GenomeNet

Database: RefSeq
Entry: NC_015723
LinkDB: NC_015723
Original site: NC_015723 
LOCUS       NC_015723            2684606 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Cupriavidus necator N-1 chromosome 2, complete sequence.
ACCESSION   NC_015723
VERSION     NC_015723.1  GI:339321330
DBLINK      Project: 68689
            BioProject: PRJNA68689
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 2684606)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of the type strain Cupriavidus necator N-1
  JOURNAL   J. Bacteriol. 193 (18), 5017 (2011)
   PUBMED   21742890
REFERENCE   2  (bases 1 to 2684606)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2684606)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002878.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2684606
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /chromosome="2"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1195
                     /gene="repA"
                     /locus_tag="CNE_2c00010"
                     /db_xref="GeneID:10922070"
     CDS             101..1195
                     /gene="repA"
                     /locus_tag="CNE_2c00010"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepA"
                     /protein_id="YP_004680225.1"
                     /db_xref="GI:339321331"
                     /db_xref="GeneID:10922070"
                     /translation="MPIKRSPATTGDRRVLDLDAEPSRIIVPGNENNLVPSEKFQRLF
                     DEAQAMEREDAWQSGEVGFLSRASVQVTLPYRAPKGAPPVWTRTSGNISLMIQPGYFT
                     QQRSERAANGRQKLVSETVSLGYPYGSYPRLMLAWIGKEIMAKKKRGEFTGTVEDRRI
                     SLGNSLSEFMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSTPSQNQNPNH
                     EPLSIDRVGYLLADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALK
                     ALKQSPFALDVYSWLTYRFFTIQRRTEIPWEALQMQFGTETESERKFRALFRKALKDV
                     LVVYPGAKVDADSSKALILQPSRTSVRKLG"
     misc_feature    476..1024
                     /gene="repA"
                     /locus_tag="CNE_2c00010"
                     /note="Plasmid encoded RepA protein; Region: RepA_C;
                     pfam04796"
                     /db_xref="CDD:252808"
     gene            complement(1374..1577)
                     /locus_tag="CNE_2c00020"
                     /db_xref="GeneID:10920492"
     CDS             complement(1374..1577)
                     /locus_tag="CNE_2c00020"
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock DNA-binding protein family"
                     /protein_id="YP_004680226.1"
                     /db_xref="GI:339321332"
                     /db_xref="GeneID:10920492"
                     /translation="MATGTVKWFNETKGFGFITPDDGGADLFAHFSEIQGSGFKTLKD
                     GQRVTFEVKQGPKGLQASAIKPA"
     misc_feature    complement(1380..1571)
                     /locus_tag="CNE_2c00020"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(1407..1409,1494..1496,1527..1529,
                     1554..1556))
                     /locus_tag="CNE_2c00020"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(1488..1499,1518..1538))
                     /locus_tag="CNE_2c00020"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            1955..2614
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /db_xref="GeneID:10920493"
     CDS             1955..2614
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partition protein ParA"
                     /protein_id="YP_004680227.1"
                     /db_xref="GI:339321333"
                     /db_xref="GeneID:10920493"
                     /translation="MPAKIITVFNQKGGCGKTTVSMHLAGTLGLRGARSMLVDMDEQG
                     TATRWAAQASDERPFPASVIGLAPSGGAMHREVRKFVQDYDYIVVDCPPAVHSAAPSS
                     ALLISDLAIIPVVPSPPDLWAAVAAKTLAQHAQVQNESLLIRVMANMVQRRVSIARQA
                     IEILGDDGDVPLLNSMIGSRSAFRECQAIGCTVHGVAGAREAVQEVDMMVDEILSLIE
                     H"
     misc_feature    1964..2611
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /note="VirC1 protein; Region: VirC1; cl17401"
                     /db_xref="CDD:247955"
     misc_feature    1964..2596
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    1967..2398
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    1988..2008
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(2006..2008,2222..2224)
                     /gene="parA"
                     /locus_tag="CNE_2c00030"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            2617..3630
                     /gene="parB"
                     /locus_tag="CNE_2c00040"
                     /db_xref="GeneID:10920494"
     CDS             2617..3630
                     /gene="parB"
                     /locus_tag="CNE_2c00040"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="YP_004680228.1"
                     /db_xref="GI:339321334"
                     /db_xref="GeneID:10920494"
                     /translation="MATKLKSLKAGMLAGMAAEKNRNETLDRFARAEAAISQHPNGLL
                     QGRGADGTPVFSAESLGEAAKGRQLIRIPLAQLHDNPLNARRLYDPAVVQERAASIAT
                     HGQKTPGLAAPDPARSGHYILIDGHYRKRALASAGKLEMECFVEDDLSDLDFYRLSFM
                     LNEQRSDQSALDNAIAWRQLLDEGKVQKEEEICELTGISAGTVNKTLALLRLPESVLG
                     VMRERPSAIGIAAGYELTLYCKLAGEERTRDLAARIINDGLSSREVEAIRKHAQEGKA
                     RKVKEISRQYKIRTDSGQLLGTIKEWDSGRVMLDVQLSDRSAREALVEALKARFGLDK
                     TLL"
     misc_feature    2812..3381
                     /gene="parB"
                     /locus_tag="CNE_2c00040"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    2830..3081
                     /gene="parB"
                     /locus_tag="CNE_2c00040"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     gene            complement(3682..5271)
                     /locus_tag="CNE_2c00050"
                     /db_xref="GeneID:10920495"
     CDS             complement(3682..5271)
                     /locus_tag="CNE_2c00050"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase XerD family"
                     /protein_id="YP_004680229.1"
                     /db_xref="GI:339321335"
                     /db_xref="GeneID:10920495"
                     /translation="MPMIPGMMTVSLTRSEFAAVRAYVQGMPAAMVVPRYLADETDDD
                     EDGAESSLRILLALRDRMVQLAHLHGRGDLAELLLAGPGRSNRGMDRRVDALAELERL
                     GTAAPRPQHGVELWFAPALARRLRKAEIVTLNTLLALANQRGGAWWRAVPRIGALAGA
                     AVNRWLSENRAAFRDPDGKPLLGAHIGNRTLVEQGGLGPGMRQPLPLEWMTASPALDL
                     DASCPYSQGLDVVQAWLRDAAGDSGSTFSAYRKEAERLLLWAALERRKGLSQLDLDDR
                     RAYLGFLAQPEPASRWCGPRAPRHLAAWRPFTGPLSPASVRHSMRVLAALFRWMHANG
                     YPGAALWPAQVSDGTEAMAATAAARPDATQVPAASLAPFLSWLERRGGDGDGQRYRTA
                     HAAILLLREHRLSLDRLTSVTRRSLAPKQPPVRSREDGMGSAAPDGTPGFGPATQHAL
                     ARHWRDRNLQWDGAGTEDASLIAPPAAPPTRRAQRKLAALPQAGYSVRGLHALLSSML
                     ERYRKTCDPEFGARSPRDLLA"
     misc_feature    complement(4738..4983)
                     /locus_tag="CNE_2c00050"
                     /note="Phage integrase protein; Region: DUF3701;
                     pfam12482"
                     /db_xref="CDD:193047"
     gene            5765..6622
                     /locus_tag="CNE_2c00060"
                     /db_xref="GeneID:10920496"
     CDS             5765..6622
                     /locus_tag="CNE_2c00060"
                     /codon_start=1
                     /transl_table=11
                     /product="NarL family response regulator"
                     /protein_id="YP_004680230.1"
                     /db_xref="GI:339321336"
                     /db_xref="GeneID:10920496"
                     /translation="MATILLIEPHPLLRLGLRHLLAQAHIPGDLIDIDPLAPVDSDLW
                     LYDADLLIYGLPADHAGGWTMLEDLCQRLRPQRVLVLSDQAAPSLPDAGLPDPVRGCV
                     AKSCSADALDAAVRLVLAGGECFPARAQGSHAWQPELEAGHAPVAGSAGQGEARVVAL
                     RAGIGEAVLDHAVPAPQRHFQAHATYHETPSAGAHLLNITERQYEVLALLARGYPIKT
                     VSRMLNISVATAKTHACTLYQRLHVRNKGEAVYVALQKGATLNWAGPATPANPVTRVP
                     APDHTCQAA"
     misc_feature    5891..6535
                     /locus_tag="CNE_2c00060"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    6362..6529
                     /locus_tag="CNE_2c00060"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(6362..6370,6407..6415,6437..6442,6446..6451,
                     6455..6469,6500..6502)
                     /locus_tag="CNE_2c00060"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(6395..6397,6401..6403,6407..6409,6500..6508,
                     6515..6517,6524..6529)
                     /locus_tag="CNE_2c00060"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            6906..7364
                     /locus_tag="CNE_2c00070"
                     /db_xref="GeneID:10920497"
     CDS             6906..7364
                     /locus_tag="CNE_2c00070"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator-like protein"
                     /protein_id="YP_004680231.1"
                     /db_xref="GI:339321337"
                     /db_xref="GeneID:10920497"
                     /translation="MPTYLIASNEMMCRVLARRLNALDVPQPITWRTPQWLHESMSAS
                     TQASSSEPSPDPADIALIDCSALEGDPRALLDQLQARLAPRRWLVLSDRLDATLMLHA
                     ALLGASGCLLLPAPLELVCAATALVWAGGQCFPRMALSLTGANGTTASLL"
     misc_feature    <7071..>7310
                     /locus_tag="CNE_2c00070"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            7488..7802
                     /locus_tag="CNE_2c00080"
                     /db_xref="GeneID:10920498"
     CDS             7488..7802
                     /locus_tag="CNE_2c00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680232.1"
                     /db_xref="GI:339321338"
                     /db_xref="GeneID:10920498"
                     /translation="MEAGLEFLVVRGFAVREGRGKWACCFEIRLAASLDDGCHAGANE
                     GSDEPLLYRGELHGRQFDCELAAADAARAAGEREARLRVESLRALIIAQHRHRVPPPL
                     VA"
     gene            8467..9432
                     /locus_tag="CNE_2c00090"
                     /db_xref="GeneID:10920499"
     CDS             8467..9432
                     /locus_tag="CNE_2c00090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680233.1"
                     /db_xref="GI:339321339"
                     /db_xref="GeneID:10920499"
                     /translation="MRGRGGPGLRGGNPVWSHVNCHIDLWIELLHGLDLPPVAALACA
                     VRQDFEADHFTQCRFPDADLERLYGLTVHALAFYDSLESHVAAQTSRGHIVVMELDSS
                     QLPPPRGAGYLRHCTPTCIAIDVLIPEAGAVGYYHSDGYHTATGEDYAAIIRLAPGVR
                     SAEALPFMHADVVRRNGHPHAAETLLEASLALLRFHLSNRPRENPVTLFRAVFPQHLE
                     RLMARGEPGFHHYASGVLRQLGANFELLARYLRWLVMHGQEVPEKAAQACYTMASEAM
                     VMQFRLMRAVISRKPDPCEDCLDQLEASYLASVPLLAAHFGEFTP"
     misc_feature    8503..9411
                     /locus_tag="CNE_2c00090"
                     /note="Domain of unknown function (DUF1839); Region:
                     DUF1839; pfam08893"
                     /db_xref="CDD:255093"
     gene            9943..10665
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /db_xref="GeneID:10920500"
     CDS             9943..10665
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004680234.1"
                     /db_xref="GI:339321340"
                     /db_xref="GeneID:10920500"
                     /translation="MITHRSDLHVNHLLSALPRGEWETLAQHFELVRLRAGELLTDSG
                     QRIVHVYFPTTAVVSLLSLLEDGATVEIAAVGNEGLVGIPVVTGGDTMPSRVEVRSPG
                     MAYRIPARLLRGELPRLPTLQRVTLLYVQAMLTQIAQTAACNRHHSLNKQLCRWLLLA
                     IDRLSSNELVITQQVIANMLGVRREGVTEAAGKLEDLGLIHHSRGHITVLDRCGLEKH
                     SCECYKLVKREYDRLLPALASA"
     misc_feature    9964..10578
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    9979..10314
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(10186..10191,10216..10224)
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(10282..10290,10300..10308)
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    10375..10380
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    10396..10593
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    order(10450..10452,10456..10464,10489..10491)
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    10489..10509
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    order(10492..10497,10507..10509)
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    10492..10497
                     /gene="crp"
                     /locus_tag="CNE_2c00100"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            10744..13179
                     /gene="epsB1"
                     /locus_tag="CNE_2c00110"
                     /db_xref="GeneID:10920501"
     CDS             10744..13179
                     /gene="epsB1"
                     /locus_tag="CNE_2c00110"
                     /EC_number="2.7.10.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein kinase EpsB"
                     /protein_id="YP_004680235.1"
                     /db_xref="GI:339321341"
                     /db_xref="GeneID:10920501"
                     /translation="MSRLSYAGGPAESATPRRDAQPGVTQARALMDHLGWIAAAGVAG
                     AAAGLLVALSAPPQYRAQALVQVEGRDGGMRSVAQMQGPAAFDAGLLKSRAVVGPVVE
                     RLRLDITAQPLRAPLVGALVQRFSTPGQPRGTWPASLGYAWGGERLVIASMTVPEALV
                     DQQLTLEVRGEGRYRLSQQDTVLLEGQAGETAMANGIVLRVDKIEAGPGTRFQLTRHD
                     LARTAESVRRGLTVESERSETVASLGGAADPLTAPGGTVRVSWEYPDRQLAAQLVNGV
                     TRAYIDGQTDKRRQDAAGTLAFLSGELPRVQSELTRAEEALTRYRARTGSLQPSRDAQ
                     SFLSNSMEYQRQIAALRLERTRLLQRFTPEANEVRTVDSQIQQMTRERAEIDARMQTL
                     SASERESVALTRDVKVAEDMYMSLRSKVEQLSLMLSDSSTQMRVVDAAIAPVTPVGLG
                     AWPFASAGALLGLCLGVAAVNLRQRMRPSVASAADAEERLGMAMLGDIAFSNEQTELE
                     RLVDAKRRLGIASGFVLPPNVRLGWPDSVTSVIDAATAAAPEDERARAERLLRQGLHD
                     QFLLARRAPHSLAVEGLRTLRAALHFALRDAPNCVVAVTSPAAAAGKTFAAVNLAVLF
                     AEAGQRVLLVDADLRRGRVADWFDLPAEPGLAEVLAGRSAIADAVKPSVVNGLFLLSR
                     GAVPANPSELLMLPALAESLRLCAGRFDLVLVDTPPVMAVADATLVANLAGSTLVVVR
                     ADVTATAQVDETLKRLAHANARLAGGILNGVMPRRSNRADFNTINPYLGMPLPPPQLR
                     HPALAKSEAPGQS"
     misc_feature    10906..13086
                     /gene="epsB1"
                     /locus_tag="CNE_2c00110"
                     /note="tyrosine kinase; Provisional; Region: PRK11519"
                     /db_xref="CDD:183173"
     misc_feature    11926..12165
                     /gene="epsB1"
                     /locus_tag="CNE_2c00110"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     misc_feature    12544..12978
                     /gene="epsB1"
                     /locus_tag="CNE_2c00110"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(13300..14919)
                     /locus_tag="CNE_2c00120"
                     /db_xref="GeneID:10920502"
     CDS             complement(13300..14919)
                     /locus_tag="CNE_2c00120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680236.1"
                     /db_xref="GI:339321342"
                     /db_xref="GeneID:10920502"
                     /translation="MSAPHKRKKSKRLWPSVSAVACSSFLLLPSYAQAGSRATSGSAN
                     ETRQGSGNPSGAGAADAAATKPSGRADPCPLLSAEKQAYPGATVRSITSYGARGDGVT
                     DEYLAFQMMAADISNQRFTRRQIVYFPKGTYYIDRYAVTRGPWTNHNQNIRLLKASNF
                     SLIGCTGSVVSFKGNFTITNDHFSGRSWYSARHQLGFEIRNASNFRISGLELNGNVDK
                     LSRPPSANGKPLSETPSFGIQTHASSNYELSHLKIHHFACDGLFIGGDFTADLNGTIH
                     AVDSYNNARQGMSIMQARSFRITNSSFRNTGLTDGAYPTHAPAAGVDIEPDGTPADGV
                     TARTGDMVFDACRFVNNKGSQFVGGDNGRNTENVTIRNSEFVGRAGNKHPYVIILSAP
                     GAVIENNQIDTIDGGVYPSFSEGIGDMKAVNTIVRGNTIRSSGVGLQAADAGASVVIE
                     NNTFISTHGPDYRDDFPNIRAGVASFSGNKLSYPHKNFGSRSVVGIIKAATFMNNSIT
                     TDLSGGNYTIKVGAGADAANNVVGAHILLAP"
     misc_feature    complement(<13981..14655)
                     /locus_tag="CNE_2c00120"
                     /note="Pectate lyase superfamily protein; Region:
                     Pectate_lyase_3; cl19188"
                     /db_xref="CDD:267541"
     misc_feature    complement(13558..14106)
                     /locus_tag="CNE_2c00120"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     gene            complement(15094..17325)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /db_xref="GeneID:10920503"
     CDS             complement(15094..17325)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /EC_number="2.7.10.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein kinase EpsB"
                     /protein_id="YP_004680237.1"
                     /db_xref="GI:339321343"
                     /db_xref="GeneID:10920503"
                     /translation="MRTITNRDDAIEEAADQDKSVDLTAYLDILVRYRWTFCGVAIFV
                     VTLGLLYAMVASPVYRTDIVVQVEESNGGGASKLATSISPVLDIKPAATAEMELLRSR
                     MVVGKAVASLHLDVEAQPRYFPLIGQTIAHFKRELSNPGLFGWGGYAWGSESIAVKEL
                     EVPESMEDRRIDLTATGNGGYSVSFNGGDARASGKVGAPLSIATPAGAVRLLVSQLDA
                     RPGARFELRRLPRSTAIARLQGKLVITERGRQSGVIGISLEGDDPAMVAATLNEIGNA
                     YVEQNVLRKAAEAEKSLAFLEQQMPQLKQQVETSENRYNAMRNQRGTVDLPEESKLML
                     NQSVQLQTKLQELRQKRQELDARFMPNHPVISLIDAQIASVNAQINGLAGRIQKLPDV
                     EQNVLRLMRDVKVSTEMLQSLLNDVQQLRLMKASKVGNSRLVDAAEVPLGPIRPNREV
                     IATLAVVLGLIAGLAAVVLRHAFNGGVADADEIERRTGLVVYTTIPFAPQEAQTRDAA
                     SGGGLLVREQPDDPAVETLRSFRTALQFALAGNKNRTVVITGPAPGVGKSFICANFSA
                     IAASGRRVLLIDADLRRGSLHRRFGAQRTPGLTELLLGAPFEQVVQREVAPGLDFIST
                     GSEPPHAADVLLSPAMENLLDTLTKRYDLVLIDTPPILAATDAGILAGKAAAVFLVAL
                     AEKTTVNELQASYRALKQSGADVKGVLLNGLRIEGRWYRAHYYFGKYRYLGEYSAKPP
                     KRA"
     misc_feature    complement(15112..17286)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /note="tyrosine kinase; Provisional; Region: PRK11519"
                     /db_xref="CDD:183173"
     misc_feature    complement(<16981..17265)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    complement(15910..16155)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     misc_feature    complement(15316..15696)
                     /gene="epsB2"
                     /locus_tag="CNE_2c00130"
                     /note="AAA domain; Region: AAA_31; pfam13614"
                     /db_xref="CDD:257927"
     gene            complement(17322..17795)
                     /gene="epsP1"
                     /locus_tag="CNE_2c00140"
                     /db_xref="GeneID:10920504"
     CDS             complement(17322..17795)
                     /gene="epsP1"
                     /locus_tag="CNE_2c00140"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight
                     protein-tyrosine-phosphatase EpsP"
                     /protein_id="YP_004680238.1"
                     /db_xref="GI:339321344"
                     /db_xref="GeneID:10920504"
                     /translation="MPRTILVVCLGNICRSPMAAVLLNRALPGFDVTSAGLAPPVGAA
                     ADPRAVRLLAHEGCDLAGHRARAVDSVLVESADLVLVMESLQREALEQRFPQSRGKTF
                     RLCEGMDLDVPDPYGSSQQMFSIVLEMIKQGILSWSSQLEQEHAIASIDSHREAT"
     misc_feature    complement(17385..17786)
                     /gene="epsP1"
                     /locus_tag="CNE_2c00140"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    complement(order(17748..17756,17760..17765,17769..17771))
                     /gene="epsP1"
                     /locus_tag="CNE_2c00140"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(17807..18973)
                     /gene="epsA1"
                     /locus_tag="CNE_2c00150"
                     /db_xref="GeneID:10920505"
     CDS             complement(17807..18973)
                     /gene="epsA1"
                     /locus_tag="CNE_2c00150"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide export outer membrane protein
