAVTQPQAVARSQAVAQPQAAAQPQAAAQPQAV
                     APAQAAAQPQAVAQPQAPAQSPAAAQPAPVAATPR"
     gene            complement(793841..795802)
                     /locus_tag="CNE_RS21700"
                     /old_locus_tag="CNE_2c07350"
     CDS             complement(793841..795802)
                     /locus_tag="CNE_RS21700"
                     /old_locus_tag="CNE_2c07350"
                     /EC_number="2.4.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_013952418.1"
                     /db_xref="GI:503718342"
                     /translation="MFALFLENQTLLVINGGVLLAMVLLSMLCRHDRPADRVLFGGVA
                     ALLLVVYLTWRIRETLPDWQMTFASVWAHVFFTFECMTLAYTLLSIVVLARTSNHTPD
                     ADAGEAALRRAKQVPPVDIFIATYNEGLDILEKTIVSALAIDYPDFRVWVLDDTRRDW
                     LREFCERVGAHYVTRPDNAHAKAGNLNNGLRHSAAAGGAPYILVLDADFAPHRNILLR
                     TVGLFSDARVGVVQTPQFYYNADPIQYNLRATECWVDEQRAFFDVMQPAKDAWGAAFC
                     IGTSFVVRRDLIDLIGGFPTGTVTEDIHLTYRLLPHGYLTRWLNERLSVGLSAEGLPE
                     YISQRSRWGLGTIQVALTADGPLRGRGYTGMQRLHYVHGLLHWLSRPFTLMLLAGPLL
                     YWYLGVSTLYGEPLQFLAYGLPALVAYWAYSIWITGQRALPIFTEVTQIVAALAVTAS
                     LVSAMFKPFGRPFKVTNKGLDRSKLVIHGKFVALYAGLLGFSALGLGRALVVDPDAQG
                     LAFNTIWTGVALMLYLASLLVCVELPRPRKEERFPHRAAALLRVDGKEYRVTTRDLSC
                     NGVAVTTPLAPAIPAGTEGALWLEQTGWIPCRVVRRDGQLLGIALNAGMAARHALIRL
                     LFTDPAHNIARQGRPKLALSRFVRRALLG"
     gene            complement(795805..797151)
                     /locus_tag="CNE_RS21705"
                     /old_locus_tag="CNE_2c07360"
     CDS             complement(795805..797151)
                     /locus_tag="CNE_RS21705"
                     /old_locus_tag="CNE_2c07360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013952419.1"
                     /db_xref="GI:503718343"
                     /translation="MRLPIPTARLPRLVAGALLPAMLALAPCAARAAEPAQQTLLADG
                     CKTLAERVSRESGNGPVFLASYEPAPGGEPLAPALRNAAFVYDNALAGIALVACKRPA
                     EARRIADAVLQATRQDRHFRDARLRNAYRAGPLPAGPVPLPGWWDEPSKRWFEDAYQA
                     GTATGNVAWAALLLLAVHDATRDPRYLDGAAALMGWVHATVPDTGAPAGYIGGFFGHE
                     PKQTRQGWKSTEHNVDTYAAFSWLASQRNDPRWRDGAARSRGFVGAMWQAREGRFIIG
                     TRDDGRVPNAGPSALDAVLWPLIAIPDPPQDWRRNLAWVEAKHRAGAGYGFKGGPDGI
                     WTEGTGQAALVLQAAGQAQQSQPLWQLLLSQRAPSGMLYATPEARISTGLSIGPTSTT
                     EDFHYFHLPHLGATAWAVLAAARWNPFRPGGCLEPSCPPPAIAAAPANASTNTTKD"
     gene            complement(797179..798570)
                     /locus_tag="CNE_RS21710"
                     /old_locus_tag="CNE_2c07370"
     CDS             complement(797179..798570)
                     /locus_tag="CNE_RS21710"
                     /old_locus_tag="CNE_2c07370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_013952420.1"
                     /db_xref="GI:503718344"
                     /translation="MADQRNNPPPRQHPLTPAPLRQPHGDGLVQRPQPVPVPLWHIVP
                     RMAGYGVVLFIIWAVLTIMFPNVFTRSSERAVVNSPVSLVTSPVEGIVMKQMVAADQP
                     FSANQALMIVQNPNIDRSLLVDLTGKKLDNQQRYDSAKARLESNRRLMAATEQDLQRY
                     NSAAQREHGARVRALEARLASAKAQEDQQQEVVNRNQSMQWAGAVSEAYTNASRYQLS
                     MLSNAKAAAKAELDNAVGVSEAARNKVYASSTDGPSATLAQRRQVLSAESAQLTAELE
                     QLEAYGKSVDEMIATEQERLDRLSNLEIRSTEPGTIEDLIAQPGMRVAAGATLARASN
                     CAQTRVVAVFPRSLSDNLLPGARLNVHVDGVPTALPASVAEVLPRAPDGDQARYFVPF
                     PPIEKNEIYVIAKLDRPLDNVPGKAAASGTATRAAAGAAAGPSQSGHCGMGRWARVTL
                     NQSWLGQLRASLI"
     gene            complement(799204..800295)
                     /locus_tag="CNE_RS21715"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(800428..>800730)
                     /locus_tag="CNE_RS21720"
                     /old_locus_tag="CNE_2c07400"
     CDS             complement(800428..>800730)
                     /locus_tag="CNE_RS21720"
                     /old_locus_tag="CNE_2c07400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013122085.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041228279.1"
                     /db_xref="GI:752557047"
                     /translation="DLRDIFTGVCADFEAELVEFDGEDDHVHLLVNYPPKVAVSALVN
                     SLKGVSSRMIRKKNYPSISKKLWGGALWSPSYFAGSCGGAPIEIIRQYIEQQQTPH"
     gene            800815..801942
                     /locus_tag="CNE_RS21725"
                     /old_locus_tag="CNE_2c07410"
     CDS             800815..801942
                     /locus_tag="CNE_RS21725"