                     EpsA"
                     /protein_id="YP_004680239.1"
                     /db_xref="GI:339321345"
                     /db_xref="GeneID:10920505"
                     /translation="MRSIYSCAIQRSNQPRRRGPAASLLPLLASALLTACAASPGMVF
                     DSNAPVKAVGPNATTTVTPITLDLVRQLRHKIKPANERVEELYAPAQPYRIGPGDIIS
                     VVVWDHPELVFPTQTYSPGASFEIPASTGGSNLPGYVVSAQGDIQFPYAGSLKVAGKT
                     ANQVRDETARILSRVVRNPQMTVRVLGFRSQRVYVDGEVRTPGMLAIDDAPMTLVEAL
                     NRAGGVLNLTGDNSRIRVTRGERSWYVNIPALLARGTDPARIMLRSGDIVRVEQREDN
                     KIFVTGEVGKPTSLLMRNGRMTLNEALGDAGGVNPGTANAEQIFVIRKAPNGEPSVFH
                     LDGTSPAALAIAEGFELEPKDVVYVDARDLVRWSRVMSLLLPSTSLIGTAAGIK"
     misc_feature    complement(18416..18712)
                     /gene="epsA1"
                     /locus_tag="CNE_2c00150"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     misc_feature    complement(17897..18697)
                     /gene="epsA1"
                     /locus_tag="CNE_2c00150"
                     /note="polysaccharide export protein EpsE; Region: EpsE;
                     TIGR03028"
                     /db_xref="CDD:132073"
     misc_feature    complement(<17996..18145)
                     /gene="epsA1"
                     /locus_tag="CNE_2c00150"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     gene            19625..20878
                     /gene="rfbX"
                     /locus_tag="CNE_2c00160"
                     /db_xref="GeneID:10920506"
     CDS             19625..20878
                     /gene="rfbX"
                     /locus_tag="CNE_2c00160"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein involved in the export of
                     O-antigen"
                     /protein_id="YP_004680240.1"
                     /db_xref="GI:339321346"
                     /db_xref="GeneID:10920506"
                     /translation="MQMQIARNVFWLVFERGLQVVFGIVSVAMIARAVGPEGFAEFQY
                     AQSLVLIASAVALICGNEVVIPRLVADQAPAAQHRLLAHVFGLREIAAVVGYLLLVVV
                     VAMTEDDEVIVVIVFITGIPMLFREPFGAVRTWLQARTDSRPAVIFSMVGLAFRMIAV
                     SGLYLAGTDSAPVFAWVVAVESLLFAVLHARYYRKRSPRVAVELDWSLARKLLRDGTV
                     FWASMILMLCAKRIDQLLLKPHISLFELGGYAASMQVLDNFMMLSAIVASSVAPLMIY
                     AQPTLTLVRRNVLYVVAGMVFMGVAGGAVLAYCAPWIIALIYGDHYDAAASLLRLSAM
                     ASGLVFADAALSLLVIYLRKPNWLVEKWLLVLGTMILVDLIAIPIHGARGAVYGYIAG
                     NLVAVIAGIGFFIRSREPVAMEQAV"
     misc_feature    19625..20842
                     /gene="rfbX"
                     /locus_tag="CNE_2c00160"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    19637..20818
                     /gene="rfbX"
                     /locus_tag="CNE_2c00160"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            20926..22107
                     /locus_tag="CNE_2c00170"
                     /db_xref="GeneID:10920507"
     CDS             20926..22107
                     /locus_tag="CNE_2c00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680241.1"
                     /db_xref="GI:339321347"
                     /db_xref="GeneID:10920507"
                     /translation="MEYASSAWHVISATLVLMLGAPVAVSMGRKFGTRPKWGLFLYVW
                     HTIFCIFYAKLVMESGGDAADYFEASLAPSPEFGIGTRGVSYFTHIFSIYLGFSYVGV
                     FFVFNIFGTIGLLAFDAVLRTVTQDRSRFLRRLAVVIVLLPSISFWSAAIGKDSVAFM
                     ATSLALWASMSMPRRSWLMIIAIACMFLMRPHIAAIMILSLAASMVFSAKVPWKWRAA
                     LVSVALAASAAIVPFTIQYAGLEMPADGDSIETYVEKRQGYNQHGGGGIDIGSMSLPM
                     QLFTYVFRPLPYEANGIFGLAASLDNVVLLVLAVLGVWGMIRRRGDRVVLRNAAFLWI
                     YSAGTWLILAPMTANLGISVRQKWMFVPMLVCLLICNVRERQVRRRASAAEYQPLGTS
                     R"
     gene            complement(22243..23406)
                     /locus_tag="CNE_2c00180"
                     /db_xref="GeneID:10920508"
     CDS             complement(22243..23406)
                     /locus_tag="CNE_2c00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680242.1"
                     /db_xref="GI:339321348"
                     /db_xref="GeneID:10920508"
                     /translation="MQQFKPLTSLRLFLALWVLCRHYFHVYEQDAMLFNIGFTSTYFD
                     HGYLGVDGFFILSGFILAYNYDPAPGQQLQWKKFIVARIARIYPVYLFCLLAFALAVI
                     VRDLGLHTHTVGTGNYTLSSFVPEALMLGAWQYAGPSGWNDVGWSVSAEWFAYVFFPL
                     FLLAAPRLNKARIAMAGCLALAALAAVEATAPDHLSLSGGVARLVPEFLLGVLLCRLR
                     EAMPRHNGFAAGGMLSLAVCVLGVGLGLDVLFVAGAAGLVFFLSYEKDALTRVLSLRS
                     LVFLGEVSYCIYIVQRIPQYMFAFARGKMASLAALPGVAQAALLLALTVGIAILLHFV
                     VEKPMRIYINRRFGARAKPVEVSERPTDSRDREYAAASDQQGRRARSTGSRAG"
     misc_feature    complement(22324..23406)
                     /locus_tag="CNE_2c00180"
                     /note="Predicted acyltransferases [Lipid metabolism];
                     Region: COG1835"
                     /db_xref="CDD:224748"
     gene            complement(23540..24856)
                     /locus_tag="CNE_2c00190"
                     /db_xref="GeneID:10920509"
     CDS             complement(23540..24856)
                     /locus_tag="CNE_2c00190"
                     /note="N-oxide forming"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylaniline monooxygenase"
                     /protein_id="YP_004680243.1"
                     /db_xref="GI:339321349"
                     /db_xref="GeneID:10920509"
                     /translation="MISTTDTAIIGAGPYGLSISAHLSDAGVPHQVLGEPMLAWRNFM
                     PPGMLMRSEAFASDLYAPHAGYRLEDYCRLMHLPYAPIGMRLPLERFVEYGLWFQSQL
                     VGHVRPVDVTELRRQDDGFLLSLSDGSALAARRVVVALGLKGFEQTPKVLQGLPRPHV
                     LHSGEIGNLAWARGKRIVIVGGGQSALGLAALFNELGAHVRVLVRGGIISWNEDPEVG
                     RSLLSRMLRPEGGLAQGWYPYVLSEFPYLFRGVGQRTRKRIAEASFGPSGAWWLRDRV
                     AGKIELRMNTTVRHVAIRNDEVVLEVSGENGPATITGDHVVAATGFKVDLARHAFLSP
                     EIVSALSLVDGWSDVSRNFESAMPGLYITGPASALSFGPVLRFVYGAKYAAPRIARHI
                     SRCHAAEGGSRAFDAPAVPQPLAESRTGVLPHPPAAAFQEAKSPAD"
     misc_feature    complement(23606..24856)
                     /locus_tag="CNE_2c00190"
                     /note="Predicted flavoprotein involved in K+ transport
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG2072"
                     /db_xref="CDD:224983"
     misc_feature    complement(24242..24835)
                     /locus_tag="CNE_2c00190"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(24853..26064)
                     /locus_tag="CNE_2c00200"
                     /db_xref="GeneID:10920510"
     CDS             complement(24853..26064)
                     /locus_tag="CNE_2c00200"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-grasp enzyme-like protein"
                     /protein_id="YP_004680244.1"
                     /db_xref="GI:339321350"
                     /db_xref="GeneID:10920510"
                     /translation="MMKSTLDPAETTAAVVVGGELGGLGLVRSLAGKGIPVLLADTGH
                     TTPASWSRHARRHIIRSLVGREFTEDLIALARRLGQRPVLFLTDEDAVHSVSENRDEL
                     SEWFRFCVPPAQGVRMLSSKSAFHCFAEENGFPVPRTVIMNGQLDVPLLSGLRYPAVI
                     KPDDKRQALTGDKERAIRVQSLAEGQAHARAMLRTPGGIVAQEWIEGPQSNIHFTLFY
                     RGMDGKAAAVFTGRKLACWPPEIGSTAVCVAAPEASEELEPITLAFAERASFYGMGSM
                     EYKWDEIHRRFVMIEPTVGRIDWQEEIATLCGVNIPLAAYRHELGLPDLPAATPPPGG
                     AVWRATFLRSAPRSLMPHGARIFDGYFRWDDPLPAIQHYCLSMPLDRFLLHWSGWFPS
                     TRRDQVQQEQQ"
     misc_feature    complement(24955..25983)
                     /locus_tag="CNE_2c00200"
                     /note="Predicted ATP-grasp enzyme [General function
                     prediction only]; Region: COG3919"
                     /db_xref="CDD:226433"
     misc_feature    complement(<25261..25701)
                     /locus_tag="CNE_2c00200"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            26440..28080
                     /locus_tag="CNE_2c00210"
                     /db_xref="GeneID:10920511"
     CDS             26440..28080
                     /locus_tag="CNE_2c00210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680245.1"
                     /db_xref="GI:339321351"
                     /db_xref="GeneID:10920511"
                     /translation="MRLRPKANVGALHPGAKYQEPLHPIAREEDMSCLLPETAARESL
                     VIMVTTTEPAGWERLVVQRLQASGTCRVVERALGAMNALEEASGTADRAKALQAGGPV
                     TAIVDLTGRLDTGWSRHAAEGVWRLCDARGLAPGDPHHGLETHASGAGIRLHLVAWTP
                     SHAVMVDTASGYAEPCEKVRPERLAVMGASLLDGALREIRALGGLSGRQAWTGCHGRV
                     PAWRRLLWRLRALGSHAIIQLKGFVLVEEWMVGIVEMAFADAVRAQRLPVRWLGTRMP
                     SYCWADPFGVPGSPDEIYCEEVDLRQNIGRIVRLKLDAHEAPSSAGQVDLGLPGHLSF
                     PYLFRHDGALYCVAESSQSRRCVLNRQEEGGRWQQVAVLLEDVAAVDPTIFAHEGRFW
                     LLYTDVAMGQFDNVCLCYADNLLGPWQPHPQNPVKFDHGSARAAGSVMREADGLLRVA
                     QVCKTAYGQAIAVNRIVHCTPEFYREETVGVISPAGDRVNPHGLHTLSAWGGRVVVDG
                     KRHGFNGGVLWHRIVSRAARALRLPLPTRNPSRAASRR"
     misc_feature    <27583..>27732
                     /locus_tag="CNE_2c00210"
                     /note="Glycosyl hydrolase families: GH43, GH62, GH32,
                     GH68; Region: GH43_62_32_68; cl14647"
                     /db_xref="CDD:265439"
     gene            complement(28043..29161)
                     /locus_tag="CNE_2c00220"
                     /db_xref="GeneID:10920512"
     CDS             complement(28043..29161)
                     /locus_tag="CNE_2c00220"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="YP_004680246.1"
                     /db_xref="GI:339321352"
                     /db_xref="GeneID:10920512"
                     /translation="MRFLMIASYAESLIAFRGPLIAALQQKGLEVHIAAPDLPAGHQV
                     RAALESRGVVVHHVPLQRTGMNPLADARTLLALHRLMRRVRPACVMSYTIKPVIYGML
                     AGWLARVPRRFALITGLGYAFREDSGRSRLRAVVQRLYALALSRAHTTFFQNPDDEAL
                     FRRAEILPAGKRSCIVNGSGVDVASFEVAPLPDDGPRFLLIARLLGDKGVREYAEAAR
                     RIRARGAGARFSLVGWIDASPDAIAQDELDAWVADGTVDFLGRLSDVRPAIAGCNVYV
                     LPSYGEGTPRSVLEAMAMGRPIITTDAPGCRETVVDGDNGLLVPVKSVGALEQAMMQL
                     IEDWEQVVRMGQRSRQIAESKYDVRKVNAVMLREMGFE"
     misc_feature    complement(28061..29158)
                     /locus_tag="CNE_2c00220"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. cap1E in Streptococcus
                     pneumoniae is required for the synthesis of type 1
                     capsular polysaccharides; Region: GT1_cap1E_like; cd03808"
                     /db_xref="CDD:99980"
     misc_feature    complement(28079..29095)
                     /locus_tag="CNE_2c00220"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(order(28301..28303,28367..28369,28553..28561,
                     29078..29080))
                     /locus_tag="CNE_2c00220"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99980"
     gene            complement(29149..31143)
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /db_xref="GeneID:10920513"
     CDS             complement(29149..31143)
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /EC_number="6.3.5.4"
                     /note="glutamine-hydrolyzing"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthetase AsnB"
                     /protein_id="YP_004680247.1"
                     /db_xref="GI:339321353"
                     /db_xref="GeneID:10920513"
                     /translation="MCGFAGFLGGLPATLADRADLLADMANQIRHRGPDHGDTWCDPD
                     QPFGLAHRRLAIVDLSAAGHQPMTAASGRHVIAFNGEIYNHLDIRAELERAGVAPRWR
                     GHSDTETLLAGIDAWGAEATVRRAVGMFAFALWDRRTCTLTLARDRLGEKPLYYGWQA
                     TGRGRAFLFGSELKALRPHPAFEGRINRDALCLYMRHNNVSGSHSIYHNVAKLPPAHL
                     LTVSLGAPEPVLRPYWSGAEAALDGVQHPFAGSPDEAVDQLEMLLRDAVSRQMMADVP
                     LGAFLSGGIDSSTVVALMQSQSSQPIRTFSIGFHNSDYSEAPHAKAVARHLGTSHTEL
                     YVTPEHAMAVIPGLPRIYDEPFADSSQIPTLLVSELARRHVTVSLSGDAGDELFGGYN
                     RYQITAELWPRLSRIPAPLRAAAAWSLTRCPPDRINRIAAAFPVASRWANVGEKIHKG
                     AGVMAARSSAELYRGMVSHWPHPEMLVVGGAEAATVLDGSAQAFSALTDVERMMALDM
                     LSYLPNDILAKVDRAAMHHSLETRIPFLDHRVVEFAWRLPLAYKLRREARGYTTKWVL
                     RQVLDRYVPRTLIERPKMGFGIPIDAWLRGPLRDWAEDLIDPRRLRREGYLNPEPIRK
                     RWAEHLSGRRNWQHQLWCVLMFQAWLAHQTAQERSPACVS"
     misc_feature    complement(29194..31143)
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="exosortase A system-associated amidotransferase 1;
                     Region: eps_aminotran_1; TIGR03108"
                     /db_xref="CDD:132152"
     misc_feature    complement(30439..31140)
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="Glutamine amidotransferases class-II (GATase)
                     asparagine synthase_B type.  Asparagine synthetase B
                     catalyses the ATP-dependent conversion of aspartate to
                     asparagine. This enzyme is a homodimer, with each monomer
                     composed of a  glutaminase domain and a...; Region: AsnB;
                     cd00712"
                     /db_xref="CDD:238364"
     misc_feature    complement(order(30826..30828,30901..30909,30985..30987,
                     31138..31140))
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="active site"
                     /db_xref="CDD:238364"
     misc_feature    complement(order(30988..30990,31033..31047,31054..31056,
                     31063..31065,31090..31092))
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238364"
     misc_feature    complement(29377..30360)
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    complement(order(29998..30006,30043..30045,30217..30225,
                     30298..30306))
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    complement(order(29998..30006,30043..30045,30217..30225,
                     30298..30306))
                     /gene="asnB"
                     /locus_tag="CNE_2c00230"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            complement(31163..32248)
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /db_xref="GeneID:10920514"
     CDS             complement(31163..32248)
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /codon_start=1
                     /transl_table=11
                     /product="Vi polysaccharide biosynthesis protein
                     vipB/tviC"
                     /protein_id="YP_004680248.1"
                     /db_xref="GI:339321354"
                     /db_xref="GeneID:10920514"
                     /translation="MQENAYAHLKARLAATPRTWLVTGVAGFIGSNLLETLLRLDQRV
                     VGLDNFSTGHRRNLIEVEALVSPRQWANFRFIEGDIRNLEHCRSAMRFCAPGREGAAN
                     GLYPVDFVLHQAALGSVPRSLEDPIATHSVNISGFLNLLVAARDAQVSTFVYAASSST
                     YGDHPGLPKVEDRIGKPLSPYAVTKYANELYADVFHRCYGVHATGLRYFNVFGPRQDP
                     NGAYAAVIPKWIAALLRHEAVYINGDGETSRDFCYVANAVQANLLAAASDHCEGDSQV
                     YNVAVGDRTTLATLFELLRDGLRPYGVAAGTEPVYRGFRAGDVRHSQADIGKAQRLLG
                     YLPTHRVRDGLAEAMPWYVQMQQALNA"
     misc_feature    complement(31172..32236)
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="Vi polysaccharide biosynthesis protein TviC;
                     Provisional; Region: PRK15181"
                     /db_xref="CDD:185103"
     misc_feature    complement(31193..32191)
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="UDP-N-acetylglucosamine 4-epimerase, extended (e)
                     SDRs; Region: UDP_AE_SDR_e; cd05256"
                     /db_xref="CDD:187566"
     misc_feature    complement(order(31580..31582,31616..31627,31694..31696,
                     31706..31708,31778..31786,31853..31855,31898..31900,
                     31904..31912,32009..32017,32090..32107,32162..32173,
                     32177..32179))
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187566"
     misc_feature    complement(order(31283..31285,31292..31297,31304..31306,
                     31388..31390,31502..31504,31508..31510,31523..31531,
                     31562..31567,31574..31579,31619..31621,31625..31627,
                     31706..31708,31772..31780,31895..31900))
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187566"
     misc_feature    complement(order(31652..31654,31664..31669,31676..31681,
                     31688..31693,31697..31702,31709..31720,31814..31816,
                     31823..31825,31835..31837,31844..31849,31859..31861,
                     31868..31873,31880..31885))
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187566"
     misc_feature    complement(order(31694..31696,31706..31708,31778..31780,
                     31850..31852))
                     /gene="vipB"
                     /locus_tag="CNE_2c00240"
                     /note="active site"
                     /db_xref="CDD:187566"
     gene            complement(32309..33628)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /db_xref="GeneID:10920515"
     CDS             complement(32309..33628)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Vi polysaccharide biosynthesis protein
                     vipA/tviB"
                     /protein_id="YP_004680249.1"
                     /db_xref="GI:339321355"
                     /db_xref="GeneID:10920515"
                     /translation="MPTTTGSTTRKITVMELSHAQVAIIGLGYVGLPLAVEFGKQQPV
                     LGFDVNAARIEALRAGHDATLEVSPDELRSAHHLRYSNDPEALRDCQVFIVTVPTPVD
                     RAKRPDLTPLILASETVGRAMAPGAVVIYESTVYPGATEEICVPVLERHSGLKFNVDF
                     FCGYSPERINPGDKEHRLPDIRKVTSGSTPEASEAIDKLYGRIIVAGTHRASSIRVAE
                     AAKVIENTQRDVNIALMNELSLLFHKLGIDTLEVLRAAGTKWNFLPFRPGLVGGHCIG
                     VDPYYLTHKAQEVGYHPQVILAGRRINDKMAIHVADEVVKLMLRRGIPVLDSRVLVLG
                     LTFKENCPDVRNTKAVDIVTTLRSYNAQVDVYDPWINIEDAEHEYGLSCLREAPRNDQ
                     YDAIVLAVAHHQFVTMGVRAIKALGKAHAVLFDVKGILPRSEIDARL"
     misc_feature    complement(32312..33580)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /note="Vi polysaccharide biosynthesis protein TviB;
                     Provisional; Region: PRK15182"
                     /db_xref="CDD:185104"
     misc_feature    complement(33041..33565)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    complement(32708..32989)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    complement(32336..32638)
                     /gene="vipA"
                     /locus_tag="CNE_2c00250"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            complement(33736..34785)
                     /locus_tag="CNE_2c00260"
                     /db_xref="GeneID:10920516"
     CDS             complement(33736..34785)
                     /locus_tag="CNE_2c00260"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_004680250.1"
                     /db_xref="GI:339321356"
                     /db_xref="GeneID:10920516"
                     /translation="MAATVANELARRGHDIHILSLCDPRSCFRLDPAVRHDALFDRRP
                     SFRSQFLPTIARLRRYLRQHKIAVLVEVDPLLTLFTLPACLGLGMRRIAWEHCNFDQD
                     LGLPLRSIARRLAARTCERIVVLTELDREKWVRSLHCTNIDVIPNILTFPIPAEPAAR
                     TSRTAVAVGRLADVKGFDVLLQAWVPIATTFPDWRLRIVGNGELLESLTQLRDRLCLQ
                     DCVHIEPARSDIESVYRDASLLCLSSRFEGFSLVLLEAMAYGLPVVATNCETGVKAML
                     THGENAQLSPVDDPAALARGIAAVITSPELAARLSEAGRRHAQRFTPGEIGTHWERLL
                     SGTSGETTTSEIGMA"
     misc_feature    complement(33790..34782)
                     /locus_tag="CNE_2c00260"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. AmSD in Erwinia amylovora
                     has been shown to be involved in the biosynthesis of
                     amylovoran, the acidic exopolysaccharide acting as a
                     virulence factor. This enzyme may be...; Region:
                     GT1_amsD_like; cd03820"
                     /db_xref="CDD:99990"
     misc_feature    complement(33781..34764)
                     /locus_tag="CNE_2c00260"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(order(34030..34032,34096..34098,34276..34284))