                     /old_locus_tag="CNE_2c07410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013956511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine methyltransferase"
                     /protein_id="WP_041228814.1"
                     /db_xref="GI:752557582"
                     /translation="MPNGEQQRNMRRYVGSCRFVYNKALALQKQRYDQGEKKLSYAGL
                     CKQLTEWRNSTETAWLADAPVHPLQQTLKDLERAYTNFFAKRADFPRFKKKGLGDSFR
                     YPDQKQIKLDQTNSRIFLPKLGWLRYRNSRDVLGEVRNACVSLSGGKWFVSIQTERKV
                     ERPVPKATSAIGIDMGIARFATMSDGTFLAPLNSFRKHEARLRRAQRAMSRKTKFSNN
                     WKKSKARIQRIHARIGNARLDYLHKATTTISENQAMVCIEDLKVRNMSKSAAGSSGQP
                     GKNVRAKSGLNKAILDQGWYEFGRQLEYKLAWNGGWLIAVPPQHTSRTCPCCGHVSAE
                     NRQSQASFACVACGYANHADVVGAINVLARGHRVAACGESA"
     gene            complement(802089..803498)
                     /locus_tag="CNE_RS21730"
                     /old_locus_tag="CNE_2c07420"
     CDS             complement(802089..803498)
                     /locus_tag="CNE_RS21730"
                     /old_locus_tag="CNE_2c07420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010814226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_041228815.1"
                     /db_xref="GI:752557583"
                     /translation="MPGRLDRLPWSRWHWRVAIALGVAWVLDGLEVTLVGSVGAVLER
                     PDTLGLTATQVGWSGSLYIAGAVLGALVFGRMADRLGRKRLFLATLAVYMVATLATAF
                     SPGFAFFAACRFFTGLGIGGEYAAINSAIDELIPARVRGRVNLAINGSFWLGAALGAG
                     LSLVLLDARVFGPVWGWRVCFALGAVLAVAIVLVRRHVPESPRWLATHGRLEEAERVI
                     AAIEAEVRARHGPLPPVAPDCVAMTMRRRAAPGVGEVMRLLLRRFRRRSVITLALMVA
                     QAFFYNAIFFTYALVLTRFYAVPEARVALYIFPFALGNALGPLLLGPLFDHIGRRRMI
                     GATYVLSGIGLALTGWAFVAGWLDARAQALCWSAVFFLASAAASSAYLTASEVFPLEM
                     RALAISVFYAVGTGTGGFIAPVLLGALIESGSREAVAAGYGFGAVLVIVAGLLALRFG
                     IDAERRPLEHIAPPLAADD"
     gene            complement(803736..804431)
                     /locus_tag="CNE_RS21735"
                     /old_locus_tag="CNE_2c07430"
     CDS             complement(803736..804431)
                     /locus_tag="CNE_RS21735"
                     /old_locus_tag="CNE_2c07430"
                     /EC_number="1.13.11.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase"
                     /protein_id="WP_013952426.1"
                     /db_xref="GI:503718350"
                     /translation="MTERPAVGADGTADTDAARRRFLHELGGLLAAAGIAPGAAAATP
                     AACLLTPAATEGPFYLDDAQVRADIRDDRPGQPLRLRIRVVDAGRGCTPVPGALVSIW
                     HCDADGSYSGEGRGNRQARFLRGVQPTSQDGVATFMSIYPGWYAPRAIHIHFKVLLGQ
                     SEALTSQLYFSDTLNREVLSSHPAYRAHGVPSRATAQDPIAGSHPNQMRVRQAADAAG
                     LLEAEFTVGIARP"
     gene            complement(804499..804708)
                     /locus_tag="CNE_RS21740"
     CDS             complement(804499..804708)
                     /locus_tag="CNE_RS21740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041228569.1"
                     /db_xref="GI:752557337"
                     /translation="MLSPHELATLLLLSDGPDSLDSSDSRQIDPIDLKALVEKQLVQL
                     DILHGSRQEPRITSHGYSMLKAMRR"
     gene            complement(805075..805542)
                     /locus_tag="CNE_RS21745"
     CDS             complement(805075..805542)
                     /locus_tag="CNE_RS21745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMP deaminase"
                     /protein_id="WP_041228570.1"
                     /db_xref="GI:752557338"
                     /translation="MSTTEAYLLDSIRLAMENVRERNTWPFGAVVVRDGKVLARAVNE
                     VEANCDPSAHAEMQAVRAASRALGKPDLSGCTVYASGYPCPMCLSAMYLAGVKAVYYA
                     YSNEDGEPYDLSAERGYIELARPLEQREMTLAYVPARDEGIDLYEAWREQQGQ"
     gene            805810..806481
                     /locus_tag="CNE_RS21750"
                     /old_locus_tag="CNE_2c07460"
     CDS             805810..806481
                     /locus_tag="CNE_RS21750"
                     /old_locus_tag="CNE_2c07460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ankyrin"
                     /protein_id="WP_013952429.1"
                     /db_xref="GI:503718353"
                     /translation="MLAARLSICLALVIAMLTPTLAAAGGPPEQQLREAAASGNAAQV
                     TALLGQGASIDDRDAQGRTALLLATHHNRVQAARVLIDAGADVNAKDAIHDSPYLYAG
                     ARGYNEILRLTLAHGADLRSTNRYGGTALIPAAERGHVETVRTLIAAGVAVNHVNKLK
                     WTALLEAIILGNGGQALTEIVRLLLKAGADVNLADGDGVTPLQHARQRGYTRIEQILS
                     AAGAR"
     gene            806614..807087
                     /locus_tag="CNE_RS21755"