                     /locus_tag="CNE_2c00260"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99990"
     gene            complement(34877..36052)
                     /locus_tag="CNE_2c00270"
                     /db_xref="GeneID:10920517"
     CDS             complement(34877..36052)
                     /locus_tag="CNE_2c00270"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase"
                     /protein_id="YP_004680251.1"
                     /db_xref="GI:339321357"
                     /db_xref="GeneID:10920517"
                     /translation="MDQSQSGKPAGPMRITLLITCLQMGGAEQQVAALARQYLSLGHA
                     VSVISLMPGCEVKLPEGVETLMLAIRKTPLALLATLMQVRRFVLRWRPDVIHAHLVHA
                     NLVARLLTRVCPVPATICTAHNYMEGGTWRMLAYRLTDRWADLTTQVSNEGRQRMIEV
                     RAAPETRIIYMPNGFDTTRYRPSAEQRAATRAGLGLGPGDRFVLNVGRLVPDKAQADL
                     IDAFAQACPGPGTVLMIAGDGPLRDALAQRIAQHGLSGRVRLLGQRADVPALLNAADL
                     FVLSSLIEGMPLVVGEALACGCPVVATDASGVPAMLGTIGTLVPRGDTAALARAIRDA
                     VAHGRGEPVDEAARHQHIAAAFNIEVIAREWLRLYARLASAGAAPHVEATDAAARYQ"
     misc_feature    complement(34925..36016)
                     /locus_tag="CNE_2c00270"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(34943..36013)
                     /locus_tag="CNE_2c00270"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            36271..36870
                     /gene="epsL"
                     /locus_tag="CNE_2c00280"
                     /db_xref="GeneID:10920518"
     CDS             36271..36870
                     /gene="epsL"
                     /locus_tag="CNE_2c00280"
                     /EC_number="2.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transferase"
                     /protein_id="YP_004680252.1"
                     /db_xref="GI:339321358"
                     /db_xref="GeneID:10920518"
                     /translation="MKRVLDVVLTSVALVVLALPLLVVMGLVRWKLGGPVFFRQTRAG
                     LDGKPFEVIKFRTMTDERGPDGELLPDAQRITPFGWMIRRTSIDELPELWCVLKGEMS
                     LVGPRPLPTFYLPLYSPEQARRLLVLPGITGWAQVNGRNSLSWEEKFRLDVWYVDHQS
                     FWLDLRILWRTIGTVLAKEDISAAGEVSATRFCGSKEAP"
     misc_feature    36349..36804
                     /gene="epsL"
                     /locus_tag="CNE_2c00280"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            36918..38102
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /db_xref="GeneID:10920519"
     CDS             36918..38102
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /codon_start=1
                     /transl_table=11
                     /product="spore coat polysaccharide biosynthesis protein
                     SpsC"
                     /protein_id="YP_004680253.1"
                     /db_xref="GI:339321359"
                     /db_xref="GeneID:10920519"
                     /translation="MLDTGFSPWPSFSREEAQAVQRVLLSNRVNYWTGTECRDFEKEF
                     AAWCGAEYAVTLANGTLALDVALHALDIGPGDEVVVAPRTFLASVSCVVNAGAKPVFA
                     DVDPDSGNLSAHTIAAALTPRTRAVICVHLAGMPCDMDPIMALAREHGFKVIEDCAQA
                     HGAVYKGRMVGTIGHIGAWSFCQDKIMTTGGEGGMVTTDDRELWSHMWSYKDHGKSWE
                     AMHGRAHPPGFRWVHDAFGTNWRMTEMQAAIGRIQLRRMADWHERRTANAMALADALG
                     ACDALHVPLPPAGIEHAWYKFYAFVQPRGLAEGWSRDSIMAAINAAGVPCYAGICAEV
                     YLEKAFDGTGLRPPARLPAARALGETSLMFLVHPTLTDDEVRMTGQVVRSVMQQATRV
                     AA"
     misc_feature    36963..38072
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    order(37092..37097,37383..37385,37392..37394,37455..37457,
                     37467..37472,37905..37907)
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    order(37092..37097,37167..37169,37383..37385,37392..37394,
                     37455..37457,37470..37472)
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    37470..37472
                     /gene="spsC"
                     /locus_tag="CNE_2c00290"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            38102..38854
                     /locus_tag="CNE_2c00300"
                     /db_xref="GeneID:10920520"
     CDS             38102..38854
                     /locus_tag="CNE_2c00300"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 superfamily"
                     /protein_id="YP_004680254.1"
                     /db_xref="GI:339321360"
                     /db_xref="GeneID:10920520"
                     /translation="MATFLWNHYLYFGESRVALPLVAWVAVCFVVAGQGWRALRWAVS
                     FGVGGALLIAAKSAFSYAGWSLPTIGVYSVSGHAMLTAAVYPVLLMLLGSVLGRQMAW
                     LGLATGVGLALFMPVVLVTDFHHTIGESLIGLGVGFAVAGVTLWRWRPVGFLHVGAAV
                     ALLVPVALLFDPRDAVEDLQGALRSRVMLWTGATGEYWRSIDPDPATGRRVISVGFWS
                     ERDTSGQVPHRRRHHSAWPSYEVLIERAGRHP"
     misc_feature    <38135..>38446
                     /locus_tag="CNE_2c00300"
                     /note="PAP2_like proteins, a super-family of histidine
                     phosphatases and vanadium haloperoxidases, includes type 2
                     phosphatidic acid phosphatase or lipid phosphate
                     phosphatase (LPP), Glucose-6-phosphatase,
                     Phosphatidylglycerophosphatase B and bacterial acid...;
                     Region: PAP2_like; cl00474"
                     /db_xref="CDD:260448"
     misc_feature    order(38267..38269,38324..38332)
                     /locus_tag="CNE_2c00300"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            38851..39918
                     /locus_tag="CNE_2c00310"
                     /db_xref="GeneID:10920521"
     CDS             38851..39918
                     /locus_tag="CNE_2c00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680255.1"
                     /db_xref="GI:339321361"
                     /db_xref="GeneID:10920521"
                     /translation="MKSATEFGSFFPLDPAVPLGGEAWLRPGDLLTGTGRDALRAMVA
                     HGRSHGWRRLYAPSYYCHAVLDDIARDIDVRMYLHAPFGGPAQLALGDDEAAIVPEYF
                     GLQAEVEVQGGSVLLDRSHDLLATWSYARAPDYVFASLRKTLPVPDGGLVRPPPGQPF
                     ARSLAPTPAHVRAAASMAAAMAMKAAYLAGAQVAKAAYLALAAEAEGNLRSDAEISGP
                     SALTRVLAPAVDLGWMRQRRQENLALLARCFAGPHAALPAGMQWRETPAFGILLCADA
                     PQRERVRQRLIGADVYPAVLWPMTWPGVPEDNHRLCGRILVLHADYRYGLHDIGRLGE
                     IILQIAASIAANPDTSDEDRR"
     gene            39915..40940
                     /locus_tag="CNE_2c00320"
                     /db_xref="GeneID:10920522"
     CDS             39915..40940
                     /locus_tag="CNE_2c00320"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_004680256.1"
                     /db_xref="GI:339321362"
                     /db_xref="GeneID:10920522"
                     /translation="MMKINLLETSSAEWLDVLQRCRHDSHHMPGWLRAAQHEGSGKAF
                     AIHVMDDGHELFVPLLNRDINGKDWDASSPYGFAGPLVSDDAPDAFIDTALSEALELL
                     RGRGCVSCFIRLNPIVNAPWRSAVGTLIDHGMTISIDLSKSEAEHWHDTSHGHRLEIS
                     KAMRAGVTVRLDETLETLPHFIRLYNASMDRLRASDYYFFDDAYHYTLARELGDRLRL
                     FVAEEDGVIIGGATVTVSDGTGILQGHLMGIDARYRHRQPSKIMLHAIRQWGREQGHR
                     YYHLGGGLGGSAEDSLFRFKRGFSPDTHVFRTQRVVVDPGKYLALCDGTPSVLEDLSG
                     YFPAYRR"
     misc_feature    40377..40751
                     /locus_tag="CNE_2c00320"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_6; pfam13480"
                     /db_xref="CDD:257804"
     misc_feature    40566..40751
                     /locus_tag="CNE_2c00320"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(40653..40661,40689..40694)
                     /locus_tag="CNE_2c00320"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(41031..43100)
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /db_xref="GeneID:10920523"
     CDS             complement(41031..43100)
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein EpsC"
                     /protein_id="YP_004680257.1"
                     /db_xref="GI:339321363"
                     /db_xref="GeneID:10920523"
                     /translation="MTAPRSLRLLSLSRRQKIVLMMTVDLLALPLCFALALLLRSGNQ
                     ELIVQYGLLPPLFIAACTIPVFSFSGLYRTVLRYIDLKVLWAAGISMAAMVGLTYAVS
                     FLMNDSRLPRAGLLIYWFIAFAYVVISRFLIRAMLRRTELWRSARGRPTRRVGIFGAG
                     EAGFQLANAMRASVDHEAVCFFDDDLSLDNHTFTDLPVFHTSRMREQLQRLGIDEVVL
                     AVPSLSPDRRKRILDKLHRYAVSVRTLPTLLELVDRKITMQSIREVKVEDLLGRPAVP
                     PREALFAKCTHRKVVMVTGAGGSIGSELCRQVATQQPRKLILFDHSEWALYMVEQDLR
                     RNFPGVPLLARIGSVCDANAVAAAMQGQQVDTIYHAAAYKHVPLVESNMPEGIRNNVL
                     GSLTIANMADRFGVQTCVLISTDKAVRPTNVMGASKRIAELIFQAAAARPGTRTVFAM
                     VRFGNVLGSSGSVVPLFRSQIEAGGPITITHPDVIRFFMLIPEASQLVIQAGAMARGG
                     EVFVLDMGQPVRIVDLARTMIEMAGLVERTPKNPNGDIEVKFVGLRPGEKLYEELLIG
                     GNVTPSDHERIMCSQEPSLEEAELREMLTRLYAACDARDELKIQTMVQAIVPEYAPYT
                     SLDDASRKPVPAAVPAESGQAIQDTPDDARVPRQVVLRRVASHALGQPELASEAKPVS
                     LSSPGKL"
     misc_feature    complement(41217..43043)
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="Predicted nucleoside-diphosphate sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG1086"
                     /db_xref="CDD:224011"
     misc_feature    complement(42363..42899)
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="CoA binding domain; Region: CoA_binding; cl17356"
                     /db_xref="CDD:266646"
     misc_feature    complement(41367..42236)
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="UDP-Glcnac (UDP-linked N-acetylglucosamine)
                     inverting 4,6-dehydratase, extended (e) SDRs; Region:
                     UDP_invert_4-6DH_SDR_e; cd05237"
                     /db_xref="CDD:187548"
     misc_feature    complement(order(41721..41726,41733..41744,41817..41819,
                     41865..41867,41934..41936,41979..41981,41985..41993,
                     42054..42062,42138..42143,42201..42212,42216..42218))
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187548"
     misc_feature    complement(order(41703..41705,41718..41723,41937..41939,
                     41946..41948,41955..41957,41967..41969,41976..41987,
                     42039..42041,42048..42050,42057..42068,42108..42110,
                     42120..42122,42132..42134,42138..42140))
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    complement(order(41430..41432,41439..41441,41538..41540,
                     41643..41645,41649..41651,41661..41669,41700..41705,
                     41712..41720,41736..41741,41829..41831,41853..41861,
                     41979..41981))
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    complement(order(41817..41819,41829..41831,41859..41861,
                     41931..41933))
                     /gene="epsC"
                     /locus_tag="CNE_2c00330"
                     /note="active site"
                     /db_xref="CDD:187548"
     gene            complement(43596..44525)
                     /locus_tag="CNE_2c00340"
                     /db_xref="GeneID:10920524"
     CDS             complement(43596..44525)
                     /locus_tag="CNE_2c00340"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_004680258.1"
                     /db_xref="GI:339321364"
                     /db_xref="GeneID:10920524"
                     /translation="MPASSFLPTVSVCISTCDHPEQLRHTLQSVADSTMPPHQLIVTD
                     DSSGYDTREMMRRDYPDITYLEGPRRSRAANRNRALRAATGSHVLFLDDQTLLGATFL
                     QQMTESVADDHLRRATAGCATPLILTGTEVCQGRRGAPRKPAFLGYPTLDYRRGERLC
                     SVLLHSAVFPRELFENLSFDEHLAVGYDDLELAARAVQEFGYRIEMVPSAVNQRLPSV
                     SADRPCPASDASRLYVACRRYDHGPEHPLKTALFLLLALPHDLAHHLRAAGLRGAGTF
                     YDTATCLWQLLRGPRPAGRQGSGTGLSAPLPRD"
     misc_feature    complement(43893..44474)
                     /locus_tag="CNE_2c00340"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(44244..44246,44250..44252,44397..44399))
                     /locus_tag="CNE_2c00340"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(44604..45560)
                     /locus_tag="CNE_2c00350"
                     /db_xref="GeneID:10920525"
     CDS             complement(44604..45560)
                     /locus_tag="CNE_2c00350"
                     /codon_start=1
                     /transl_table=11
                     /product="NarL family response regulator"
                     /protein_id="YP_004680259.1"
                     /db_xref="GI:339321365"
                     /db_xref="GeneID:10920525"
                     /translation="MNALLIEEHPLLRLGLLQMLENIQESAQVAAIAPADIARLDSRH
                     HNADLLVFGMPADVGSGWPQLEQAREALSPHRILILADILPLHVPNADSARGVCGCLP
                     KSASLAVIEAAIRLAVSGVQGLLFSAETGSMPSASRSAMPAVQSLASAAPLPLNPAHA
                     LTGEQLSLVACAGTPGAARTTVAVRDLTCLRPGQPLSAPASTSPAPLVEEEPSYDEAE
                     MLKITPRQYEVLVLLARGYPIKTVSRMLNISVATVKSHACTLYQRLKVRNKGEAVYAA
                     LQRGATLEWVSGDERLTRGSNARPVVASRTSDAAFQAASPVL"
     misc_feature    complement(44721..45560)
                     /locus_tag="CNE_2c00350"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(44742..44894)
                     /locus_tag="CNE_2c00350"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(44754..44756,44787..44801,44805..44810,
                     44814..44819,44841..44849,44886..44894))
                     /locus_tag="CNE_2c00350"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(44748..44756,44847..44849,44853..44855,
                     44859..44861))
                     /locus_tag="CNE_2c00350"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(46279..46596)
                     /locus_tag="CNE_2c00360"
                     /db_xref="GeneID:10920526"
     CDS             complement(46279..46596)
                     /locus_tag="CNE_2c00360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680260.1"
                     /db_xref="GI:339321366"
                     /db_xref="GeneID:10920526"
                     /translation="MKRQLLLAAAVLATSGVFGLTAPAEAQPVVVAHGYGHPPPPPRY
                     EPHPAARRGQVWVPGHWAATGGRYDWRGGYWQAQRPGYRYVPERWVRGPHGWVMRPGH
                     WAR"
     gene            complement(46636..46758)
                     /locus_tag="CNE_2c00370"
                     /db_xref="GeneID:10920527"
     CDS             complement(46636..46758)
                     /locus_tag="CNE_2c00370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680261.1"
                     /db_xref="GI:339321367"
                     /db_xref="GeneID:10920527"
                     /translation="MKRALSLVVLLSTTAALLSACIVVPPRGGPPPRYHHYDRY"
     gene            47256..47393
                     /locus_tag="CNE_2c00380"
                     /db_xref="GeneID:10920528"
     CDS             47256..47393
                     /locus_tag="CNE_2c00380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680262.1"
                     /db_xref="GI:339321368"
                     /db_xref="GeneID:10920528"
                     /translation="MPVMLIVLALQWLQGLSPPAAALFALPQEMAPVDAAAIIEPALT
                     R"
     gene            47416..47925
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /db_xref="GeneID:10920529"
     CDS             47416..47925
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /EC_number="4.2.1.104"
                     /codon_start=1
                     /transl_table=11
                     /product="cyanate hydratase CynS"
                     /protein_id="YP_004680263.1"
                     /db_xref="GI:339321369"
                     /db_xref="GeneID:10920529"
                     /translation="MTTLPPWQSEWFHPTYHCHGVSMNRSDVTDLIIEAKVTRGITWA
                     QVAERVGRSKEWTTAACLGQMAFDAAGARAVMEAFGLPPEAEPWLREVPYKGSLPTQV
                     PADPLIYRFYELISVYGTTFKALIHEEFGDGIMSAIDFRMDLQREPDPNGDRVRIEMS
                     GKFLPYKTY"
     misc_feature    47482..47922
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /note="cyanate hydratase; Validated; Region: PRK02866"
                     /db_xref="CDD:235079"
     misc_feature    47719..47922
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /note="Cyanase C-terminal domain. Cyanase (Cyanate lyase)
                     is responsible for the hydrolysis of cyanate.  It
                     catalyzes the reaction of cyanate with bicarbonate to
                     produce ammonia and carbon dioxide. This allows organisms
                     that possess the enzyme to overcome the...; Region:
                     Cyanase_C; cd00559"
                     /db_xref="CDD:238313"
     misc_feature    order(47725..47736,47740..47745,47749..47754,47758..47760,
                     47767..47769,47782..47784,47788..47790,47794..47805,
                     47809..47820,47827..47832,47845..47847,47851..47853,
                     47875..47880,47884..47886,47890..47892,47896..47904,
                     47911..47913,47920..47922)
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238313"
     misc_feature    order(47743..47745,47821..47826)
                     /gene="cynS"
                     /locus_tag="CNE_2c00390"
                     /note="active site"
                     /db_xref="CDD:238313"
     gene            complement(47919..49181)
                     /gene="cynX"
                     /locus_tag="CNE_2c00400"
                     /db_xref="GeneID:10920530"
     CDS             complement(47919..49181)
                     /gene="cynX"
                     /locus_tag="CNE_2c00400"
                     /codon_start=1
                     /transl_table=11
                     /product="cyanate transport protein CynX"
                     /protein_id="YP_004680264.1"
                     /db_xref="GI:339321370"
                     /db_xref="GeneID:10920530"
                     /translation="MAEGARGANGSAVRNIRTTPRWLVLAAVAGIGLNLRPFLTAVGP
                     LAPAIRTGTGLSYQGMAWLTLLPMLLMGVGAFFGPAIRERLGARAAVLGALALLGAGC
                     ALRLGVADGTWLIASAALCGLGVAVVQAACPGLVKQEFPGRVAPVMGLYSAALMGGGA
                     LGAQLSPYVTALAGSWRDALALWAMPALAALALAWVALPRAAARGPGVPASRPAGATR
                     ALLRRPRTWLLMACFGVMNGGYASLVAWLAPFYQDHGWSASASGSLVALMAVAQAAAA
                     LLLPVLAARSLDRRAWMALALAMQVAGFGGLALWPDAAPHAWAVIGGAGLGGCFALYL
                     VVALDHLPDPDSAGALSALMQGGGFLLASLAPWITAMLHERTGDFAAGWWYHLACAAL
                     VGVLTMRLDPARYDVSFALPPVRAVAPQ"
     misc_feature    complement(47949..49124)
                     /gene="cynX"
                     /locus_tag="CNE_2c00400"
                     /note="putative cyanate transporter; Provisional; Region:
                     cynX; PRK09705"
                     /db_xref="CDD:236614"
     misc_feature    complement(47982..49064)
                     /gene="cynX"
                     /locus_tag="CNE_2c00400"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(48096..48098,48105..48110,48117..48122,
                     48129..48134,48168..48170,48177..48182,48192..48194,
                     48201..48206,48213..48215,48354..48356,48366..48368,
                     48375..48377,48387..48389,48399..48401,48438..48440,
                     48447..48452,48459..48464,48471..48473,48705..48707,
                     48723..48728,48735..48740,48771..48773,48780..48785,
                     48792..48797,48804..48809,48945..48950,48954..48959,
                     48969..48971,48978..48983,48990..48992,49041..49046,
                     49050..49058))
                     /gene="cynX"
                     /locus_tag="CNE_2c00400"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(49174..49611)
                     /locus_tag="CNE_2c00410"
                     /db_xref="GeneID:10920531"
     CDS             complement(49174..49611)
                     /locus_tag="CNE_2c00410"
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine/adenosine deaminase"
                     /protein_id="YP_004680265.1"
                     /db_xref="GI:339321371"
                     /db_xref="GeneID:10920531"
                     /translation="MREAIRLAAANRDRGARPFGAVLVLDGEAVATGVNDIVHSHDPT
                     THAEMEAVRAAARKLGRPDLRGSVIYASGHPCPMCLAAMTMAGVQAVYYAFDNQDAAP
                     YGMSSDAAYQALRLSLNSPPLPLTRVPVDLSAAQLYGPRAPRG"
     misc_feature    complement(49297..49611)
                     /locus_tag="CNE_2c00410"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(49375..49377,49384..49386,49468..49476,
                     49507..49509,49555..49557))
                     /locus_tag="CNE_2c00410"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(49354..49359,49366..49371,49378..49383,
                     49453..49455,49465..49467,49480..49482))
                     /locus_tag="CNE_2c00410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(49375..49377,49384..49389,49468..49476))
                     /locus_tag="CNE_2c00410"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            49766..50713
                     /locus_tag="CNE_2c00420"
                     /db_xref="GeneID:10920532"
     CDS             49766..50713
                     /locus_tag="CNE_2c00420"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680266.1"
                     /db_xref="GI:339321372"
                     /db_xref="GeneID:10920532"
                     /translation="MMKSPAVEKSMDKPAMHDPRLDPVLLQSFVAVAESGSFTRAAQR
                     VHLTQSTVSQQVRRLEDQLGCVLLDRGGRYVTTTPEGERLLGYARRLQQLMAEAVGQL
                     RQSAGQGEIRIGVPEDFAARPLTPVLAGFADDWPGMRLEVTSGMSHELWQRFQDRELD
                     LVLVKQRVGQAPGLASWPEPLCWFDSRGRPAVARDPVPLVAFPVGGLYRGEMTHALDA
                     GGRRWRVAFVSASLASILAAVADGLGVTLLPRRLATAQHQVLEDDGWPAAVPDVELSL
                     HAQPDLPAAARDMAARLAALCETVMGPGEPPADQPKNSL"
     misc_feature    49838..50659
                     /locus_tag="CNE_2c00420"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    49838..50011
                     /locus_tag="CNE_2c00420"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    50093..50623
                     /locus_tag="CNE_2c00420"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(50138..50143,50147..50152,50159..50161,50171..50173,
                     50177..50197,50441..50458,50474..50479,50483..50488)
                     /locus_tag="CNE_2c00420"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(50692..50913)
                     /locus_tag="CNE_2c00430"
                     /db_xref="GeneID:10920533"
     CDS             complement(50692..50913)
                     /locus_tag="CNE_2c00430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680267.1"
                     /db_xref="GI:339321373"
                     /db_xref="GeneID:10920533"
                     /translation="MQCPALENEPDMTSPSNPRAQLARPDHQSAPEAGPLAAPDIPFG
                     SLEAAAMAELPYTFRPAGTCTRYYNEFFG"
     gene            51177..51872
                     /locus_tag="CNE_2c00440"
                     /db_xref="GeneID:10920534"
     CDS             51177..51872
                     /locus_tag="CNE_2c00440"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="YP_004680268.1"
                     /db_xref="GI:339321374"
                     /db_xref="GeneID:10920534"
                     /translation="MSMPPCFADRREAGLYLGRRLAELGFGAAQLGQPALVLALPRGG
                     VPVAFEVVRALDAQLDVLLVRKIGAAGYPELALGAVVEGDAGGGGPHTVVNNDPWARR
                     AVESGSFDAERGRQLDEIARRQQRYRGGAPVPARAGRTVIVVDDGVATGATMRAALES
                     VRMAGAARVVAATPVGSGEGLASLSAAADEVICLNTPPSFGAVGAFYLDFSQTSDEEA
                     LALLRAAAAPPAR"
     misc_feature    51225..51764
                     /locus_tag="CNE_2c00440"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(51297..51299,51303..51305,51609..51617,51621..51635,
                     51705..51707)
                     /locus_tag="CNE_2c00440"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(51880..52401)
                     /gene="leuD1"
                     /locus_tag="CNE_2c00450"
                     /db_xref="GeneID:10920535"
     CDS             complement(51880..52401)
                     /gene="leuD1"
                     /locus_tag="CNE_2c00450"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="YP_004680269.1"
                     /db_xref="GI:339321375"
                     /db_xref="GeneID:10920535"
                     /translation="MTSAIAPAPAGRLWRFGDNIDTDAMAPAVLMKSPLPVLARHCLA
                     SLRPEFPGSVRAGDVLVAGANFGIGSSREQAPQALRELGVGAVVAQSFGGLFYRNAIN
                     LGLPVLVCADTSRLADGAHAVLDLASAQLRLDDGSLVACEPIPDFLRAILAAGGLVPH
                     LKARLGKGQADQG"
     misc_feature    complement(52024..52359)
                     /gene="leuD1"
                     /locus_tag="CNE_2c00450"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    complement(52186..52194)
                     /gene="leuD1"
                     /locus_tag="CNE_2c00450"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            complement(52449..53735)
                     /gene="leuC1"
                     /locus_tag="CNE_2c00460"
                     /db_xref="GeneID:10920536"
     CDS             complement(52449..53735)
                     /gene="leuC1"
                     /locus_tag="CNE_2c00460"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_004680270.1"
                     /db_xref="GI:339321376"
                     /db_xref="GeneID:10920536"
                     /translation="MSHTPATLAQKLVARAAGLAHAEIGTVVICRVDLAMSHDSSGPR
                     RVAPLLQELGTGVWDPSRYVVVTDHFVPGGDAQAESILRFTRDWTRQSGAHFIDAEGI
                     CHVVLPERGHVLPGRLIVGGDSHSPTGGAFGAYMFGVGATEMAGVLATGEIWLRVPHT
                     IRLQWDGQLAPGVCAKDMMLFLCATLGMGGGRYEALEYTGSAVAALPMQERMTLANMS
                     AELGAQTGLVAPDAVTLGWLAEAGVPAQTLAAIDLAHWRTDPDAPVLATHRFDAAALV
                     PQVAAPHSPANSAPVGQAAGEPVQIAYLGACTGAKLEDLRMAARVLRGRHVAAGVTLQ
                     VAPASRRDQLLAEQEGTLGILTDAGATLLPNACGACAGYGAARFPAGSRAIASTARNF
                     SGRMGDVGSAVWLGSPMTVAASAVTGRITDPRTLLE"
     misc_feature    complement(52476..53636)
                     /gene="leuC1"
                     /locus_tag="CNE_2c00460"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    complement(order(52551..52553,52566..52568,52623..52625,
                     53364..53369,53613..53615,53622..53624))
                     /gene="leuC1"
                     /locus_tag="CNE_2c00460"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    complement(order(52569..52571,52623..52628,52635..52637,
                     52815..52817,53361..53363))
                     /gene="leuC1"
                     /locus_tag="CNE_2c00460"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            complement(53732..54772)
                     /locus_tag="CNE_2c00470"
                     /db_xref="GeneID:10920537"
     CDS             complement(53732..54772)
                     /locus_tag="CNE_2c00470"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680271.1"
                     /db_xref="GI:339321377"
                     /db_xref="GeneID:10920537"
                     /translation="MPVFRLVPSSPTRSPSIPRRAAVQRLAMASLAACALALPLSAAA
                     QGHPQVAGGKPIRILVGAPAGGTTDTLARTIAQEMSQELGQPVVVENRPGAGGNIAAD
                     LVAKSAPDGSTLLMSFTSHTINATLYKKLPFDPVQDFTPITLVATVPSVLVATPKLAA
                     SNVPELIRLARSEPGKLNFAIGSVGSSLHMAGDMFKMMTGTYIVNIPYKGTAPALTDV
                     LAGQCDLMFASTINVLPHVRAGKLKVLGVTSPAPLPQFPGAAPIGATVKGFESSAWFG
                     LFGPAGMPHDVTQALYQAARKGLETPAVRKRLENDGAQPMGTTPEAFAAFVKQDVKRW
                     AAVVKYSGASPE"
     misc_feature    complement(53744..54559)
                     /locus_tag="CNE_2c00470"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(54883..55668)
                     /locus_tag="CNE_2c00480"
                     /db_xref="GeneID:10920538"
     CDS             complement(54883..55668)
                     /locus_tag="CNE_2c00480"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680272.1"
                     /db_xref="GI:339321378"
                     /db_xref="GeneID:10920538"
                     /translation="MSEAVVPLYHQIYVVLRQQIVEGRFGQGPLPGEIDLAKQFHASR
                     VTMRRVFDRLVQEGLVRRHRGLGTFVNPHPVRPAAAAGEERGTSLLDNIIDMGQKTSV
                     KVISIDEVHATPDVAESLQIEPGDPVVKIVRVRHYRNRPLSHITVYLPADLGRPITRQ
                     SLEERPVLRLLEAGGVKLGRATQVLSARLADVVVAPLLDVPVGGALLAVRRVVKDAAG
                     RPVQLLLGQYRPDRYEYRMELSPAGVDSANVWVESETRPGLRD"
     misc_feature    complement(54952..55668)
                     /locus_tag="CNE_2c00480"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    complement(55456..55650)
                     /locus_tag="CNE_2c00480"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(55465..55476,55480..55485,55513..55515,
                     55522..55527,55531..55545,55567..55572,55576..55578,
                     55642..55644,55648..55650))
                     /locus_tag="CNE_2c00480"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(54967..55386)
                     /locus_tag="CNE_2c00480"
                     /note="UTRA domain; Region: UTRA; pfam07702"
                     /db_xref="CDD:254372"
     gene            56381..57808
                     /locus_tag="CNE_2c00490"
                     /db_xref="GeneID:10920539"
     CDS             56381..57808
                     /locus_tag="CNE_2c00490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680273.1"
                     /db_xref="GI:339321379"
                     /db_xref="GeneID:10920539"
                     /translation="MNKTLLASAIALAFGAGQALANPTNNADDSGTTNTQNATATSTQ
                     SGSGAAANENSTAVQANDSSTTTKTSTRTSTRTSTNTNSKNRTDQDMRGYGNAAAANG
                     STATANFSNAFNTSKALAISKLEGYVSGNTIAAMGNRAGNWGDANGGLGGKGGRGIGG
                     VGNGGNGGNGGNGGNGGSGGSATNGSATNGAATNYGARAGSGGDGGKAVGWAGDGGNA
                     KSYGGDALSAAATRGGSGGDAIGAGGRALSASLGAGGRGGSALGASLGLGGAAGSAGG
                     SSGNGGAGNDTVGAGGAAGAATAAGSAGAGTGTGGAGGAGTSSASATGGAGSGTGGAG
                     GAGGTGTSTAAGGASTSTGGAGGTQASVGGAGGAGGAATNGSASSSATNGSATAGNGA
                     TGAVGATGGAGGVGNGGTGNGAVGGAGGAGGTVAVSAGSFSLSNVMTSVGQTAAGIMV
                     ANQNLGAASLVQQSVNVQANLSVGR"
     misc_feature    <56924..>57079
                     /locus_tag="CNE_2c00490"
                     /note="2-ketoisovalerate ferredoxin oxidoreductase subunit
                     beta; Provisional; Region: PRK11864"
                     /db_xref="CDD:237005"
     gene            58009..58404
                     /locus_tag="CNE_2c00500"
                     /db_xref="GeneID:10920540"
     CDS             58009..58404
                     /locus_tag="CNE_2c00500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680274.1"
                     /db_xref="GI:339321380"
                     /db_xref="GeneID:10920540"
                     /translation="MQPIHTAVTALTAAFLAWPFMQAQAGPLAGDAAVPAPVAAVAPA
                     ASNPFGTAAVAVASDKLDDVRGGAEVVVNDMRLHGTVADNAAVHTLSGTNMITEGAFA
                     NAAGIPTAIQNSGNNVLIQNATIVNVQFK"
     gene            58410..59102
                     /locus_tag="CNE_2c00510"
                     /db_xref="GeneID:10920541"
     CDS             58410..59102
                     /locus_tag="CNE_2c00510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680275.1"
                     /db_xref="GI:339321381"
                     /db_xref="GeneID:10920541"
                     /translation="MLQRLLRALPFVLALGGTPPALADRISIYGPVGEYYSVPVTSLR
                     EARFKTTIRQQYDFSCGSAAVATLLTYQYGQPVSEELVFANMFVNGDQAKIRQEGFSL
                     LDMKRYLASQGFLADGYELPLSKLEETKIPAIVLIAENGYHHFVVVKGVRGDRVLIGD
                     PARGTRSISREHFESIWESQLLFVIHNRTEQARFNLAADWRVAPSGPYWMGVNRDSLF
                     FTVMPKHGASDF"
     misc_feature    58557..58961
                     /locus_tag="CNE_2c00510"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region: Peptidase_C39G;
                     cd02423"
                     /db_xref="CDD:239103"
     misc_feature    order(58569..58571,58587..58589,58839..58841,58887..58889)
                     /locus_tag="CNE_2c00510"
                     /note="putative active site [active]"
                     /db_xref="CDD:239103"
     gene            59113..59976
                     /locus_tag="CNE_2c00520"
                     /db_xref="GeneID:10920542"
     CDS             59113..59976
                     /locus_tag="CNE_2c00520"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin-like periplasmic protein"
                     /protein_id="YP_004680276.1"
                     /db_xref="GI:339321382"
                     /db_xref="GeneID:10920542"
                     /translation="MFETSAPNTTACRSRGAGTATAAVLFGAGMACATAAQASEQPLP
                     DALDAAAVPAQTVLDTQENKQDQTLAAATQGSMAGWKPVSEDKLDEMRGGFDAGGLQV
                     SFGIERAVYVNGALVVATSINIPDIARITSDQAAKLASALAPAIVSNTYADVNSAMAG
                     NPATAGVQLGSNGSSSAGAAGTATAVASNGASASSAGAAGLPSTAVTTPTGQVVTNGL
                     LAVIQNGAGNSAAVANGTSPMTVIQNTLNNQSIRSLMTIDTSVNTLQAFRSQVANATL
                     NNVLLRAASMR"
     gene            60062..61501
                     /locus_tag="CNE_2c00530"
                     /db_xref="GeneID:10920543"
     CDS             60062..61501
                     /locus_tag="CNE_2c00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680277.1"
                     /db_xref="GI:339321383"
                     /db_xref="GeneID:10920543"
                     /translation="MKKRSMQGIRSAGCSTLLLLGGLAHAQTTLDAGPPAAGLESLQN
                     QLAEQASQLDAMKRALAEQEALIRELRSVIGPEVLSRKRGGAGPGVTPMDNATNAAAA
                     AAGASATQGVPNAVTSPQATQGDQPPQMVVQPGQPQQGESTYQQVVADEPVGKPPERD
                     TRPPEIAPITEQPGVLTAQGKLVIEPGFQYGYSSNNRVALVGYSIIPALLIGLIDVRE
                     VKTSTYIPSVAFRYGITKRLEIEAKVPYVHSSGSTVSREVFTGTAVDRVFNASGSGIG
                     DVEATVRYQLNYGSEKLPYFIGWLRYKSNTGKDPFEVVTDCVTRCVGNATGTGLPLGL
                     PTGTGFQAIQPGVTWLLPTDPAVFFGTFSYLHNFARDNVSRTVLNGEKEPLGKIAPGD
                     IFEFSFGMGLALNERASFSIGYDQSIIWPTKQNGQTVPGSVRVTQGTLLVGYSYRFSN
                     RYTLNLSVGAGLTRDTPDLQVNVRLPITF"
     misc_feature    60632..61486
                     /locus_tag="CNE_2c00530"
                     /note="Putative MetA-pathway of phenol degradation;
                     Region: Phenol_MetA_deg; cl01768"
                     /db_xref="CDD:261060"
     gene            61717..62229
                     /locus_tag="CNE_2c00540"
                     /db_xref="GeneID:10920544"
     CDS             61717..62229
                     /locus_tag="CNE_2c00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680278.1"
                     /db_xref="GI:339321384"
                     /db_xref="GeneID:10920544"
                     /translation="MRKRIFWLLPDLASARRTMDDLLLARLENSHIHFVARDGSDMTG
                     LHEANLFQTSDIVHAAEMGLMVGGGVGVVAGVVVAMFPIVSDTPQWGLVGVLAVLGAV
                     FGAWASSMIGSSAPNSRLRAFEKDIEAGKILLMVDVPRSRVEEIETLLANAHPEASFA
                     GLDPAVPAFP"
     gene            62503..63639
                     /locus_tag="CNE_2c00550"
                     /db_xref="GeneID:10920545"
     CDS             62503..63639
                     /locus_tag="CNE_2c00550"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004680279.1"
                     /db_xref="GI:339321385"
                     /db_xref="GeneID:10920545"
                     /translation="MKAKWIACGMLAATLGWAAQTALAETGVTRNTIRIGQSAGITGP
                     VAGSVKEQIAGAQVYLRTINASGGVAGRRIELVTHDDGFDAKRTPDNVRKLIDEDKVF
                     ALFMVRGTPQNESILPIIAAQKVPLVAPLTGAITLHRPVNRYVFNVRAKYQDEVARAI
                     NHLATSGMSRIGIFYANDGFGRDVLEGYSAALQARGVQPAATASFARPMGDITQSVAA
                     MNKANPQAVLVIGSGSEAARIIRELRRAGSEAQFVTLSNNAADSFIRELGADARGLII
                     TQVVPGTNSSQMTLASEYRSLAKQQGVEPSNAGMEGFMSAKVLVEGLRRAGPDLTRER
                     LVTALEGMRDYDLGGILISYSAERHTGSSFVEMSIVSSTGKLIR"
     misc_feature    62599..63600
                     /locus_tag="CNE_2c00550"
                     /note="Type I periplasmic binding domain of
                     uncharacterized extracellular ligand-binding proteins;
                     Region: PBP1_STKc_like; cd06326"
                     /db_xref="CDD:107321"
     misc_feature    order(62824..62832,62893..62901,63040..63042,63196..63198,
                     63268..63270)
                     /locus_tag="CNE_2c00550"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107321"
     gene            63676..64467
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /db_xref="GeneID:10920546"
     CDS             63676..64467
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /EC_number="1.1.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="YP_004680280.1"
                     /db_xref="GI:339321386"
                     /db_xref="GeneID:10920546"
                     /translation="MATPTPSPDSRTPFSLHGRVALVTGGAQGLGLAIAAGLADAGAH
                     VLVVARNAQRVQAAVAALAARGGSAEALVLDITDEAAVAAAFDRIDAAHGRLDILVNN
                     AGARNRSTMAQLDAGDLRAMLETNLVAPYTLCRLAAQRMRRGDYGRIVNVSSIAGQVA
                     RAGDVLYPATKGALDALTRAMAADLGRHGVTVNAIAPGYFATEPNQAMVEDEGVAEWL
                     RQRTSLGRWGQPEEVAGAVVFLASPAASYVTGQVLAVDGGYLGHF"
     misc_feature    63697..64464
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /note="gluconate 5-dehydrogenase; Provisional; Region:
                     PRK06124"
                     /db_xref="CDD:235702"
     misc_feature    63715..64455
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(63748..63750,63754..63759,63763..63765,63820..63828,
                     63979..63987,64129..64137,64174..64176,64186..64188,
                     64264..64275)
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(64051..64053,64135..64137,64174..64176,64186..64188)
                     /gene="gno"
                     /locus_tag="CNE_2c00560"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(64523..65428)
                     /locus_tag="CNE_2c00570"
                     /db_xref="GeneID:10920547"
     CDS             complement(64523..65428)
                     /locus_tag="CNE_2c00570"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680281.1"
                     /db_xref="GI:339321387"
                     /db_xref="GeneID:10920547"
                     /translation="MNLSVKHLRAFVALATYRNFTRAARACHLSQSAFSALVQTLEEQ
                     AGSRLFERTTRHVELSSDGVRFEQTARRLLADFETAFEDLRAHAERRKGRVSIAALPS
                     LAAGDLPPLLAQFRALYPGIALELFDQLADGCIELVRQGRADFALAPAPAQDDDLRVE
                     PLVRDTFHLVCPADHPLARKRRITPEMLAGLPFIQLSRTTSVRQHLDAALHPLRLTSV
                     MEVEHLATVAALVQAGLGVSAVPSLALFQFRREGLAIRPLQLPSLVRDICLVRLKDRG
                     DSAAAAAMIDCLQAFYRGGKPPARR"
     misc_feature    complement(64550..65422)
                     /locus_tag="CNE_2c00570"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(65240..65413)
                     /locus_tag="CNE_2c00570"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(64565..65149)
                     /locus_tag="CNE_2c00570"
                     /note="TThe C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_4; cd08440"
                     /db_xref="CDD:176131"
     misc_feature    complement(order(64730..64735,64739..64744,64760..64777,
                     65045..65065,65069..65071,65081..65083,65090..65095,
                     65099..65104))
                     /locus_tag="CNE_2c00570"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176131"
     gene            65543..66904
                     /locus_tag="CNE_2c00580"
                     /db_xref="GeneID:10920548"
     CDS             65543..66904
                     /locus_tag="CNE_2c00580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680282.1"
                     /db_xref="GI:339321388"
                     /db_xref="GeneID:10920548"
                     /translation="MTAPLLIGSGAGFSGDRTDAALPVVRTLIACGQPAALIFETLAE
                     RTLALAQLARRNDPAQGYEPLLDALLVPVLGLCLQHRIPIVGNFGAANPRAAARRVLQ