                     /old_locus_tag="CNE_2c07470"
     CDS             806614..807087
                     /locus_tag="CNE_RS21755"
                     /old_locus_tag="CNE_2c07470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_041228571.1"
                     /db_xref="GI:752557339"
                     /translation="MPEADPAKELLWARPGFLVRRLHQIHVAMFFEECKSPNITPVQY
                     AILTVLSVLPGLDQTSLGQEVGLDRTTTADVVRRLEERGLVERRDNPADRRTRHVYLT
                     REGKSVVTALRADMARAQERMLAPLKPAQREVFMDLLATLVEANNQYSRTVLRSM"
     gene            complement(807127..807651)
                     /locus_tag="CNE_RS21760"
                     /old_locus_tag="CNE_2c07480"
     CDS             complement(807127..807651)
                     /locus_tag="CNE_RS21760"
                     /old_locus_tag="CNE_2c07480"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_013952431.1"
                     /db_xref="GI:503718355"
                     /translation="MKPMNYSLYCESALGTARAIELRLEIEAFHAEYCAVLDAGLVEQ
                     WPRFFTEDALYRITARENAERNLPVGLVYAEGVGMMRDRAAAIANTQMFAPRYNLHLV
                     TNTRVSDETADGDILAQANYMLLQTLVEGPTTIHLAGTYYDRFRRQGGRLLLRERQVV
                     YDTTIIANDLVYPV"
     gene            complement(807678..808967)
                     /locus_tag="CNE_RS21765"
                     /old_locus_tag="CNE_2c07490"
     CDS             complement(807678..808967)
                     /locus_tag="CNE_RS21765"
                     /old_locus_tag="CNE_2c07490"
                     /EC_number="1.14.12.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl 2,3-dioxygenase"
                     /protein_id="WP_013952432.1"
                     /db_xref="GI:503718356"
                     /translation="MYQTQAVIQHTLGKKDAGLADCRWPEDSLHYIPDWVYTSKEVHD
                     LELQKIFRGRSWNYVALEAEIPNAGDYKRSYVGATPVVVSRAEDGSVNVFENRCAHRG
                     AEFCRHSQGNAKEFVCPYHQWSYDLKGNLQGVPFKRGVNRAGGMPRDFRNEDHGLVKL
                     NVATRNGVVFASYAADMESLEDYLTPEILKDFDIVFNGKPLKVLGYYKNELPCNWKMY
                     HENLKDPYHATLLHSFLVVFGLLVAGNESAMIADPVHGRHGTMASAKKEDKYAAVSDE
                     NKKEMRSYHEGMRLEDERFLEYVKEFDSPWSVTMQTIWPNLIVQREMNTLGVRQIVPN
                     GPDSMLMLWTMFGYEDDTEEMTQHRLRQGNLMGPAGFLGLEDNEAMKFVQEGVRRSSS
                     DLNVLKLDPDQVGTSNSLISESAIRAMYQYYRGVMGF"
     gene            complement(808980..810260)
                     /locus_tag="CNE_RS21770"
                     /old_locus_tag="CNE_2c07500"
     CDS             complement(808980..810260)
                     /locus_tag="CNE_RS21770"
                     /old_locus_tag="CNE_2c07500"
                     /EC_number="1.18.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin reductase"
                     /protein_id="WP_013952433.1"
                     /db_xref="GI:503718357"
                     /translation="MPQDTPILIVGAGQAGAMAAAELRRLGHRGRIVMAGGERHAPYE
                     RPPLSKSLLADAAQDGKIGVHPAGFYAGQDIELRLGTTVTALGPAHSVAHCADGEAIR
                     YAACLLATGGNARVLPALPPGTPHVHYLRTLDDAARLRDAMQRAREVIVIGGGFLGLE
                     TASTAAGIGLRVTLIESADRLLGRALPPELGSWLAQRVLAQGVELRLGCGIAALVPQA
                     DGVQVRLADGAALQAPLVVVAIGLTPEVALGAAAGLALDPANGGIQVDQQGHTSAAGI
                     YAAGDCCSQYQPLFGAHMRLESWQSANEQARIAAAAILGVQAEPAAMPWFWTDQFGCN
                     VQMLGAATPDTRYAWRGIAASDAPSPRFMLLGTRHGRLSHAIAINAGGDLRPLRVLFG
                     HAVEDLLPRLCDDALPLRQLVRDLPTAAASPTTL"
     gene            complement(810272..810577)
                     /locus_tag="CNE_RS21775"
                     /old_locus_tag="CNE_2c07510"
     CDS             complement(810272..810577)
                     /locus_tag="CNE_RS21775"
                     /old_locus_tag="CNE_2c07510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011299903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_013952434.1"
                     /db_xref="GI:503718358"
                     /translation="MAWIEIDAAHGLQNDEVMPLTLGDRQLAVYRSDDQYFVTDNVCT
                     HQYALLSDGYLEDGCIECPLHQARFDIRSGKAMCAPATSDIRTYPVKFEDSRVWVEL"
     gene            complement(810660..811706)
                     /locus_tag="CNE_RS21780"
                     /old_locus_tag="CNE_2c07520"
     CDS             complement(810660..811706)
                     /locus_tag="CNE_RS21780"
                     /old_locus_tag="CNE_2c07520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952435.1"
                     /db_xref="GI:503718359"
                     /translation="MASGKRATFAYGLLLAVLLLAPWLGAYPVLVMKLLCFALFACAF
                     NLLLGYTGLVSFGHAAFFGGAAYACGYAMKSLQLTPELGLLAGTAFGALLGLVFGALA
                     IRRQGIYFAMITLALAQMFYFFCLQTPATGGEDGLQAVPRGDLFGVLPLASDHTMYYV
                     VLLITAAAFLGIMRIVNSPFGQILRAIKEDEPRAISLGYDADRFKLLAFVLSSALAGL
                     AGALKTLVLGFATLTDVHWMMSGTVILMTLVGGMGTLSGPLVGALVIVALENKLGDAG
                     NALAAMTGIGWFEALGESVSMVTGLIFVVCVLTFRRGIMGEILARWQARPSLQAGAPA
                     VGPARSGAANPGQG"
     gene            complement(811706..812590)
                     /locus_tag="CNE_RS21785"
                     /old_locus_tag="CNE_2c07530"
     CDS             complement(811706..812590)
                     /locus_tag="CNE_RS21785"
                     /old_locus_tag="CNE_2c07530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013952436.1"
                     /db_xref="GI:503718360"
                     /translation="MELFGVPLPALLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINF
                     AHGALFMLGAVLAWMGLNYLGLNYWLMLVLAPVVAGALGVVLERTMLRHLYRFDHLYG
                     LLLTLGICLLIEGALRSVYGVSGLPYPTPEALSGVSHLGFMVLPNYRAWVVLASLAVC
                     FATWFMIEKTRLGAYLRAGTENPRMVEAFGVNVPLLVTLTYAFGVGLAALAGVLAAPV
                     MQVSPLMGQNLIITVFAVVVIGGMGSILGSIFTGLGLGVFEGITKVYYPEASATVVFV
                     AMVCVLLVRPAGLFGKEK"
     gene            complement(812601..813338)
                     /locus_tag="CNE_RS21790"
                     /old_locus_tag="CNE_2c07540"
     CDS             complement(812601..813338)
                     /locus_tag="CNE_RS21790"
                     /old_locus_tag="CNE_2c07540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_013952437.1"
                     /db_xref="GI:503718361"
                     /translation="MTRTASPALELRGLHAWYGESHILHGVDLTVNPGEVVTLLGRNG
                     AGRTTTLRAIMGLVGMRKGSVCVHGQETIGMKTHRIAPLGLSYCPEERAIFASLSCEE
                     NLLLPPQFACTPGAVGLREPMALGEIYEMFPNLHERRKSQGTRMSGGEQQMLAVARIL
                     RTGASVLLLDEISEGLAPVIVQKLAKMIAMLRSRGYTIVMVEQNFRFAAPLADRFFVM
                     EHGRIVEALGADELERKMPTLSALLGV"
     gene            complement(813335..814141)
                     /locus_tag="CNE_RS21795"
                     /old_locus_tag="CNE_2c07550"
     CDS             complement(813335..814141)
                     /locus_tag="CNE_RS21795"
                     /old_locus_tag="CNE_2c07550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_013952438.1"
                     /db_xref="GI:503718362"
                     /translation="MPDTDVILQTQGLTKAFKGFTAVSDVSLSVRRGSIHALIGPNGA
                     GKTTCFNLLTKFHAPSSGSIHFNGTDITALRPAQIARMGVIRSFQISAVFPQLTVLEN
                     VRIALQRRLGTSWHFWRGKRSLSRLDGRAMELLDAVGLAGFADLGTAELAYGRKRALE
                     LATTLATDPELMLLDEPTQGMGHEDVETVTALIKRVSAGRTVLMVEHNMSVVSSIVDR
                     ITVLQRGAVLAEGTYDEISRNPQVREAYMGTTDEPEDRHAAAAALSAEAS"
     gene            complement(814149..815366)
                     /locus_tag="CNE_RS21800"
                     /old_locus_tag="CNE_2c07560"
     CDS             complement(814149..815366)
                     /locus_tag="CNE_RS21800"
                     /old_locus_tag="CNE_2c07560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041228816.1"
                     /db_xref="GI:752557584"
                     /translation="MTTSRILRTLAASSALLGLAAATPALADTNGVKIGVITDMSGSY
                     ADLSGKGSVLAAQMAVEEFGGKALGKPVTVLSADHQNKADIASSLARRWFDTDGVDMV
                     IDFPNSSTALAVQEVARQKQKIDIVSTGGAMALTNQNCSPTGFHWAWDTYSVSYPLVR
                     RMIEQGRNSWYYITVDYAFGQSLEADFRKAVDAGGGKNVGATRHPLNASDFSSPVVAA
                     SASKAKVVVLANAGNDMINGVKAAGEFGLIKAGQTVITPSTFITDLKSLGLNAAQGLT
                     YVDPFKLDLDGKSKDFVERYYKRHKAYPTHGQIGVYSGVLHYLKAVEAAKTVEGPAVA
                     EKMRALPVNDAFVRNGKVRVDGRMVHDMYLAQAKTPAESKGPWDLVRYIGTIPGDEAF
                     RPLSASECPLVKK"
     gene            complement(815537..817141)
                     /locus_tag="CNE_RS21805"
                     /old_locus_tag="CNE_2c07570"
     CDS             complement(815537..817141)
                     /locus_tag="CNE_RS21805"
                     /old_locus_tag="CNE_2c07570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_013952440.1"
                     /db_xref="GI:503718364"
                     /translation="MTISLTRSETRAPASRMTAEERKVILASSFGALMEWYDFYIYAA
                     LAVYFGALFFPKGNETAAFLASLATFGAGFLIRPVGALLFGRLGDLIGRKYTFLVTIL
                     LMGVATVGVGVLPTYEQIGITATVLLVLLRLLQGLALGGEVGGAVTYVAEHSPVHKRG
                     LYTSSLQTTATLGLLSSLLVVYLLKTFLTEAEFREWGWRIPFIVSLVMLVISVYIRGK
                     LHESPVFARMKAANTTSRAPIRESFTNWKNLRSVLLLFVVAAGLGAIFGTGHFYSMFF