                     LAQELGLPAPRVAVVEGDDLSDDAGRARLHGILGDAFEADRFVCANAYIGAQGIAEAI
                     AADAQVVVCGRVADPALAVGPAMAHFGWSWDDWDRLAAATMAGHLLECGAQVTGGYFA
                     DPGMKDVPDVHALGFPIAQLDADGGIEIFKAANTGGCVDLRTVKEQLLYEVHDPAAYL
                     TPDVVADIGAVTVAQLGPDRVAVRNVRGHPRPAQLKANVFSHGGWLAEGEISYAGPNA
                     AARARLAADILCRRMQLLGHDAPIRFDLIGVLSVLADDGGAMFAQRQPHEQAAQDVRL
                     RAALAHDDLAVAQALQREVNALYTCGPAGGGGVRTAQRARLNAVSCLVPREAVTATHS
                     FIA"
     misc_feature    65561..66634
                     /locus_tag="CNE_2c00580"
                     /note="Protein of unknown function (DUF1446); Region:
                     DUF1446; pfam07287"
                     /db_xref="CDD:254140"
     gene            66917..67270
                     /locus_tag="CNE_2c00590"
                     /db_xref="GeneID:10920549"
     CDS             66917..67270
                     /locus_tag="CNE_2c00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680283.1"
                     /db_xref="GI:339321389"
                     /db_xref="GeneID:10920549"
                     /translation="MTDTAALYQFAHGRTGDKGNRSNISVIAYDARNYDHLVTHVTED
                     AVRALFRERRPTSVTRYLVPSLQAMNFVLDGVLDGGVNDALNLDTHGKALSFRLLQLE
                     IPVPPRLASGAADSH"
     gene            67313..68278
                     /locus_tag="CNE_2c00600"
                     /db_xref="GeneID:10920550"
     CDS             67313..68278
                     /locus_tag="CNE_2c00600"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680284.1"
                     /db_xref="GI:339321390"
                     /db_xref="GeneID:10920550"
                     /translation="MYPFLKPLAVAALALILPAGLAWAEFPDKPIRFVVPFAAGSATD
                     QLARAIGQAITVDSKTTVVVDNKPGANGFIAASDVAKAAPDGYTVLISTNTTHAANEH
                     LFKKLPYDPVKDYAPITTLGRGGQIMVVNPQVPAKTVGEFIALAKQQPGKLSFGSGSS
                     SSRIAGELFQQMAHVELLHVPYKSNPLAITDLLGNQIQMMITDTATGLPQVKSGKLRA
                     LGVSGKTRSPLAPDVPTIDEAGVKGYEMSYWFAAYAPAGTPQPVVAKLNAMMVKAARG
                     DTAAGFYKSTGTEVFTSTPAELAKFQLQESGKWGRIIKAANIQPE"
     misc_feature    67451..68266
                     /locus_tag="CNE_2c00600"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            68396..69511
                     /locus_tag="CNE_2c00610"
                     /db_xref="GeneID:10920551"
     CDS             68396..69511
                     /locus_tag="CNE_2c00610"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="YP_004680285.1"
                     /db_xref="GI:339321391"
                     /db_xref="GeneID:10920551"
                     /translation="MPGSAALPLRPTPRQHQPEQEQDMKQQSVVCHATLRPGRRPVLR
                     QAVLRAAIAVTIGAAVLPAIATAQTTTPPAQQKTQVPGYYRMMVGQLEVTALYDGYID
                     LDPKILKYTSAREVQSLLARMFVESTPGMQTAVNAYLIHTGSHLVLVDTGAAACFGPT
                     LGRIGENLRAAGYAPEQIDTVLLTHLHGDHACGLATDGKAAFPNATVYVDKADADYWL
                     SEANAAAAPKEAQGLFAMARAAVAPYQAAQRFRPFSGGAGVEPVPGVRAVPANGHTPG
                     HSGYLFTSGKDSLLLWGDIVHSHAVQFRRPQVAIEFDVDSHQAVITRQRILADAAKGR
                     LWVGGAHMPFPGLGHVRRDVAGYAWVPAEFGPIRNDR"
     misc_feature    68801..69418
                     /locus_tag="CNE_2c00610"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            69609..70373
                     /locus_tag="CNE_2c00620"
                     /db_xref="GeneID:10920552"
     CDS             69609..70373
                     /locus_tag="CNE_2c00620"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_004680286.1"
                     /db_xref="GI:339321392"
                     /db_xref="GeneID:10920552"
                     /translation="MNARASRFDPARRRWLGAGAAALVLAAPLPRAACAQPGPAAGRE
                     AAAQRIGVIGSGRIGGTVGGLWVKAGHPVLFSSRHPEALKPLVEELGTLARAGTVAEA
                     IAFSNVLFLATPYGALPQLSRDHAEAWRGKIVLDATNAYEHRDGPITEEARRDGIGIT
                     TARYLRGARVVRAFNFMGAAQFASEHHRAGGLVAVPIAGDDKAALDVAAQLVRDAGFE
                     PVVVGPLASADRFAPGGPLFRQVGTAEEFRRKMGAR"
     misc_feature    69753..70355
                     /locus_tag="CNE_2c00620"
                     /note="Predicted dinucleotide-binding enzymes [General
                     function prediction only]; Region: COG2085"
                     /db_xref="CDD:224996"
     misc_feature    69753..70025
                     /locus_tag="CNE_2c00620"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; pfam03807"
                     /db_xref="CDD:252177"
     gene            complement(70399..70788)
                     /locus_tag="CNE_2c00630"
                     /db_xref="GeneID:10920553"
     CDS             complement(70399..70788)
                     /locus_tag="CNE_2c00630"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_004680287.1"
                     /db_xref="GI:339321393"
                     /db_xref="GeneID:10920553"
                     /translation="MEIRNLLPDDIEAARQLLIANGWAHRVGGPEKFARLVANSQRVV
                     VAVEHGEIVGFARALCDDVCDGFLSMVAVAPSHRRRGIGRALVRHIVGNDPDITWMLR
                     AARSSEAAFFGQLGFTPSMVAMERRRP"
     misc_feature    complement(70438..70782)
                     /locus_tag="CNE_2c00630"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(<70516..70662)
                     /locus_tag="CNE_2c00630"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(<70432..>70578)
                     /locus_tag="CNE_2c00630"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    complement(order(70537..70542,70570..70578))
                     /locus_tag="CNE_2c00630"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            70976..72463
                     /gene="amn"
                     /locus_tag="CNE_2c00640"
                     /db_xref="GeneID:10920554"
     CDS             70976..72463
                     /gene="amn"
                     /locus_tag="CNE_2c00640"
                     /EC_number="3.2.2.4"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP nucleosidase Amn"
                     /protein_id="YP_004680288.1"
                     /db_xref="GI:339321394"
                     /db_xref="GeneID:10920554"
                     /translation="MASMNAPVFSSAHPADQLAEFTDADAAIARIRDIYEASVGAVRA
                     RFDAFASGKPLPSAAHACYPYLGISVNIETMVTDSRPSWGTVAYPGVYGTTVTRPDLL
                     ADYYRDQIERLMRYHRVPVVVGLSRRPIPLPFVIEASTTDISYTQARELEASFVLPEL
                     SRIDDGIANGTYEPIPGEAWPLSLFPAERVDLALQRLYHYTGTAPQHFQRFVLFTNYQ
                     RYVDEFVELGRGLMASSDGGGYTRFVEPGDVMQELGGAEPDDASRPRALPQMPAYHLV
                     REDKLGVTLVNIGVGPSNAKTMTDHLAVLRPHCWLMVGHCGGLRRSQQLGDYVLAHAY
                     VRDDHVLDHDLPPWVPVPPIAEIQVALQEAVARVTGLSGNEMKTRMRTGTVVSTDDRN
                     WELKSKSLYARFNQSRAIAIDMESAAVAANGFRLRVPYGTLLCVSDKPLHGELKLRGM
                     ANAFYRQRVSQHMTIGLEAIRILRENGVEQLHSRKLRSFDEPAFR"
     misc_feature    71012..72460
                     /gene="amn"
                     /locus_tag="CNE_2c00640"
                     /note="AMP nucleosidase; Provisional; Region: PRK08292"
                     /db_xref="CDD:236222"
     misc_feature    71048..71518
                     /gene="amn"
                     /locus_tag="CNE_2c00640"
                     /note="Bacterial AMP nucleoside phosphorylase N-terminus;
                     Region: AMNp_N; pfam10423"
                     /db_xref="CDD:255979"
     misc_feature    71618..72394
                     /gene="amn"
                     /locus_tag="CNE_2c00640"
                     /note="Nucleoside phosphorylase [Nucleotide transport and
                     metabolism]; Region: Pfs; COG0775"
                     /db_xref="CDD:223846"
     gene            complement(72541..73185)
                     /gene="ompW"
                     /locus_tag="CNE_2c00650"
                     /db_xref="GeneID:10920555"
     CDS             complement(72541..73185)
                     /gene="ompW"
                     /locus_tag="CNE_2c00650"
                     /codon_start=1
                     /transl_table=11
                     /product="porin OmpW family"
                     /protein_id="YP_004680289.1"
                     /db_xref="GI:339321395"
                     /db_xref="GeneID:10920555"
                     /translation="MKTISLRTRVTCSAIAACAMLGAFATPAAAADDAQGNWMVRLRG
                     TYLDMAKSSDPVGGVGPSDRITVNNKWIPEFDVTYFFTPNIAAELVLTVPQKQNVYLD
                     GNKVGTFKHLPPTLLVQYHFIPNGTFRPYIGAGLNFTRIWGENIANNALQLDSWSVGP
                     ALQIGMDYKLTKNWFLNADIKKIWLSSDVKAGDVKVSKVNLDPWLFSMGVGYRF"
     misc_feature    complement(72544..73083)
                     /gene="ompW"
                     /locus_tag="CNE_2c00650"
                     /note="Outer membrane protein W [Cell envelope biogenesis,
                     outer membrane]; Region: OmpW; COG3047"
                     /db_xref="CDD:225589"
     gene            complement(73529..75226)
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /db_xref="GeneID:10920556"
     CDS             complement(73529..75226)
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /EC_number="2.3.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="YP_004680290.1"
                     /db_xref="GI:339321396"
                     /db_xref="GeneID:10920556"
                     /translation="MLSNPATKYQPAATVDIPDRTWPGRTITRAPRWMSTDLRDGNQA
                     LIEPMNPARKLRFFEQLVKIGLKEIEVAFPAASQTDFDFVRMLIEEQRIPDDVNIVVL
                     TQSREDLIRRTVQSVRGAARATVHLYNPIAPAWRRIVFNASREEIKEVAVSGTRLIKA
                     LTDAMPGTAWTYEYSPETFSLAELDFSLEVSDAVSAAWQAGPGRPMILNLPTTVECST
                     PNVFADQIEWMHRRLARREHIALSVHPHNDRGTAVAAAELALMAGADRVEGCLFGNGE
                     RTGNVDLVTLALNLYTQGVAPGLDFSDIDAVRQCVEHCNQLPVHPRHPYVGDLVFTAF
                     SGSHQDAIRKGFAQQQPDSIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQ
                     VHGIYMPRRLQIEFSRAVQAMTDDTGLEASADDLYGLFQREYLAQQTPLRYVSHQLVS
                     DSGGATEIEVQMVRDGKQRSVRGTGNGPIDAFVNALDLPVRVMDYHEHAMTAGADARA
                     ACYVEVRVGDSPTGFGAGIDANLVTASLRAVISGVNRHLQAGFGVAQASQSAEAAEA"
     misc_feature    complement(73583..75226)
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="2-isopropylmalate synthase; Validated; Region:
                     PRK03739"
                     /db_xref="CDD:235154"
     misc_feature    complement(74288..75139)
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="Mycobacterium tuberculosis LeuA3 and related
                     proteins, N-terminal catalytic TIM barrel domain; Region:
                     DRE_TIM_LeuA; cd07942"
                     /db_xref="CDD:163680"
     misc_feature    complement(order(74489..74491,74495..74497,74588..74590,
                     74594..74596,74696..74698,75017..75019,75107..75112))
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="active site"
                     /db_xref="CDD:163680"
     misc_feature    complement(order(75017..75019,75107..75112))
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163680"
     misc_feature    complement(order(74489..74491,74495..74497,75107..75109))
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163680"
     misc_feature    complement(73592..73969)
                     /gene="leuA1"
                     /locus_tag="CNE_2c00660"
                     /note="LeuA allosteric (dimerisation) domain; Region:
                     LeuA_dimer; smart00917"
                     /db_xref="CDD:214910"
     gene            75863..77179
                     /locus_tag="CNE_2c00670"
                     /db_xref="GeneID:10920557"
     CDS             75863..77179
                     /locus_tag="CNE_2c00670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680291.1"
                     /db_xref="GI:339321397"
                     /db_xref="GeneID:10920557"
                     /translation="MTLLLAACGGGGGGSGTPTTPNAGGTTPLTYTVKMSVTSGEVGV
                     GRTITISALAVDSNGIDVSGNTTFNWTSTDSGIATVEPSATTPGSAVVKGIATGTTTV
                     QVVASVKGADNTTVQLPAQSATITVVPASALSYSLSIPNSSLSMSDGQTLPVRVSLVD
                     SNGADVSASVNSWAWSSSGTAVQVTASQNSATLKASNSSPTAVATASVSVSVTAPDGH
                     AIAGVIAVTVQKNGAAAYRVVTTKGGREVNALQVFSNRPETFTSRVLRHDGQDVTADF
                     DGAWTYNATSATLSASEAAGTHDATVSTSLASDKGPVQSSLTVTAVSTRLGERRSATL
                     TVTENPVWALVGDNQDPMTLLLMPPTTVEVTARMKHLGDDAQYTACNNWAWDKTGPVT
                     LSPSMVMLPNQVRAAGTAAGDFTITATCTAAADNTPLKLVFYGTVK"
     gene            complement(77569..77886)
                     /locus_tag="CNE_2c00680"
                     /db_xref="GeneID:10920558"
     CDS             complement(77569..77886)
                     /locus_tag="CNE_2c00680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680292.1"
                     /db_xref="GI:339321398"
                     /db_xref="GeneID:10920558"
                     /translation="MSLYHAIETLLVPLIVLACAVQVIARYAPRTRERVKAALAARLG
                     GSAAAGWRARLARWLAPQAAAGCASGCDDGGCNTCGSNTANTTSGAQGQTAEQVVRFV
                     RKR"
     gene            complement(77901..79757)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /db_xref="GeneID:10920559"
     CDS             complement(77901..79757)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein B"
                     /protein_id="YP_004680293.1"
                     /db_xref="GI:339321399"
                     /db_xref="GeneID:10920559"
                     /translation="MSAAPSTSALRIALVGNPNCGKTALFNRLTGSRQKVANYAGVTV
                     ERKEGYFVSPAGRQVRILDLPGAYSLHAASLDEAITRDVCLGMRAGEQRPDLLVSVVD
                     ATNLRLHLRFVLELRRLGLPMVVVLNMSDAAARRGIRIDRDKLSAALGVPVVSTVAVK
                     HDGAAALVSLLDDTLPPAPPATPEPANDIDVHAEVNRLLAAAVSMPARTAALDDRLDR
                     IVLHPVIGLLLLAVLLFLMFQAVFSWAQPLMDGIEGGVHWAGEMLGAHLPDGMLKSLL
                     VDGLIAGLGSVVVFLPQILILFLFILTLEESGYLPRAAFLLDRLMMGAGLSGRSFIPL
                     LSSFACAIPGIMATRTIQDPRDRLTTILVAPLMTCSARLPVYALLIGAFIPERTVMGL
                     FNLQGLVLFALYVAGIVSALVVAYALKFFRRDRTDHPLLMELPSYRIPNPRDVAIGLW
                     ERARIFLSRVGKVILALTVLLWFLSTFPSAPVGATAPAIDYSFAGMIGHALQKVFAPV
                     GFNWQICIALVPGLAAREVAVGALATVYALSGSEEAVATQLAPMISAQWSLATALSLL
                     AWYVFAPQCISTLAVIRRETDSWKVMALSAAYLTGLAYLAAFVTYRVALMFS"
     misc_feature    complement(77907..79739)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Fe2+ transport system protein B [Inorganic ion
                     transport and metabolism]; Region: FeoB; COG0370"
                     /db_xref="CDD:223447"
     misc_feature    complement(79233..79721)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    complement(79689..79712)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(order(79281..79289,79365..79367,79371..79376,
                     79686..79697,79701..79703))
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    complement(79620..79634)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(79629..79631)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(79560..79571)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(order(79476..79481,79506..79562))
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(79365..79376)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(79281..79289)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(78618..78845)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     misc_feature    complement(78402..78563)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:254341"
     misc_feature    complement(78000..78383)
                     /gene="feoB"
                     /locus_tag="CNE_2c00690"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     gene            complement(79773..80090)
                     /gene="feoA"
                     /locus_tag="CNE_2c00700"
                     /db_xref="GeneID:10920560"
     CDS             complement(79773..80090)
                     /gene="feoA"
                     /locus_tag="CNE_2c00700"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein A"
                     /protein_id="YP_004680294.1"
                     /db_xref="GI:339321400"
                     /db_xref="GeneID:10920560"
                     /translation="MMRLSELPRRTPAVVQSVDDATPGDPVARRLRELGFVPGEAVQI
                     IAYGPFGMDPLVAQVGFTRFALRRSEASRIGVEVASASVTSIAPATQGGDQTAKPSAK
                     RTA"
     misc_feature    complement(79857..80087)
                     /gene="feoA"
                     /locus_tag="CNE_2c00700"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:252322"
     gene            complement(80561..81481)
                     /locus_tag="CNE_2c00710"
                     /db_xref="GeneID:10920561"
     CDS             complement(80561..81481)
                     /locus_tag="CNE_2c00710"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680295.1"
                     /db_xref="GI:339321401"
                     /db_xref="GeneID:10920561"
                     /translation="MEFRHLRYFLVLAEELHFGRAARRLAISQPPLSLNIQQLEASVG
                     ARLFDRDSRGVRLTAAGRAFRESAMALLAQAEAARVLAREIEAGAVGRLRVGFVGSML
                     YRGLPQTLRGFQAAYPGIQVALTELNSQEQIDALLHDELDAAFIHTGRVPDTLQATLV
                     HSEPFVCCLPADHALAALPELPLAALRGEPFVLFSRKASPDYYSRIFDMCAAQGFYPQ
                     IRHEVRHWLSVVSLVSQGMGVAVVPAALARSGMAGAAFRPLADAAVRSEVYCAWKTAP
                     DHPARDHFVGMVREMTAAAQGSHKEKATGR"
     misc_feature    complement(81296..81475)
                     /locus_tag="CNE_2c00710"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(80621..81472)
                     /locus_tag="CNE_2c00710"
                     /note="DNA-binding transcriptional activator XapR;
                     Provisional; Region: PRK09986"
                     /db_xref="CDD:182183"
     misc_feature    complement(80618..81208)
                     /locus_tag="CNE_2c00710"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     similar to regulators involved in the catabolism of
                     aromatic compounds, contains type 2 periplasmic binding
                     fold; Region: PBP2_LTTR_aromatics_like_2; cd08448"
                     /db_xref="CDD:176139"
     misc_feature    complement(order(80723..80725,80777..80782,80786..80791,
                     80807..80812,80867..80872,80972..80974,81104..81106,
                     81110..81112,81116..81118,81140..81142,81149..81154,
                     81158..81163,81170..81172,81191..81193))
                     /locus_tag="CNE_2c00710"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176139"
     misc_feature    complement(order(80876..80878,80897..80902,81041..81043,
                     81188..81190))
                     /locus_tag="CNE_2c00710"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176139"
     gene            81602..83482
                     /gene="aidB"
                     /locus_tag="CNE_2c00720"
                     /db_xref="GeneID:10920562"
     CDS             81602..83482
                     /gene="aidB"
                     /locus_tag="CNE_2c00720"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase AidB"
                     /protein_id="YP_004680296.1"
                     /db_xref="GI:339321402"
                     /db_xref="GeneID:10920562"
                     /translation="MPSSAVRDTTLQAHSTAPAAAHPVPDRQGGSLFAADPDLRALLP
                     LYLPPDLFNHLLPHLERMGALAGGVLDELAGVADRHPPELTYRTRAGVDAQRIDKHPA
                     YVEMERVAFAEFGLAAASHRGGVLGWDKPMPPAAKYALTYLFVQAEFGLCCPLSMTDS
                     LTRTLRKFGDPALVERFLPNLTTQVFDDLYQGAMFMTEQGAGSDVAATATRAVRDASA
                     EGGWRLQGDKWFCSNPDATLAMVLARVEDEAGNAVPGHKGVSLFLLPRKLADGSDNHY
                     RIIRLKDKLGTRSMASGEIRLEGAHAWLVGEPGRGFVQMADMINNSRLSNGVRAAGLM
                     RRALTEGLFIARERQAFGKRLQDMPLMRRQLLKLTLPTEQARTMVFQTAEALRRADAG
                     EADAYPLMRILTPLIKFRACRDARKVTGDAMEIRGGCGYIEEWSDPRLVRDAHLGSIW
                     EGTSNIVALDVLRAVRREGALPVLQAHLAGLLADTPMHAAARAVFEGAIAAAAKLAAQ
                     AAEAGADGELLARQAASALYHVTSAVAMAWEAGLSARCAACGWRSWCCAIACCRRIRL