                     LNKTLHVPLETVHKLIGIALVVATPCYLLFGWLSDRIGRKYIMMAACLLAAVCIQPVF
                     KGLTHYANPALEQFQQQGAVQVTAGDCKARLFGEPVSACDKIRGYLTDLGVGYTFVPA
                     SNPAQAEVRIADRTLQGFDRDAIKGALVAAGWPERADLSKINTPMVFVLLLVPILFLA
                     MVYGPMAAFMVELFPARVRYTSLSLPFHLGAGWVGGMLSFVVTAMNVASGDVYFGLWY
                     PVIIAGLAFVIGMLFVPETRGRDLAT"
     gene            817580..818542
                     /locus_tag="CNE_RS21810"
                     /old_locus_tag="CNE_2c07580"
     CDS             817580..818542
                     /locus_tag="CNE_RS21810"
                     /old_locus_tag="CNE_2c07580"
                     /EC_number="3.5.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013952441.1"
                     /db_xref="GI:503718365"
                     /translation="MTKVKKIALEEHFMTPGFQAYSKAFTQHIDPAVFAELGRRLADF
                     DEDRLAEMDRAGIDITVLSQTGPGVQGESDSGLAVARARESNDFLAAQIARHPTRFAG
                     FAALPMHDPEQAARELERAVRELGFKGSLVNGHTHGRYYDDPAYDAFWERMQALDVPM
                     YLHPTDALVQPQVLAGHPELTGAAWGWGVETASHALRLLFGGVFDRFPRLKIILGHMG
                     EGLPYQRWRFDSRFAVYSHGVRLARAPSEYIGTNIVITTSGVCSHGALAGAIAELGAE
                     AVMFSVDYPYESTEVAAKFIEDAPLDDTTRALVCHGNAQRLLKL"
     gene            818564..819316
                     /locus_tag="CNE_RS21815"
                     /old_locus_tag="CNE_2c07590"
     CDS             818564..819316
                     /locus_tag="CNE_RS21815"
                     /old_locus_tag="CNE_2c07590"
                     /EC_number="5.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013955909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu racemase"
                     /protein_id="WP_013952442.1"
                     /db_xref="GI:503718366"
                     /translation="MQKVFRIGQIVPSSNTTMETEIPAMLLARQQLRPERFTFHSSRM
                     RMKKVVKEELAAMDAESDRCAVELSDARVDVLGYACLVAIMAMGHGYHRKSEQRLKAH
                     TIENGGDAPVITSAGALVDALRVIGARRIAVVAPYMKPLTELVVDYIRNEGYEVVDYR
                     ALEIPDNLEVGRHDPARLPGIVSQMNLADVDAIVLSACVQMPSLPAVAKVEAMTGKPV
                     ITAAIATTYAMLKALDLEPVVPGAGALLSGAY"
     gene            819326..820153
                     /locus_tag="CNE_RS21820"
                     /old_locus_tag="CNE_2c07600"
     CDS             819326..820153
                     /locus_tag="CNE_RS21820"
                     /old_locus_tag="CNE_2c07600"
                     /EC_number="3.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013952443.1"
                     /db_xref="GI:503718367"
                     /translation="MTTFLYGGHVHANGIRQHYLRYGGNDGARAARDPVIIVPGITSP
                     AITWGFVGERFGASFDTYVLDVRGRGLSSAEAGLDYSLDAQARDVVAFAEALGLRRYS
                     VVGHSMGARIGVRAAAGRPGGLARLVLVDPPVSGPGRRAYPAQLPWYVDSIRLSRQGT
                     DVEGMRCFCPTWTDEQLRLRAEWLHTCNEDAVMRSFEDFHRDDIHADMPRITVPALLV
                     TAGRGDVVRAEDVAEIRTLLPGVLVSHVAGAGHMIPWDDEAGFYAALGDFLGAPLTQ"
     gene            820170..821225
                     /locus_tag="CNE_RS21825"
                     /old_locus_tag="CNE_2c07610"
     CDS             820170..821225
                     /locus_tag="CNE_RS21825"
                     /old_locus_tag="CNE_2c07610"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010813499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M29 family"
                     /protein_id="WP_013952444.1"
                     /db_xref="GI:503718368"
                     /translation="MPVSDHQMIEAWRKVLKLSRLEPGQTVTILTSAATHPQTLSTAL
                     IATQAMGAIVNRLDLPPVNGEKALSRDALAYLGTTPLTGNRAAIAALRESDLVLDLMT
                     LLFSPEQHDILKGGTKILLAVEPPEVLARLVPCEADRERVKAASERLARAKEMHVVSP
                     AGTDLRCPLGEFPAISEYGFVDEPGRWDHWPSGFALTWPNEGAANGTIVLARGDILLP
                     QKTYVTEPVMLTVEGGFATRIEGGLHAELLSEYMASFNDPQAYAISHIGWGLQPRAHW
                     STLGLYDREATIGMDARAFEGNFLFSLGPNNEAGGSRTTACHIDIPVRNCTVRLDGVD
                     VVTRGKVTDGFRYPEEK"
     gene            821228..821854
                     /locus_tag="CNE_RS21830"
                     /old_locus_tag="CNE_2c07620"
     CDS             821228..821854
                     /locus_tag="CNE_RS21830"
                     /old_locus_tag="CNE_2c07620"
                     /EC_number="3.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylsarcosine amidase"
                     /protein_id="WP_013952445.1"
                     /db_xref="GI:503718369"
                     /translation="MHKEIGAYQRQGFGNDLELAGPFGLLVVDFVNGFADPEVFGGGN
                     IREAIANTVPLLAVARREGWAIAHSRIVFADDGSDHNIFAMKVPNMLSLKERERNSAI
                     VEELAPRAGELVVRKTVPSAFFGTSLAAWLTQRGVRTLVVAGAVTSGCVRASVVDAMQ
                     YGFRPLVLSDCVGDRALGPHEANLFDMGQKYATVASRAEGLAAIGVRE"
     gene            821900..824284
                     /locus_tag="CNE_RS21835"
                     /old_locus_tag="CNE_2c07630"
     CDS             821900..824284
                     /locus_tag="CNE_RS21835"
                     /old_locus_tag="CNE_2c07630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_041228572.1"
                     /db_xref="GI:752557340"
                     /translation="MEPDHSEEGRGQGVGARVARKEDARHLHGKGRFVADIAMPDLQE
                     VAFLRSPVAHARLLSVSKPARHAQAVIVREDMAAARDIVADSAFPSYQPSAQAPLASG
                     KVRFVGEPVAMAFAPTRAEAEDIAEQVVAEFDELPALTDVAQARQLAGEVRVHEHWRD
                     NTFLTLNIDKNFEARQREASVVVHRKVNLARQCMVPMEGKAVLAYWDHQFDQLVVYSA
                     TQVPHMIRTILSHCLDLDQARVRVISPDVGGAFGYKCVLQQEELCIAWLALTYKRPFR
                     FVEDRREHLTAGANSREHHYELTAYADQRGRLLALDAKIAIDGGAYSVWPFTVGLEPG
                     QAIGNLPGPYAFDGYRCETTCVATNKPGFVPYRGVARTGVCFAMELMMDAIAREVGRE
                     PWEVRCENLVPPQAMPYVNVTNKHFDGGDYPASVRQAMEMIDLPAIRARQQAGPQGSR
                     YVGVGFGTYTEQSAHGTSVFAAWGTPVIPGFDSATVRITPDGGLEVRVGVHSHGQGME
                     TTFAQIAHEILGIDIGRIKLVHGDTGLTPFSTGTYASRSLVMSGGAVSRACKALLPRL
                     QKIGAHMLGQPVEAVTLEAGAVRAGDATVIDIGRIADAWYINPHLLPHDVDAQGLEVT
                     MGFKPAVDTGSFTYATHAVAVEVDIDSGHVEILDYVVVEDCGTMINPMVVEGQTYGGV
                     AQGIGTAMFEEMRYDGNGQPLASTLADYMLPGPTEIPSIRIHHFETPSPHTEFGAKGM
                     GEGGAIAPPAAIFNAVNDALRDFGVELQETPLTPRKILEALDAAVAGAQSKKAA"
     gene            824288..825114
                     /locus_tag="CNE_RS21840"
                     /old_locus_tag="CNE_2c07640"
                     /note="carbon monoxide dehydrogenase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            825124..826293
                     /locus_tag="CNE_RS21845"
                     /old_locus_tag="CNE_2c07650"
     CDS             825124..826293
                     /locus_tag="CNE_RS21845"
                     /old_locus_tag="CNE_2c07650"
                     /EC_number="1.2.99.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011616817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_013952448.1"
                     /db_xref="GI:503718372"
                     /translation="MQTIEFNVNGRRVSGACADRTHLGDFLRDTHSLTGTHLGCEHGV
                     CGACTVLLDDKPVRSCITFAAACQGADIVTVEGYQDDAVMADLRAAFNQHHALQCGFC
                     TPGMLATARDIVLRLPDADDATIRHELSGNLCRCTGYMGIVAAIRSVLDARRDAAGVI
                     ARHVAGAAPAEAPFTGFAVADEALGTLPHLAAGTGAEAERSADRKGWSRIEGSFTVPY
                     ALDSVWAFMADLPAVAGCLPGAVLTEIAGEKVKGHIAIKFGPMSARFDGAARLQRDDA
                     LKRGVLKGAGQDSLSNSKAAGDIAYQLKALSAHETEVAVDLQYSLQGPLAQFSRSGLV
                     RDFVRRMIADFGKSVARRMDPTLSDAERNQAVRLNPVAMFFGVLWERVKRWFGAR"
     gene            complement(826329..826925)
                     /locus_tag="CNE_RS21850"
                     /old_locus_tag="CNE_2c07660"
     CDS             complement(826329..826925)
                     /locus_tag="CNE_RS21850"
                     /old_locus_tag="CNE_2c07660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013952449.1"
                     /db_xref="GI:503718373"
                     /translation="MTQALAQMPQADGPPAVGMALQALRQQQRLSLDELSRRAGVSKS
                     MLSQIERNLANPTVAVLWRLANALGVSLTDFLAGGAAERPGGGITVIQPHATPSLKSP
                     DTRCDLRILGPIDLAGRFEWYELTIQAGGVLASEPHEAGTQEHLSVLSGSMTVRAGVD
                     EKKLRHGETARYAADVAHAISNGGKTTATALLVVVHPG"
     gene            827030..828229
                     /locus_tag="CNE_RS21855"
                     /old_locus_tag="CNE_2c07670"
     CDS             827030..828229
                     /locus_tag="CNE_RS21855"
                     /old_locus_tag="CNE_2c07670"
                     /EC_number="2.3.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018311760.1"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="WP_013952450.1"
                     /db_xref="GI:503718374"
                     /translation="MSNAEAFYASIRTELESIRAAGLFKNERVIATPQGARVRTTDGR
                     EVINLCANNYLGLSSHPQVIEAAHEALRTHGFGLSSVRFICGTQDLHKTLEARLSAFL
                     GTEDTILYGSAFDANGGLFETLLGAEDAVISDALNHASIIDGIRLSKARRYRYQHNDM
                     DDLRVQLEQARADGARYTLVFSDGVFSMDGTVARLDQMRTICDEYDALLGIDECHATG
                     FMGQRGRGTHEARGVFGKIDIITGTLGKALGGASGGFTSARKEVVALLRQRSRPYLFS
                     NTVAPAIVGASIAVLDILEASTELRDRLEGNTRFFRAGLDQLGFDVKAGDHPIIPIMV
                     YDADKAQQLAQRLLELGVYVVGFFYPVVPKGQARIRVQMSALHDEAALQEALEAFGQA