                     QRRPSPSGWPRPSRRLTAPCMPLARSTRSTCSNRIHVRQPSSATPSRHQRETSYTQET
                     TP"
     misc_feature    81770..83002
                     /gene="aidB"
                     /locus_tag="CNE_2c00720"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(82079..82081,82181..82183,82187..82189,82289..82291,
                     82295..82297,82946..82954,82958..82960,82964..82966)
                     /gene="aidB"
                     /locus_tag="CNE_2c00720"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            83479..84453
                     /gene="bugT1"
                     /locus_tag="CNE_2c00730"
                     /db_xref="GeneID:10920563"
     CDS             83479..84453
                     /gene="bugT1"
                     /locus_tag="CNE_2c00730"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004680297.1"
                     /db_xref="GI:339321403"
                     /db_xref="GeneID:10920563"
                     /translation="MKLWHRVAAIAACSLCIAPAFAQKDFPSKPIMMVVTYPPGGPTD
                     AMARTLAAALKTSLGQPVVVENRAGAGGNIGAEVVARAEPDGYTLMFGTSAPLAINVS
                     LYRKINYDPVKSFAPVIQIGQLPNVLVVNPSVPAKNVTELIAYGKAHPGKLTYASSGN
                     GASSHLAGVLFNNVTGTDFQHIPYKGTGPALNDLLGGQVSMTFTDVLTAMPFIKSGKV
                     RALGVTTKARSQALPDVPTVAEQGVPGFDVSVFFGVVAPAGTPPEVIGKLNRAFADAL
                     KQPEVRKTLQAQGLEFAPSTTPEQLGGFVKAEVGKWRAVVQKSGAQLD"
     misc_feature    83614..84441
                     /gene="bugT1"
                     /locus_tag="CNE_2c00730"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            84474..85595
                     /locus_tag="CNE_2c00740"
                     /db_xref="GeneID:10920564"
     CDS             84474..85595
                     /locus_tag="CNE_2c00740"
                     /EC_number="5.1.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA transferase/carnitine dehydratase"
                     /protein_id="YP_004680298.1"
                     /db_xref="GI:339321404"
                     /db_xref="GeneID:10920564"
                     /translation="MTQTSPGALAGIRVVDLSRILGGPYCGQILGDHGADVLKIEPPQ
                     GDDTRTWGPPFKDGVASYYFGLNRNKRVMRLDLTADADREVLLVLLAEADVLVENFKT
                     GTMEKWGLGYDTLSARFPRLVHCRVSGFGADGPLGGLPGYDAAIQAMSGIMSINGEAD
                     GDPLRVGLPVVDMVTGLNAVIGVLLALQERARSGRGQFVEAALYDSGLSLLHPHAANW
                     FMSGKTPQRTGNAHPNIYPYDTVATATDPIFLAVGNDRQFRILCEHLRLPALADDERY
                     GTAGARSVNRVALKAELEARLREFDGKVLADELVAAGVPCAPVLSVADALQHPHTQHR
                     EMVVEMEGGYQGLGAPVKLSRTPATYRYAPLTEGDEFLD"
     misc_feature    84483..85565
                     /locus_tag="CNE_2c00740"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(85670..87370)
                     /gene="glcA1"
                     /locus_tag="CNE_2c00750"
                     /db_xref="GeneID:10920565"
     CDS             complement(85670..87370)
                     /gene="glcA1"
                     /locus_tag="CNE_2c00750"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate permease GlcA"
                     /protein_id="YP_004680299.1"
                     /db_xref="GI:339321405"
                     /db_xref="GeneID:10920565"
                     /translation="MQPWTQLYTPLGSLWLSSLAAAIPILFFFIALAVWRMKGHVAAA
                     VTLLLALAVAIFAYGMPAQQALASAGFGFAYGLWPIAWIIVTAVFLYKIVVKTGQFDV
                     IRASVLSITDDQRLQMLLIGFAFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLC
                     LIANTAPVAFGAMGIPIIVAGQVTGIDPFHIGAMAGRQLPLLSLLVPFWLVFMMDGAK
                     GVRETWPAALVCGGCFAVTQYFTSNHIGPELPDITSALVSLVSLAAFLKVWQPRGASQ
                     RAGGNVSGGTVALAGFGGGFGGAMSGRKASPYTLAQTLRAWAPFGILTAIVTVWSLQP
                     FKALFAANGALAGTVLKFKIPGLDQMVIKAAPIVATPKAYDAVLKLDLLSAVGTAILL
                     TALISAVLLRMKPRMLLATFAETLVELARPVLSIGLVLAFAFVANYSGMSSTLALLLA
                     GTGAAFPFFSPFLGWLGVFLTGSDTSSNALFCALQNTTAHQIGVSDTLLVAANTTGGV
                     TAKMISPQSIAVACAATGLVGKESELFRFTVRHSLLFAVIIGIMTVVQAYLLPGMIPG
                     "
     misc_feature    complement(85676..87370)
                     /gene="glcA1"
                     /locus_tag="CNE_2c00750"
                     /note="L-lactate permease; Region: Lactate_perm; cl00701"
                     /db_xref="CDD:260580"
     gene            complement(87438..88883)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /db_xref="GeneID:10920566"
     CDS             complement(87438..88883)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /codon_start=1
                     /transl_table=11
                     /product="lactate utilization protein LutB"
                     /protein_id="YP_004680300.1"
                     /db_xref="GI:339321406"
                     /db_xref="GeneID:10920566"
                     /translation="MSQHTLNFVPPQDFKARAREALDDPKLRQSFRGAMDFLQGKRLA
                     QFPDADELERLRDLGEAVRQHALANLPDLLVQLEAKLTAAGVQVHWAENADEANAIIH
                     RIAASKQAQRVIKGKSMASEEIELNHYLAERGVDCIESDMGEYIVQLAGEKPSHIVMP
                     AIHKTKGDIAQLFQAHIPDTPYTEDVDALIQTGRRALRQAFVEADIGLSGVNFAAADT
                     GTLWLVENEGNGRLSTTVPDVHIAIMGMEKVVARLEHIVPLSTLLTRSATGQAITTYF
                     NLISGPRRAGERDGPREVHLVLLDNGRTQAYADTQLRATLQCIRCGACMNHCPVYTRI
                     GGHAYGTTYPGPIGKIISPHLLGLDATADLATASSLCGACGEVCPVRIPIPQLLVRLR
                     TEANRDPEEQVANPLRGQGAKYSRGEHLVWRFWSGAYSHPATYRLFRWAATRLRALTP
                     SKQMGWTQHRTPLKPAAKSLADLLKEKGQPE"
     misc_feature    complement(87477..88859)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /note="Uncharacterized conserved protein containing a
                     ferredoxin-like domain [Energy production and conversion];
                     Region: COG1139"
                     /db_xref="CDD:224062"
     misc_feature    complement(87987..88664)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; pfam02589"
                     /db_xref="CDD:251397"
     misc_feature    complement(87738..87938)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    complement(87441..87716)
                     /gene="lutB"
                     /locus_tag="CNE_2c00760"
                     /note="Domain of unknown function (DUF3390); Region:
                     DUF3390; pfam11870"
                     /db_xref="CDD:256687"
     gene            complement(88880..89581)
                     /locus_tag="CNE_2c00770"
                     /db_xref="GeneID:10920567"
     CDS             complement(88880..89581)
                     /locus_tag="CNE_2c00770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680301.1"
                     /db_xref="GI:339321407"
                     /db_xref="GeneID:10920567"
                     /translation="MSTPGARERMLGRLRAAAPAPSPRTAELDRRIDGHFEARRHGAP
                     AIGELTGAMLAALQGLHAEVWCASEAAWPALLATELANAGVKRLLLDPASQAGAALAA
                     ALPAHIEAIGYDRPIEAWKAELFDTIDAGFTVARSGIAATGTLVVAPDAGSPRTVSLV
                     PPLHVALVRASTLHTDLHMAARTERWSDGMPTNLVLISGPSKTSDIQQTLAYGAHGPR
                     RLWVIIETDTAEAGQ"
     misc_feature    complement(88898..>89404)
                     /locus_tag="CNE_2c00770"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; cl00674"
                     /db_xref="CDD:260565"
     gene            complement(89578..90360)
                     /gene="lutA"
                     /locus_tag="CNE_2c00780"
                     /db_xref="GeneID:10920568"
     CDS             complement(89578..90360)
                     /gene="lutA"
                     /locus_tag="CNE_2c00780"
                     /codon_start=1
                     /transl_table=11
                     /product="lactate utilization protein LutA"
                     /protein_id="YP_004680302.1"
                     /db_xref="GI:339321408"
                     /db_xref="GeneID:10920568"
                     /translation="MMDRQYPTGPAPAQAYLFATCLVDMFVPQAGLDAVRLLEREGLT
                     VHFPRGQSCCGQPAYSSGNPDAARAVARAQLDLFSQPWPVIVPSGSCAGMMRHHWPQL
                     FADDPVAGPKALELAGRIYELGEFLLHVLKLDFGDAAPAGQPQERIVLHTSCGARREM
                     GTRQHGVALVDTLPGVTRVEHERESECCGFGGTFSLKHPDISGAMVRDKVASACATGC
                     DRLVSADCGCLLNIGHTAAHDHAPLQVEHLATFLWRRTGGAA"
     misc_feature    complement(89605..>90345)
                     /gene="lutA"
                     /locus_tag="CNE_2c00780"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    complement(90073..90312)
                     /gene="lutA"
                     /locus_tag="CNE_2c00780"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    complement(89662..89919)
                     /gene="lutA"
                     /locus_tag="CNE_2c00780"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            90487..91212
                     /locus_tag="CNE_2c00790"
                     /db_xref="GeneID:10920569"
     CDS             90487..91212
                     /locus_tag="CNE_2c00790"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680303.1"
                     /db_xref="GI:339321409"
                     /db_xref="GeneID:10920569"
                     /translation="MTAAAARHGRTRGRVESVMRRIETALLDGTWPPGTRLPAERVLA
                     GQYEVARNTVREAIQRLAARGLLQSRRGAGVYATDQLRAGIASPWGQLVADHPALRDD
                     ILEFRRVLEGATAYFAALRADAADVKRIRALMAELERARAADDKQAEADADAQLHDAI
                     AQASHNTMFLHLHTSVIGMLREHITINGTGLREQDDGASDLLLLQHRTLCDAICARRP
                     EEARTAMQTHIDFVRSRVEQDGA"
     misc_feature    90499..91209
                     /locus_tag="CNE_2c00790"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    90526..90714
                     /locus_tag="CNE_2c00790"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(90529..90531,90598..90600,90604..90609,90631..90645,
                     90649..90654,90661..90663,90691..90696,90700..90711)
                     /locus_tag="CNE_2c00790"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    90790..91176
                     /locus_tag="CNE_2c00790"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(91259..92296)
                     /locus_tag="CNE_2c00800"
                     /db_xref="GeneID:10920570"
     CDS             complement(91259..92296)
                     /locus_tag="CNE_2c00800"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_004680304.1"
                     /db_xref="GI:339321410"
                     /db_xref="GeneID:10920570"
                     /translation="MKDPDPTTTPRLLPAAWYSVGTVAYLLTALALWTVLHANLVAAL
                     LSGLLLYSLVDVLAPRLKRLNQRHDALAVAILSALILLALTLAGWLLVRFVSGEGNTL
                     DGLLNHVADIIDRSRGQMPPWLSDALPNGVDELANTLIETLREHAAMAQKLGAEVLRT
                     LVHILIGLVIGAMVALYRAVVRPNRRPLAAALVARARTLQQAFSQFIFAQIQISTINT
                     VLTAIYLLLVLPLFGVHLPLTKTLLVITFVAGLLPVLGNLISNTAIVVASLSVSLPIA
                     VASLVFLVVIHKLEYFLNARIIGARIQAAAWELLTVMLLMETLFGIPGVIAGPIFYAY
                     LKRELAGAGLI"
     misc_feature    complement(91289..>92035)
                     /locus_tag="CNE_2c00800"
                     /note="Domain of unknown function DUF20; Region: UPF0118;
                     cl00465"
                     /db_xref="CDD:260441"
     gene            92500..93882
                     /gene="eutB"
                     /locus_tag="CNE_2c00810"
                     /db_xref="GeneID:10920571"
     CDS             92500..93882
                     /gene="eutB"
                     /locus_tag="CNE_2c00810"
                     /EC_number="4.3.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia-lyase heavy chain"
                     /protein_id="YP_004680305.1"
                     /db_xref="GI:339321411"
                     /db_xref="GeneID:10920571"
                     /translation="MAYTHTIGTHRHVFADLRTLLARASPARSGDALAGVAAASEQER
                     MAARLALAEVPLKQFLTEALVPYEDDEVTRLILDRHDGAAFAAIGATTVGDLRNWLLL
                     HETDSATLARVAPGITPEMAAAVSKLMRNQDLVAVARKCQVVTRFRSTVGLPGRLSVR
                     LQPNHPTDDPKGIAASIIDGLLYGCGDATIGVNPASDNLGAIVSLLRMIDELRSRFDI
                     PTQSCVLTHVTNTLRAIGQGAPVDLVFQSVAGSERANAAFGISLSLLAEAHDAAQALA
                     RGTVGDNLMYFETGQGSALSANAHHGVDQQTMEARAYAVARAFSPLLVNTVVGFIGPE
                     YLYDGKQIIRAGLEDHFCGKLMGVPMGCDVCYTNHAEADQDDMDTLLTLFGVAGINFI
                     MGVPGADDIMLNYQSTSFHDALYLREVLGLRPAPEFEAWLQRMGIADASGRLLEPAAR
                     QPLLQMAHSL"
     misc_feature    92500..93879
                     /gene="eutB"
                     /locus_tag="CNE_2c00810"
                     /note="ethanolamine ammonia lyase large subunit;
                     Provisional; Region: PRK15067"
                     /db_xref="CDD:237897"
     gene            93893..94678
                     /gene="eutC"
                     /locus_tag="CNE_2c00820"
                     /db_xref="GeneID:10920572"
     CDS             93893..94678
                     /gene="eutC"
                     /locus_tag="CNE_2c00820"
                     /EC_number="4.3.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia-lyase light chain"
                     /protein_id="YP_004680306.1"
                     /db_xref="GI:339321412"
                     /db_xref="GeneID:10920572"
                     /translation="MTARRPPPAAPANADADPWQRLRQFTRARVALGRTGHSQTTDAV
                     LAFGLAHAQARDAVHLPLDVGAVTAALDAAGVQNLAVHSAAPDRAHYLRRPDLGRRLD
                     DASRARLAAARPGDAPDVVFVVADGLSALATQTHALPLLDATRARLPQTWRIGPVVVA
                     EQSRVALGDEIGELLGARQVVMLIGERPGLSSPDSLGIYLTHAPRTGRTDAERNCISN
                     VRPEGLPYAQAADRLAFLLRGAAALGRSGVDLKDDSVPALPEG"
     misc_feature    93947..94675
                     /gene="eutC"
                     /locus_tag="CNE_2c00820"
                     /note="ethanolamine ammonia-lyase small subunit;
                     Provisional; Region: PRK05465"
                     /db_xref="CDD:235482"
     gene            complement(94775..95248)
                     /locus_tag="CNE_2c00830"
                     /db_xref="GeneID:10920573"
     CDS             complement(94775..95248)
                     /locus_tag="CNE_2c00830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680307.1"
                     /db_xref="GI:339321413"
                     /db_xref="GeneID:10920573"
                     /translation="MALASTLASCLSSKNTQYDIIRHPYTLSSMATAEAAHVPGDRLA
                     KTLLLEDDRGYVAAVIPSSHHLHMAAICEQTGRNLVLAHEDEIREIFKDCDLGAIPPV
                     AMAYGMQTYVDDSLMAQPDVYFEGGDHQELVHMSGEQFSRLMSDAGHGQFSRRMM"
     misc_feature    complement(94799..95200)
                     /locus_tag="CNE_2c00830"
                     /note="YbaK-like.  The YbaK family of deacylase domains
                     includes the INS amino acid-editing domain of  the
                     bacterial class II prolyl tRNA synthetase (ProRS), and
                     it's trans-acting homologs, YbaK, ProX, and PrdX.  The
                     primary function of INS is to hydrolyze...; Region:
                     YbaK_like; cd04332"
                     /db_xref="CDD:239824"
     misc_feature    complement(order(94874..94876,94955..94960,95114..95116))
                     /locus_tag="CNE_2c00830"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239824"
     gene            complement(95705..96841)
                     /locus_tag="CNE_2c00840"
                     /db_xref="GeneID:10920574"
     CDS             complement(95705..96841)
                     /locus_tag="CNE_2c00840"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902"
                     /protein_id="YP_004680308.1"
                     /db_xref="GI:339321414"
                     /db_xref="GeneID:10920574"
                     /translation="MNAPDTALQGQDRAVIGRLYMAFELGEKSWKLSLGDGVRGPSRY
                     TVAAGDKDAVLRAIAKAKARCGLTSQVPVRSCYEAGRDGFWLHRWLTEQGIDNLVVDS
                     SSIEVNRRARRAKTDRLDGDKLLSMLLRYHAGERRVWGVARVPTPEQEDERRLHRELG
                     RLRQERTALSNRIRSLLVLHNLRVAHVGGRSWAHWWNDHGAQLPVGLRAEIERSVARL
                     SLAVTQIRTIEAQQHATVKTGAQPAIALLARLRGIGVGSAWILVKELFGWRNFHNRRE
                     VASSLGLAPTPYSSGESQVEQGISKAGNKRARWLMIELAWSWLRYQPASQLTQWFNER
                     FAPGGKRMRRIGIVALARRLAIGLWRYLEYGEIPVQASFKPVAT"
     misc_feature    complement(95756..96691)
                     /locus_tag="CNE_2c00840"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(96326..>96637)
                     /locus_tag="CNE_2c00840"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(95864..96109)
                     /locus_tag="CNE_2c00840"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(96923..97858)
                     /locus_tag="CNE_2c00850"
                     /db_xref="GeneID:10920575"
     CDS             complement(96923..97858)
                     /locus_tag="CNE_2c00850"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680309.1"
                     /db_xref="GI:339321415"
                     /db_xref="GeneID:10920575"
                     /translation="MDLNALRLFVDIVDAGNLSAAARKLKMTRANVSYRLKALEEELG
                     VQLLRRTTRHVEPTPVGAGLYEHGRNILGEVAAANALISNMGKSLQGHVRLSVPTGLG
                     HTLLSPLLVLFKQRYPDITLDVMFDNRVHNLVSEDVDVALRIISTPPDSVVATEIGEV
                     DWIVCASPGYLAAHPAPKTLTGLQGHAMVCASPVGQKLKASGTRLDADEGHDANETRE
                     QVVLEPTLTSENFAFLKESVLAGLGIGILPIYAIGAELDSGALVPLLCDYRISVFGSK
                     LYMLTMPNRYQTLATRYLLNFLKTELQAVWPRLHR"
     misc_feature    complement(96935..97858)
                     /locus_tag="CNE_2c00850"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(97676..97852)
                     /locus_tag="CNE_2c00850"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(96965..97588)
                     /locus_tag="CNE_2c00850"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(97028..97030,97115..97117,97166..97168,
                     97379..97381,97385..97387,97427..97429,97544..97546,
                     97556..97558))
                     /locus_tag="CNE_2c00850"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(97139..97141,97148..97153,97172..97186,
                     97298..97300,97481..97501,97505..97507,97517..97519,
                     97526..97531,97535..97540,97550..97555))
                     /locus_tag="CNE_2c00850"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(97951..99264)
                     /gene="kgtP"
                     /locus_tag="CNE_2c00860"
                     /db_xref="GeneID:10920576"
     CDS             complement(97951..99264)
                     /gene="kgtP"
                     /locus_tag="CNE_2c00860"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate permease KgtP"
                     /protein_id="YP_004680310.1"
                     /db_xref="GI:339321416"
                     /db_xref="GeneID:10920576"
                     /translation="MTDLPATLAQTAAPSREEVRKRIYAIVAASSGNLVEWFDFYVYA
                     FCAIYFAPSFFPKSDPTAQLLNTAGVFAAGFLMRPIGGWLFGTIADRHGRKNSMLISV
                     IMMCAGSLLIACLPTYASIGNWAPALLLLARLIQGLSVGGEYGTTATYMSEVALRGRR
                     GFFSSFQYVTLIGGQLLAVLVVVILQQLLDEAELKAWGWRIPFVVGAVTAVVALFLRR
                     TLHETSSAATRGSKEAGSVAALFRNHKAAFFTVLGYTAGGSLIFYTFTTYMQKYLVNT
                     AGMSIKTASYVMTGCLFLYMCMQPVFGALSDRIGRRTNMLLFGALGALCTVPILTALG
                     KVSSPELAFVLIAVALAIVSFYTSISGIVKAEMFPPEVRALGVGLAYAIANAIFGGSA
                     EYVALGMKTLGHETAFYWYVTAMMVIAFFVSLRLPRQAKYLHHEH"
     misc_feature    complement(97972..99264)
                     /gene="kgtP"
                     /locus_tag="CNE_2c00860"
                     /note="alpha-ketoglutarate transporter; Provisional;
                     Region: PRK10406"
                     /db_xref="CDD:182433"
     misc_feature    complement(97984..99189)
                     /gene="kgtP"
                     /locus_tag="CNE_2c00860"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(98101..98103,98110..98115,98122..98127,
                     98134..98139,98170..98172,98179..98184,98194..98196,
                     98203..98208,98215..98217,98368..98370,98380..98382,