                     GRELGLI"
     gene            828229..829185
                     /locus_tag="CNE_RS21860"
                     /old_locus_tag="CNE_2c07680"
     CDS             828229..829185
                     /locus_tag="CNE_RS21860"
                     /old_locus_tag="CNE_2c07680"
                     /EC_number="5.3.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_013952451.1"
                     /db_xref="GI:503718375"
                     /translation="MEDGKPKILIVGANGQIGSELALALAERYGRTNVITSDVVPTGR
                     HVHLTHEMLNATDRGELATVVERHGITQVYLLAAALSATGEKAPQWAWNLNMTSLLNV
                     LELARQTGLERVFWPSSIAAFGPTTPAGQTPQKTVMEPTTVYGISKQAGEGWCRWYHA
                     NHGVDVRSVRYPGLISHKTPPGGGTTDYAVDIFHAAVKGEPYTCFLKEDEALPMMYMP
                     DAIRATIELMEAPADKLGERGSYNIAGMSFTPAQIAAAIREQVPGFQIRYEPDYRQAI
                     AQGWPDSIDDSVARADWGWKAEYGLKEMVADMLANLKVTLPA"
     gene            complement(829190..830395)
                     /locus_tag="CNE_RS21865"
                     /old_locus_tag="CNE_2c07690"
     CDS             complement(829190..830395)
                     /locus_tag="CNE_RS21865"
                     /old_locus_tag="CNE_2c07690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CycH"
                     /protein_id="WP_013952452.1"
                     /db_xref="GI:503718376"
                     /translation="MTTFWLLAAALIAATTACLLWPLLRRRAVPDPGTPERNLLVDLY
                     HDQLRELDTDLRGGTLTAARHAEARDELGRRLLDDAAGAATGTGRAGTSPLLAALLLA
                     VLPSAAILLYLHLGNPVALWRADDLPESTGNQHQLSGAQVEGMVNQLAQRLRESPGDA
                     QGWAMLARSYSVMERHADAAAAYARAVELAPDVAALRSDYADVLASLNGGSLEGPPMA
                     QVRQALALDPDDPKALALAASAAAERGDKQAAIGYWEHLYRLLPADSQTAARIAANLA
                     AARGTAAAAQTPKITGMVTLSEKAGRTPQPGDTLFVYALPADGSRMPLAVLRRQARDL
                     PLSFTLEDAMAMRPDHRLSGQQQVMLEARISASGSALPKAGDLVGRTGPVAVGTEGIR
                     IAIDGTIAP"
     gene            complement(830392..830862)
                     /locus_tag="CNE_RS21870"
                     /old_locus_tag="CNE_2c07700"
     CDS             complement(830392..830862)
                     /locus_tag="CNE_RS21870"
                     /old_locus_tag="CNE_2c07700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_013952453.1"
                     /db_xref="GI:503718377"
                     /translation="MRSRIRTMLAVWLCCVSLQATALTEAELDARVHALSNELRCLVC
                     QNQTLADSNADLAVDLRRQIRAQLRGGASDEAVKDYLVQRYGDFVLYKPPLRPLTWLL
                     WFGPLLLVAGVAAAIVRARSRNRQADATLDASAQRQLADLLDESATTSVEHRQP"
     gene            complement(830855..831397)
                     /locus_tag="CNE_RS21875"
                     /old_locus_tag="CNE_2c07710"
     CDS             complement(830855..831397)
                     /locus_tag="CNE_RS21875"
                     /old_locus_tag="CNE_2c07710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_013952454.1"
                     /db_xref="GI:503718378"
                     /translation="MTRFLLPLAAFLALAVALAAGLRHDPRELPSPLVGKAAPAFRLP
                     LLEPEGRTLASADMRGKVWLLNVWASWCAACRTEHPLLVDFAARSPVPLYGLNYKDET
                     GAARDWLQRLGNPYAASLVDADGRVGIDYGVYGVPETFVIDQHGVVRYRQVGPVTREV
                     LERKLIPLIEQLERQGGSHA"
     gene            complement(831394..833412)
                     /locus_tag="CNE_RS21880"
                     /old_locus_tag="CNE_2c07730"
     CDS             complement(831394..833412)
                     /locus_tag="CNE_RS21880"
                     /old_locus_tag="CNE_2c07730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme lyase subunit CcmF"
                     /protein_id="WP_013952455.1"
                     /db_xref="GI:503718379"
                     /translation="MIAELGHFALIVALLVALVQAVVPLAGAARGQLAWMALARPAAR
                     VQCLLVALSFAALTWSFVSNDFSVRYVAANANSALPLAYRIAAVWGGHEGSMLLWTLM
                     LGLWSLAVSACSRQLPLAAVARVLAVMGAISAGFLAFLLFASNPFVRLLPPAMEGRDL
                     NPLLQDPGMVFHPPLLYMGYVGFSVTFAFAVAALLAGRVDAAWARWSRPWTTVAWAFL
                     TLGIMLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALMHSLAVTEKRGALRAWTV
                     LLAIFTFSLSLLGTFLVRSGVLTSVHAFAVDPKRGIFILALLGLVTGLALALYAWRAP
                     RLARRVAFAAVSRESMLLANNVLLAVAAATVLLGTLYPLLVDVLGLGKISVGPAYFEQ
                     VFVPLMAPAGALMGAAPLARWRHGSLPDMARRLRWGAVASAAIGLGLLLVLRNASALS
                     GLGLLLAAWCVLSAVTSLAARLRQQQGRRLAALRQFTPSYWGMLLAHAGVGVFIAGVT
                     LVSGQESLRELPMRAGESVSVGGYDFRFAGVTQGGGPNYDALRGTLVAARDGKRVALL
                     HPERRIYRSQDMPTTEAAIDSGVARDLYVALGENVDGSAWAVRIHVKPFVDWIWAGCV
                     LMALGGLLAVCDKRYRLRRRAANPATAPAAPDVPAVPALASAHEETPA"
     gene            complement(833409..833882)
                     /locus_tag="CNE_RS21885"
                     /old_locus_tag="CNE_2c07740"
     CDS             complement(833409..833882)
                     /locus_tag="CNE_RS21885"
                     /old_locus_tag="CNE_2c07740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmE"
                     /protein_id="WP_013952456.1"
                     /db_xref="GI:503718380"
                     /translation="MTPRQRRFGLLAAALACCGIAAALVLNAFRSNLVFFFSPSQVAA
                     QEAPVARSFRLGGLVAPGSIRREGDGMTVRFVVTDTARQVPVRYRGLLPDLFREGKGV
                     VARGQLQADGTFIASEVLAKHDENYMPPEAADALKQAAQVNRRMAEAAPAQGVRQ"
     gene            complement(834019..834810)
                     /locus_tag="CNE_RS21890"
                     /old_locus_tag="CNE_2c07760"
     CDS             complement(834019..834810)
                     /locus_tag="CNE_RS21890"
                     /old_locus_tag="CNE_2c07760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter permease"
                     /protein_id="WP_013952458.1"
                     /db_xref="GI:503718382"
                     /translation="MSQPLPSVHPAAAPRPPVRGGWLAYAAPVRFYPLAGRMASWFFA
                     AAALFALAGLWLGFGVAPTDAQQGEVYRIIFIHVPAAWMSMFIYLVMAGYCALALVLR
                     TRLSSMMASALAPTGALFTALALWTGALWGQPTWGTWWVWDARLTSELILLFLYLGFI
                     ALEAAIDEPRRAERACAVLALVGVVNIPVIYFSVQWWNTLHQGASVSLTAAPSMAATM
                     LAGMLLMTMACWMYTVAVALVRVRCILRERGEVPHGPAMVPGETS"
     gene            complement(834807..835484)
                     /locus_tag="CNE_RS21895"
                     /old_locus_tag="CNE_2c07770"
     CDS             complement(834807..835484)
                     /locus_tag="CNE_RS21895"
                     /old_locus_tag="CNE_2c07770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter permease"
                     /protein_id="WP_013952459.1"
                     /db_xref="GI:503718383"
                     /translation="MMRMLAAIVAHDVSLSWRRRGSLLGGVVFFVIAASLFPLAIGPE
                     PQQLRALAPGILWVTALLASMLSLSRLFAQEHADGSLDQLLLSPHPLALLVLAKIAAH
                     WLTSGLPLLLLTPLLAQQYGLPLGASLLLAASLLVGTPALSLIGAVGAALTLGVRGGA
                     VLLCILVLPLCVPVLVFGASAAAAADAGLDVMPQFSLLGACLALSLFLCPLATAAGLR
                     IAMETPA"
     gene            complement(835481..836095)
                     /locus_tag="CNE_RS21900"
                     /old_locus_tag="CNE_2c07780"
     CDS             complement(835481..836095)
                     /locus_tag="CNE_RS21900"
                     /old_locus_tag="CNE_2c07780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmA"
                     /protein_id="WP_041228573.1"
                     /db_xref="GI:752557341"
                     /translation="MLSASGLAISRAGRPVLRGIDLDLAPGGLLQVLGPNGSGKTSLL
                     RVLCGLAMADAGTLHWRGRPVRAADPDYQLALAYVGHTNGIDPDLSPAENLRFAARLA
                     GSDDSADGVARALAAQGLERLANAPVRTLSQGQRRRVALARLSLAQRALWLLDEPVTA
                     LDADACARFDAQLGTHLAAGGMAVIATHQLLPAGGAVLQLGAPA"
     gene            complement(836165..836752)
                     /locus_tag="CNE_RS21905"
                     /old_locus_tag="CNE_2c07790"
     CDS             complement(836165..836752)
                     /locus_tag="CNE_RS21905"
                     /old_locus_tag="CNE_2c07790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_041228817.1"
                     /db_xref="GI:752557585"
                     /translation="MLDLIKRYWRTINRPSAYFSLGFLTLGGFVAGVVFWGAFNTALE
                     LTNTEQFCTGCHEMRDNVYQELQGTIHFTNRSGVRAKCSDCHVPHNWTTKMARKMQAS
                     KEVWAKIFGTVDTREKFQAHRLTLAQHEWARFKANDSLECRNCHDYQSMDFTRQSPRA
                     QAMHSTHLANKEKTCIDCHKGIAHHLPDISKAEEK"
     gene            complement(836765..837253)
                     /locus_tag="CNE_RS21910"
                     /old_locus_tag="CNE_2c07800"
     CDS             complement(836765..837253)
                     /locus_tag="CNE_RS21910"
                     /old_locus_tag="CNE_2c07800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013952462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_013952462.1"
                     /db_xref="GI:503718386"
                     /translation="MKPSRSWKPLLALCALLLAVLAMPAHAQGLVDAMRGPTPIASET
                     KAPIMYPTENKDIRRTRNYTMQPPTIPHKIDGYQVDKDFNRCMFCHARTRTEETQAIP
                     VSITHYMDRDNNVLADVSPRRYFCTQCHVPQADAKPLVGNTFVDVEQMLKRKPGVKGS
                     SN"
     gene