                     98389..98391,98401..98403,98413..98415,98455..98457,
                     98464..98469,98476..98481,98488..98490,98740..98742,
                     98758..98763,98770..98775,98809..98811,98818..98823,
                     98830..98835,98842..98847,99007..99012,99016..99021,
                     99031..99033,99040..99045,99052..99054,99121..99126,
                     99130..99138,99145..99147))
                     /gene="kgtP"
                     /locus_tag="CNE_2c00860"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            99664..100029
                     /locus_tag="CNE_2c00870"
                     /db_xref="GeneID:10920577"
     CDS             99664..100029
                     /locus_tag="CNE_2c00870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680311.1"
                     /db_xref="GI:339321417"
                     /db_xref="GeneID:10920577"
                     /translation="MMRAGPSTGLLRPPFAMHRSLRRWLCLPLLFAAASAPAQDLVEC
                     KRIEHDQLITASQETLLFLRCRARRVAYEAPRLKGVSQRVKDDLVFACLDQADAVEHQ
                     LRVRHGYSREALARLRCEL"
     gene            complement(100076..100825)
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /db_xref="GeneID:10920578"
     CDS             complement(100076..100825)
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004680312.1"
                     /db_xref="GI:339321418"
                     /db_xref="GeneID:10920578"
                     /translation="MTSTPAISRRAALVTGASRGIGRAIALRLAADGFDVAIGYAGNA
                     ARAEATVAAARESGVNAIAIQGDVAQASDVARLFDAAQQAFGRLDVVVNSAGIMQMAP
                     VAPASLDAFDQTIATNLRGAFLVLGEAAARLGEGGRIIALSTSVIARSFPGYGPYIAA
                     KAGVEGLVRVLASELRGRGITVNAVAPGPVATELFLDGKSEAQVAQLSKVAPLERLGT
                     PEDIAAAVSFLAGPDGAWVNAQVVRVNGGFA"
     misc_feature    complement(100079..100813)
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK12937"
                     /db_xref="CDD:171821"
     misc_feature    complement(100082..100798)
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(100256..100267,100343..100345,
                     100355..100357,100394..100402,100538..100546,
                     100700..100708,100763..100765,100769..100774,
                     100778..100780))
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(100343..100345,100355..100357,
                     100394..100396,100472..100474))
                     /gene="fabG1"
                     /locus_tag="CNE_2c00880"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            101088..101858
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /db_xref="GeneID:10920579"
     CDS             101088..101858
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /EC_number="1.18.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase Fpr"
                     /protein_id="YP_004680313.1"
                     /db_xref="GI:339321419"
                     /db_xref="GeneID:10920579"
                     /translation="MSNLNQQSILSVHHWTDTLFSFTCTRDPGFRFENGQFAMVGLEV
                     NGRPLLRAYSIASANYEETLEFFSIKVPDGPLTSRLQHLREGDQIFVGKKPTGTLLVD
                     NLLPGKTLWLLATGTGLAPFLSIIRDPEVYERYDKVVLTHTCRFVEELAYRELIQEHL
                     PQHEHLGDLVREKLVYFPTVTREEFDNRGRITDLIASGELFERLGVEPFSLENDRIML
                     CGSPDMLKDVRGILEARGFAEGNMSHPGHFVLEKAFVG"
     misc_feature    101088..101849
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
                     family 1 [Energy production and conversion]; Region: Hmp;
                     COG1018"
                     /db_xref="CDD:223949"
     misc_feature    101112..101846
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    order(101196..101198,101238..101249,101286..101288,
                     101292..101294,101298..101300,101307..101309,
                     101313..101318,101436..101438,101844..101846)
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    order(101238..101240,101244..101249)
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    order(101307..101309,101316..101318,101325..101327,
                     101343..101345,101370..101372,101376..101378)
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    order(101421..101423,101433..101444,101448..101450)
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    order(101436..101441,101514..101522,101745..101750)
                     /gene="fpr"
                     /locus_tag="CNE_2c00890"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            complement(101920..103326)
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /db_xref="GeneID:10920580"
     CDS             complement(101920..103326)
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase class II"
                     /protein_id="YP_004680314.1"
                     /db_xref="GI:339321420"
                     /db_xref="GeneID:10920580"
                     /translation="MSAPSTSATRIEKDSLGDVPVPADHLWGAQTERSRQNFRIGNEK
                     MPPALIEAFAILKLCAARANGELGVLKPELAHAIEQAATEVIEGRWPDEFPLSVWQTG
                     SGTQTNMNLNEVIANRAIQLLGGKVGSKTPVHPNDHVNASQSSNDSFPTAMHIAATRA
                     IQQELLPALEQLQQTFARKVEAFADIVKVGRTHLQDAVPLTLGQEFSGYMTQVADAQS
                     RLQQAMLRAMPVAQGGTAVGTGLNAPHGFAAAFARALADYTGLPFEPAPNRYALQASH
                     DALADLSGALSTTASSFLKIARDFMLLGSGPRAGFAELVLPANEPGSSIMPGKVNPTQ
                     AEALAMVCCRVIGNHTTVTLANGLGTLELNAYKPVIIYSLLQSVSLLAGAASSFAEHM
                     VEGVEADRERIAELLERSLMPVTALNPHIGYDKAAEIAKLAVKRNLSLREAAIASGHV
                     TEAQFAEWIDLKGMTREV"
     misc_feature    complement(101929..103311)
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /note="fumarate hydratase; Reviewed; Region: fumC;
                     PRK00485"
                     /db_xref="CDD:234779"
     misc_feature    complement(101935..103299)
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /note="Class II fumarases; Region: Fumarase_classII;
                     cd01362"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(102319..102321,102334..102336,
                     102340..102342,102748..102750,102889..102897,
                     102916..102927,102934..102936,103012..103014,
                     103018..103020))
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /note="active site"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(102082..102084,102241..102249,
                     102256..102258,102280..102282,102430..102435,
                     102442..102447,102451..102456,102463..102468,
                     102475..102477,102484..102489,102496..102498,
                     102502..102507,102514..102516,102523..102528,
                     102616..102618,102670..102672,102682..102684,
                     102694..102696,102712..102717,102733..102735,
                     102745..102756))
                     /gene="fumC1"
                     /locus_tag="CNE_2c00900"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176465"
     gene            103374..104351
                     /locus_tag="CNE_2c00910"
                     /db_xref="GeneID:10920581"
     CDS             103374..104351
                     /locus_tag="CNE_2c00910"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680315.1"
                     /db_xref="GI:339321421"
                     /db_xref="GeneID:10920581"
                     /translation="MQSIRIPLHRGRRPGARRLALPLATSLGRMLIAQLKSFFMVARI
                     GSVTQAAKRLGLSQPTITAQIRALEEAYGVELFHRGGRRLALSDAGLALLPRVEALVQ
                     QETEIDFFLRHSGDLRTGSLRVGATAPYYVLELIRSFSERFPAIDVSVVTGNSQEVLE
                     ALQEYRVDIATSSQRVDDARLSRVLLGVDPLMLVVHRTHALAGHTEVAVSALAGCRLL
                     MRELGSTTRIATEDMLAQARVSPAAQMEIGSRESIREAVIRNLGVSVIARHEVPSHPD
                     LRVLGFTDASPCLHEYLYCLRERRGARLIDAFVALAEPPQGQQESGWDR"
     misc_feature    103467..103643
                     /locus_tag="CNE_2c00910"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    103473..104309
                     /locus_tag="CNE_2c00910"
                     /note="aminoethylphosphonate catabolism associated LysR
                     family transcriptional regulator; Region: phn_lysR;
                     TIGR03339"
                     /db_xref="CDD:132382"
     misc_feature    103734..104309
                     /locus_tag="CNE_2c00910"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(103770..103775,103779..103784,103791..103793,
                     103803..103805,103809..103829,104103..104120,
                     104136..104141,104145..104150)
                     /locus_tag="CNE_2c00910"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(104348..104698)
                     /locus_tag="CNE_2c00920"
                     /db_xref="GeneID:10920582"
     CDS             complement(104348..104698)
                     /locus_tag="CNE_2c00920"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_004680316.1"
                     /db_xref="GI:339321422"
                     /db_xref="GeneID:10920582"
                     /translation="MIRPTVQENAARYADCIAACNAAAAAALKCAAACLEEQDVRKMA
                     RCIALDMDCAGIAQLAASYMLRNSEFAPLVCEDCAEVCKWCKEECEHHDNEHCQDCAR
                     ACAACMEQCLKMTA"
     misc_feature    complement(104357..>104596)
                     /locus_tag="CNE_2c00920"
                     /note="Cysteine-rich 4 helical bundle widely conserved in
                     bacteria; Region: DUF326; cd08026"
                     /db_xref="CDD:153434"
     misc_feature    complement(order(104456..104461,104468..104470,
                     104480..104482,104489..104494,104510..104515,
                     104522..104524,104531..104536,104543..104548,
                     104552..104557))
                     /locus_tag="CNE_2c00920"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153434"
     gene            105022..105396
                     /locus_tag="CNE_2c00930"
                     /db_xref="GeneID:10920583"
     CDS             105022..105396
                     /locus_tag="CNE_2c00930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680317.1"
                     /db_xref="GI:339321423"
                     /db_xref="GeneID:10920583"
                     /translation="MGEAKRRGTPEERAAQARAKIEALRPAQLVCGHCKTAFAQFDAL
                     DVPGLPGIDAVFGGECPGCGNDVVVFKGAPDAVAQAMIAWEKMLGADAQLGYQSSDGR
                     HVPFEPEGAGGAASDKPGGTIH"
     gene            complement(105415..107502)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /db_xref="GeneID:10920584"
     CDS             complement(105415..107502)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /EC_number="2.7.7.65"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase YegE"
                     /protein_id="YP_004680318.1"
                     /db_xref="GI:339321424"
                     /db_xref="GeneID:10920584"
                     /translation="MATTSNDAWRATGRFHGKVSAEQDTNAPTAPYMPVYTPTLKARI
                     AIITTVLAAVFGTGIVLTALYDAHRDLHDALQVQQDSVVKLTASQLDTAMSDRIVLLS
                     HQAAQLSGLLAQAHGAQAAAVRERALDALSAAIPVPAAFNALLVADMQGNIVSNRGSG
                     ADIGDRSYFREAARSLAPVVSPPIRSRTNGQMGVMVAVPVLAPNQAFVGLVGGWLDLS
                     SANFLVEILHNRLGTTGYYCLVSAGPEPVYIRHPDPAQARQPAQAVADTCGEDDSPAP
                     LEFLTPARPVIARYLMSSTGWELVALLPAREAYAPLHQMQQRFLSMAGMAMAAVALLI
                     WLAVRRQLAPLARLHKVVQASANDLSAFERLPTRQQRDEIGDVTRAFIKLMRDVRERR
                     QALDRSERRLRAVTDTLPSLLAFIDTDERYVFNNQAYERVFGLKPEELRGRHVREILG
                     EARYARVQPFMQRALAGTAVTFETEDSDLEYHCMESSLRPEWSADGSEVVGVHIHVQD
                     ITQRKLETQRLARMSRTDHLTQLMNRSAFEGQLHAAMVRSREHGTLMALLYLDMDRFK
                     AVNDIHGHAAGDQLLQTFAQRVRRCVRERDTVARQGGDEFAVVLEDMTRPAAARRVAQ
                     AILQAMDEPFDFEGVSADVDVSIGVALYNGGPAQDRELMRLADVLLYRAKGAGRGRYE
                     IGPPELAGELSAQ"
     misc_feature    complement(106744..106965)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    complement(105964..106284)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    complement(105976..106278)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(106066..106068,106081..106083,
                     106150..106161,106198..106200,106216..106218,
                     106228..106230))
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(106039..106041,106045..106047,
                     106120..106125,106132..106134,106156..106158,
                     106168..106170))
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(105460..105933)
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(105691..105693,105820..105822))
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(105688..105699,105703..105705,
                     105769..105771,105781..105783,105793..105798,
                     105805..105807))
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(105628..105630,105715..105717))
                     /gene="yegE"
                     /locus_tag="CNE_2c00940"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            107800..111045
                     /locus_tag="CNE_2c00950"
                     /db_xref="GeneID:10920585"
     CDS             107800..111045
                     /locus_tag="CNE_2c00950"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_004680319.1"
                     /db_xref="GI:339321425"
                     /db_xref="GeneID:10920585"
                     /translation="MRLTSLSPALLSLLVAASGALLTAGAWLQAERLERREAQQHFDA
                     LLGQAGSVLRERMLENERLLRGVAAVLSANPDTSRAQWRDYLYTAQLDDLPAGTQSIG
                     YAPLTPLQRVPRLVQAARADGLADYDIHPGGTRDLYAPIFYIEPLDGRNTRAAGFDML
                     SEPTRRATLEAARDSGEPRLTPGLALVREAEAAQRQHGALIFLPVYAGEAAVSTVAQR
                     RHAVLGYVYVSLRLGDLMRAAGAPAAAELELSLYEGSPAAPGPMLSGGPTEGERREDG
                     SAALLQGERQLQYGGVTWTLRGATRPAFEAAHGPRQAYLVLAAGTLATLLLAWLTHAL
                     ACRGRAARQREAQAVHAWEDDNAMLQACMAQSADGFLLADAQGVVVRASERAGQLFGA
                     DPAALAGRSLDTLVPGATGVVPSGAAAGVEAHRELAGVRADGSRFALRAGAARLPVAD
                     GGTAHWLWAVTDLEPERRAQQAAAVQAARYAGLLDHAAFCVITFDEDGLITGINAAGQ
                     RMLWYNTAELVGHMHMTGLHIADELADHARMLSGELGEPVPPGLPALVAKARLGLTDE
                     REWTWVRKGGSRMPVQLAVFALPAPIEAAAADAAPAGPADGAEPRSAPSPGYQAIGYD
                     LTERLRVDEYIRHLALHDPLTGLPNRAELSERAQALLLHARSHGERVALLLLDLDHFK
                     HINDSLGHPVGDDVLRTMADRLKGTVRQGDLVARMGGDEFGVVLGGLRHDSEAELIAA
                     KIQVRVNEELQAGGQRLRVTPSIGMAIFPDDGDSLTELLKAADSAVYAAKHDGRAQLR
                     RFASAMAEASLARFTIEGLLRRALARDEFRLRYQPIVDAATLAITGVEALITWNTPER
                     GAMQPAEFIPIAEQSGLVAPLGEWTLATACREIQALRQALGSEIEVAVNISPLQLRQA
                     NFPDTVAHCLQQAGLPPQGLVIEVTEGILVDGGETTIETFRRLRELGVGLSIDDFGTG
                     YSGLNYLTRLPISRLKIDKSFVDDVATPGHDQAVAAAIIALGHQLHLKVIAEGVETAA
                     QFEFLRAQGCDGLQGFLFSQAVPHEVLREILEKGIRAPTPTSAGATALRES"
     misc_feature    108016..108594
                     /locus_tag="CNE_2c00950"
                     /note="CHASE domain; Region: CHASE; pfam03924"
                     /db_xref="CDD:252251"
     misc_feature    108895..109188
                     /locus_tag="CNE_2c00950"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    108901..109188
                     /locus_tag="CNE_2c00950"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    order(108943..108945,108955..108957,108973..108975,
                     109012..109023,109084..109086,109099..109101)
                     /locus_tag="CNE_2c00950"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(109003..109005,109015..109017,109033..109038,
                     109120..109122,109126..109128)
                     /locus_tag="CNE_2c00950"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    109246..>109554
                     /locus_tag="CNE_2c00950"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    109717..110193
                     /locus_tag="CNE_2c00950"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(109828..109830,109957..109959)
                     /locus_tag="CNE_2c00950"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(109843..109845,109852..109857,109867..109869,
                     109879..109881,109945..109947,109951..109962)
                     /locus_tag="CNE_2c00950"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(109933..109935,110020..110022)
                     /locus_tag="CNE_2c00950"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    110251..110964
                     /locus_tag="CNE_2c00950"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            111213..112307
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /db_xref="GeneID:10920586"
     CDS             111213..112307
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /EC_number="3.6.3.25"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate ABC transporter ATP-binding
                     protein CysA"
                     /protein_id="YP_004680320.1"
                     /db_xref="GI:339321426"
                     /db_xref="GeneID:10920586"
                     /translation="MQAGKSGEGRAFLAVEQVSKRFGSFMALDGVSLSVGQGELLCLL
                     GPSGCGKTTLLRIIAGLEREDAGRIHAGARELTGLPPQARDYGILFQSYALFPNLTVA
                     QNVAYGLHGRGMGRTHRDARVAEMLGLVGLAGSERKFPGQLSGGQQQRVAMARALAPA
                     PSLLLLDEPMSALDARVREHLRLELRQLQRRLNITTVMVTHDQEEAMTMADRIAVMDG
                     GRIVQAGTPAEIYEQPASAFVAGFVGQANWLPGRSAQAGRFTVGEGSQAVDFLVDTPQ
                     PAASAGRLCCRPEAVRLDPDPAESNRLLARVVDQTYLGNRYRLALEADRLPGLTLFAD
                     VAREARHRLPDAGGHKFWIALPAQALRVFA"
     misc_feature    111237..112304
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="putative 2-aminoethylphosphonate ABC transporter,
                     ATP-binding protein; Region: PhnT2; TIGR03265"
                     /db_xref="CDD:234152"
     misc_feature    111249..111944
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    111345..111368
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(111354..111359,111363..111371,111483..111485,
                     111711..111716,111813..111815)
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    111474..111485
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    111639..111668
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    111699..111716
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    111723..111734
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    111801..111821
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    112062..112301
                     /gene="cysA"
                     /locus_tag="CNE_2c00960"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            112304..114034
                     /locus_tag="CNE_2c00970"
                     /db_xref="GeneID:10920587"
     CDS             112304..114034
                     /locus_tag="CNE_2c00970"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004680321.1"
                     /db_xref="GI:339321427"
                     /db_xref="GeneID:10920587"
                     /translation="MMRAAATVESHPGTQAASSRGTGLASRLAHGAPAAMKWIWLAGL
                     AVGLLLPLLALFRQAWFDAAGQWALGARMAALVTSPNFLPMLGRSVAVSLAVVALVVP
                     LAFGFAYALQRSCIALRPLWRGIALLPLFAPSLLPAIALVYLFGNQGIFRGAFGQGGI
                     YGFWGIVLGEAFYTFPHALMVLVATLSLADARLYEAARAMGASPWRTFCTVTLPGARQ
                     GLFAAACLVLTLVITDFGVPKVVGGGYPVLALEAYKSVVGQQQFDRGALIGMLLLAPA
                     LLTFAVDMAMQQRQRTQMGSRAQVYVPAPERGRDGACLLLVALVSAALLAVIATAVGA
                     SLVKLWPYNLGLTLAHYDFDNMDGGGWLAYRNSLKLSALTALAGTAAIFLGAWLTLRT
                     RGPAWLHGVLRASFLLPMAVPGLVLGLGYVFFFNAPGNPLHALYGTMALLVLCNVAHC
                     YTTGHLTAAAALRQLDNEFEAAALSLGVAPLVTCWRVTVPVCLPALLDIFRYLFVSSM
                     TTVSAVIFLYSPDTVLAAISVLNMDDAGDTAPAAAMSTLILLTSVLAALLLHAVSAGW
                     LRRAQRWRAG"
     misc_feature    112469..114025
                     /locus_tag="CNE_2c00970"
                     /note="putative 2-aminoethylphosphonate ABC transporter,
                     permease protein; Region: PhnU2; TIGR03262"
                     /db_xref="CDD:132306"
     misc_feature    112607..113125
                     /locus_tag="CNE_2c00970"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(112607..112612,112619..112624,112637..112639,
                     112667..112678,112682..112711,112718..112723,
                     112727..112729,112817..112822,112826..112828,
                     112832..112834,112841..112846,112850..112852,
                     112862..112867,112874..112876,112925..112927,
                     112967..112972,112979..112981,113000..113011,
                     113018..113023,113057..113062,113090..113095,
                     113102..113107,113111..113116,113123..113125)
                     /locus_tag="CNE_2c00970"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112685..112729,113000..113017)
                     /locus_tag="CNE_2c00970"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112727..112729,112799..112801,113018..113020,
                     113051..113053,113060..113062,113090..113092)
                     /locus_tag="CNE_2c00970"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112877..112915,112931..112936,112946..112948)
                     /locus_tag="CNE_2c00970"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    113393..113965
                     /locus_tag="CNE_2c00970"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(113441..113446,113453..113458,113471..113473,
                     113507..113518,113522..113551,113558..113563,
                     113567..113569,113642..113647,113651..113653,
                     113657..113659,113666..113671,113675..113677,
                     113690..113695,113702..113704,113753..113755,
                     113795..113800,113807..113809,113828..113839,
                     113846..113851,113888..113893,113921..113926,
                     113933..113938,113942..113947,113954..113959)
                     /locus_tag="CNE_2c00970"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(113525..113569,113828..113845)
                     /locus_tag="CNE_2c00970"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(113567..113569,113627..113629,113846..113848,
                     113882..113884,113891..113893,113921..113923)
                     /locus_tag="CNE_2c00970"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(113705..113743,113759..113764,113774..113776)
                     /locus_tag="CNE_2c00970"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            114096..115124
                     /locus_tag="CNE_2c00980"
                     /db_xref="GeneID:10920588"
     CDS             114096..115124
                     /locus_tag="CNE_2c00980"
                     /codon_start=1
                     /transl_table=11
                     /product="BITfamily ABC transporter permease"
                     /protein_id="YP_004680322.1"
                     /db_xref="GI:339321428"
                     /db_xref="GeneID:10920588"
                     /translation="MSRITNLVTALAAAAALPMLAGNASAATVLTVYTALEADQIAAY
                     KAAFEKVHPDIEIKWVRDSTGIVTAKLLAEKAAPRADAVWGLAGSSLAILDKEGMLDP
                     YAPKNLAAIDAKYRSPANPPAWVGMDVWGAAICFNTVEAQKQGLPKPTSWADLTKPIY
                     AGKVVMPHPASSGTGFLDVSAWLQMMGEQKGWQYMDGLHKNIGLYTHSGSKPCKMAAQ
                     GEFPIGIAFEYRAMKSKKEGAPIDIVLPSEGLGWDIEATAIVKGSKNLDAARKLADFS
                     ASREAMALYEKNFAVLAVPGIAKPDALLPADYEKRLIKNDFRWASDNRDRILAEWSKR
                     YEGKAEKK"
     misc_feature    114159..115115
                     /locus_tag="CNE_2c00980"
                     /note="putative 2-aminoethylphosphonate ABC transporter,
                     periplasmic 2-aminoethylphosphonate-binding protein;
                     Region: phnS2; TIGR03261"
                     /db_xref="CDD:234151"
     gene            complement(115207..115674)
                     /locus_tag="CNE_2c00990"
                     /db_xref="GeneID:10920589"
     CDS             complement(115207..115674)
                     /locus_tag="CNE_2c00990"
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="YP_004680323.1"
                     /db_xref="GI:339321429"
                     /db_xref="GeneID:10920589"
                     /translation="MRLARRIAHCQSNRMAGCRAAGVTTPANPGFRTAPASTGAASAA
                     LPVHMKRQFLGLLARVYVLQFALEVPATVAMLADMLLEYGFQVDIGSVRPLLRALQME
                     GYLESVLRDGIGRVYLLTERGREELQASRKRIDDLYRRLHAGQPATDEVPRLA"
     misc_feature    complement(<115249..115530)
                     /locus_tag="CNE_2c00990"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1695"
                     /db_xref="CDD:224609"
     gene            116068..116991
                     /locus_tag="CNE_2c01000"
                     /db_xref="GeneID:10920590"
     CDS             116068..116991
                     /locus_tag="CNE_2c01000"
                     /codon_start=1
                     /transl_table=11
                     /product="drug/metabolite transporter (DMT) superfamily
                     permease"
                     /protein_id="YP_004680324.1"
                     /db_xref="GI:339321430"
                     /db_xref="GeneID:10920590"
                     /translation="MKPADLARLLALAAIWGASFLFIRIGAPVLGPMPTAFARVLIGA
                     LTLAACLPLLKLRWDMQGKWPAVLALGVVNSGIPFVMYAVAALWLPAGYSAVFNAMTP
                     LMGVLIGALAFSERLTRAKAAGVLLGVAGVAVLTRTGPVAFSADVLLGALACLLATAC
                     YGLSGFLARRWITQRGGLDSRLVAAGSMVGATVFLLPFCLAALWRHNTLPAAGTGVWA
                     AMLGLGVLCTALAYILYYRLIADLGPVRSLSVTFLIPPFGIIWGALFLGEALSWAHAA
                     GGALIGVAVWLVLRPVAGVETPVQARPVAGR"
     misc_feature    116110..116478
                     /locus_tag="CNE_2c01000"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    116113..116922
                     /locus_tag="CNE_2c01000"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    116614..116937
                     /locus_tag="CNE_2c01000"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            117071..117388
                     /locus_tag="CNE_2c01010"
                     /db_xref="GeneID:10920591"
     CDS             117071..117388
                     /locus_tag="CNE_2c01010"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_004680325.1"
                     /db_xref="GI:339321431"
                     /db_xref="GeneID:10920591"
                     /translation="MKIQTIFGADGQPAFVVIPYADYLSQHARASELIPYPVVRRVLA
                     DDVPPLRAWREHLGLTQADVAVRLGISQPAYAQQENSTRLRKTSRERIAAALGITAAQ
                     LDI"
     misc_feature    117218..117379
                     /locus_tag="CNE_2c01010"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    117218..>117379
                     /locus_tag="CNE_2c01010"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    order(117221..117223,117233..117235,117308..117310)
                     /locus_tag="CNE_2c01010"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(117230..117232,117305..117307)
                     /locus_tag="CNE_2c01010"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(117251..117256,117287..117289,117296..117298,
                     117308..117313)
                     /locus_tag="CNE_2c01010"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(117674..118162)
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /db_xref="GeneID:10920592"
     CDS             complement(117674..118162)
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulation protein"
                     /protein_id="YP_004680326.1"
                     /db_xref="GI:339321432"
                     /db_xref="GeneID:10920592"
                     /translation="MPMPSAMSFESRKPIHLKRAGLKATSPRMRILEVFRTSARRHLS
                     AEDVYRILLTQDEDAGLSTVYRVLNQLVQADILLRHSFESDHAVFELNEGGHHDHLIC
                     VACGRVEEFRDESIEQRQRQVAADNAFVLREHMLVLYGVCPQCRAGATEAEPTPGLPA
                     RA"
     misc_feature    complement(117737..118084)
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(117833..117835,117866..117868,
                     117872..117874,117893..117895,118037..118039))
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(117941..117985)
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(117761..117763,117812..117814,
                     117869..117871,117875..117877))
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(117740..117766,117770..117778,
                     117803..117808,117854..117862))
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(117737..117739,117848..117850,
                     117857..117859))
                     /gene="fur"
                     /locus_tag="CNE_2c01020"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            118782..118934
                     /locus_tag="CNE_2c01030"
                     /db_xref="GeneID:10920593"
     CDS             118782..118934
                     /locus_tag="CNE_2c01030"
                     /codon_start=1
                     /transl_table=11
                     /product="iron uptake protein"
                     /protein_id="YP_004680327.1"
                     /db_xref="GI:339321433"
                     /db_xref="GeneID:10920593"
                     /translation="MSWLGTLTASAFAVALGRSYAPRAVQRLLPGVAGIGLAALVARW
                     LLATWV"
     gene            complement(118948..119373)
                     /locus_tag="CNE_2c01040"
                     /db_xref="GeneID:10920594"
     CDS             complement(118948..119373)
                     /locus_tag="CNE_2c01040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680328.1"
                     /db_xref="GI:339321434"
                     /db_xref="GeneID:10920594"
                     /translation="MPNQPPTREGAAIIGSGVGEGPGPEVMAASSLDGTKAYSSDGEH
                     VGKISEIMLDVPHGRIAYAVLTTGGFLGIGDTLHAIPWNALVMDTDEKCFRIAVTADR
                     LKSAPGFNKDSWPSMADPQWGKSLHEYYGRDPYWVSPPL"
     misc_feature    complement(119065..119304)
                     /locus_tag="CNE_2c01040"
                     /note="PRC-barrel domain; Region: PRC; pfam05239"
                     /db_xref="CDD:253112"
     gene            complement(119562..119711)
                     /locus_tag="CNE_2c01050"
                     /db_xref="GeneID:10920595"
     CDS             complement(119562..119711)
                     /locus_tag="CNE_2c01050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680329.1"
                     /db_xref="GI:339321435"
                     /db_xref="GeneID:10920595"
                     /translation="MKTAGEQPGSLARGTTLGGGLMFQQGAPPAAGVDSTTRVGVMLG
                     MRHRF"
     gene            complement(119854..120771)
                     /locus_tag="CNE_2c01060"
                     /db_xref="GeneID:10920596"
     CDS             complement(119854..120771)
                     /locus_tag="CNE_2c01060"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680330.1"
                     /db_xref="GI:339321436"
                     /db_xref="GeneID:10920596"
                     /translation="MRNDIPNLGALQAFEASARLGSFTRAAAELALTHSAVGRQVAQL
                     EQRLGVALFTRVRRRLELTDTGREYAARIRRHLDHLQRDTLEITTGRAMGYTLELAVV
                     PTFATQWLIPRLPDFARRHPNVTVNLSARSQPFSFQECAYDAAIYFGDQFWPGTRGGV
                     IFREGGMVPVCSPAFLAGHPVTGAASLARCRHLHLSTRANAWRDWYAAQGWAYDLAAS
                     RGPRYELFTMMTAAAAAGLGIGLAPRLLIERELQTGQLVIPLAGMLDEQQGYYFAYPE
                     GRPESEALAAFRNWILGLSRDAPATAAGN"
     misc_feature    complement(119896..120771)
                     /locus_tag="CNE_2c01060"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    complement(120571..120750)
                     /locus_tag="CNE_2c01060"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(119899..120486)
                     /locus_tag="CNE_2c01060"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(120067..120072,120076..120081,
                     120097..120114,120382..120402,120406..120408,
                     120418..120420,120427..120432,120436..120441))
                     /locus_tag="CNE_2c01060"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            120866..121981
                     /locus_tag="CNE_2c01070"
                     /db_xref="GeneID:10920597"
     CDS             120866..121981
                     /locus_tag="CNE_2c01070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680331.1"
                     /db_xref="GI:339321437"
                     /db_xref="GeneID:10920597"
                     /translation="MRACARHGGAPILPRGSSPARLPSSAHLFAPMTSKLSTLLTANV
                     GAARAAQLLALVTLPADLPQAPQGRASRAEIAQALNMVLFGGILERVPSGRAYTDDVA
                     AAGGKVTFDHGALRTVKWRDNGALPEGEAAFTRILRPLGYVLNGTYPLDRIGMTGRSY
                     AHADAPEDIAQFFLSEFHPERFSEAFRAAVSRVTGTSADPLTPRAQTLLWQLERDGAL
                     DLADGAELVGLLVPCFERQHATPSLADYETLLSESAEMAWVATEGNAFNHATDRVDDV
                     FALAEQQKQLGRPMKDKVEVSRSGRVKQTAFRADTVRRNFVGAQGETVERDVPGSFYE
                     FITRDRFAEEAAAPQRYDLGFDAGNAQGIFKMTAAAC"
     misc_feature    121091..121966
                     /locus_tag="CNE_2c01070"
                     /note="Domain of unknown function (DUF1338); Region:
                     DUF1338; pfam07063"
                     /db_xref="CDD:254041"
     gene            complement(122073..124193)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /db_xref="GeneID:10920598"
     CDS             complement(122073..124193)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G 2"
                     /protein_id="YP_004680332.1"
                     /db_xref="GI:339321438"
                     /db_xref="GeneID:10920598"
                     /translation="MENTVPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKL
                     GEVHDGAATMDWMEQEQERGITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIE
                     VERSMRVLDGACMVYDAVGGVQPQSETVWRQANKYAVPRIAFVNKMDRVGADFFRVQT
                     QIADRLKGRAVPIQIPLGAEDHFQGVVDLVKMKAIVWDDASQGVRFEYQDIPADLLAT
                     AQEWRDKMVEAAAEADETLLHQYLSGEPLTEEQIKRGLRKRTIANEIVPMLCGSAFKN
                     KGVQSMLDAVIDYLPSPADVPAILGHTEDDREAERHPSDDEPFAALAFKIMTDPFVGQ
                     LIFFRVYSGVVKSGDTVYNPVKAKRERLGRILQMHANVRQEIKEVRAGDIAAAVGLKE
                     ATTGDTLCDPDKVIILERMSFPEPVISQAVEPRTKADQEKMGIALNRLAQEDPSFRVT
                     TDEESGQTIISGMGELHLEILVDRMRREFGVEASVGKPQVAYRETIRQPVKDVEGKFI
                     KQSGGRGQYGHVVLNLEPMPHGGGYEFVDAIKGGVVPREFIPAVDKGIRETLQSGVLA
                     GYPVVDIKATLVFGSYHDVDSNENAFRMAGSMAFKEGMRRARPILLEPMMAVEVETPE
                     EFTGNVMGDLSSRRGMVHGMEDIAGGGGKIVRAEVPLATMFGYSTTLRSLTQGRATYT
                     MEFKHYAEAPANVAEAVISTKRAG"
     misc_feature    complement(122076..124178)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="elongation factor G; Reviewed; Region: PRK00007"
                     /db_xref="CDD:234569"
     misc_feature    complement(123315..124148)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="Elongation factor G (EF-G) family involved in both
                     the elongation and ribosome recycling phases of protein
                     synthesis; Region: EF-G; cd01886"
                     /db_xref="CDD:206673"
     misc_feature    complement(124110..124133)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="G1 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(order(123711..123713,123723..123725,
                     123831..123836,123903..123908,123981..123986,
                     124086..124091,124098..124100,124107..124112,
                     124122..124124,124128..124130))
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(order(123372..123380,123747..123749,
                     123753..123758,124107..124118,124122..124124))
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123984..124043)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123996..123998)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="G2 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123909..123920)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="G3 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123858..123914)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123747..123758)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="G4 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(123372..123380)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="G5 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(122991..123239)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    complement(122736..122957)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    complement(122370..122720)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    complement(122118..122357)
                     /gene="fusA1"
                     /locus_tag="CNE_2c01080"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            124447..125103
                     /locus_tag="CNE_2c01090"
                     /db_xref="GeneID:10920599"
     CDS             124447..125103
                     /locus_tag="CNE_2c01090"
                     /codon_start=1
                     /transl_table=11
                     /product="NarL family response regulator"
                     /protein_id="YP_004680333.1"
                     /db_xref="GI:339321439"
                     /db_xref="GeneID:10920599"
                     /translation="MHSRTTKPRMTTILIVDDHPAMRLVLRHHLLQLLGVDEVIEADN
                     GQCAIELVRARMPDRVLLDLDIPRSSGLDVAPRLRAIHPQVRILVVTALDPAVFISRS
                     WQAGAQGFVSKTQDIKEILRAVEAVLAGYTVFPVLNRGGAPRQAMSADEEILRRLSDK
                     ELVVLQMLARGMSYKAISASLFISNKTVSSYKARIMGKLQVSSLVELGDFARCCRLTP
                     "
     misc_feature    124483..125082
                     /locus_tag="CNE_2c01090"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    124486..124830
                     /locus_tag="CNE_2c01090"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(124495..124500,124633..124635,124657..124659,
                     124717..124719,124774..124776,124783..124788)
                     /locus_tag="CNE_2c01090"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    124633..124635
                     /locus_tag="CNE_2c01090"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(124642..124647,124651..124659)
                     /locus_tag="CNE_2c01090"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    124783..124791
                     /locus_tag="CNE_2c01090"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    124915..125082
                     /locus_tag="CNE_2c01090"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(124918..124926,124963..124971,124993..124998,
                     125002..125007,125011..125025,125056..125058)
                     /locus_tag="CNE_2c01090"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(124951..124953,124957..124959,124963..124965,
                     125056..125064,125071..125073,125080..125082)
                     /locus_tag="CNE_2c01090"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(125173..125997)
                     /locus_tag="CNE_2c01100"
                     /db_xref="GeneID:10920600"
     CDS             complement(125173..125997)
                     /locus_tag="CNE_2c01100"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680334.1"
                     /db_xref="GI:339321440"
                     /db_xref="GeneID:10920600"
                     /translation="MRPSRTGQVRETPPVSTMPNSTPAQSVPPVPAPQAPLRRRGRTL
                     AEEVVQALGEEIRQGQLKPGNKLPTESEIMASMGVSRTVVREALSRLQASGLVETRHG
                     IGTFVLARAAEAPSPFRIGPDALGTAMDVMAMLEFRVSLEAEAAGLAASRRTDAQLAA
                     MRQALDELKRSAGAGNDAVESDFAFHLAIARATGNRYFTDIMGHLGTMVIPRSRLQVS
                     TPEREQYLERVSIEHENIYDAIERRDPDGAKAAMRMHLTNSRERLRKASGTAAAQG"
     misc_feature    complement(125179..125886)
                     /locus_tag="CNE_2c01100"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(125677..125871)
                     /locus_tag="CNE_2c01100"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(125683..125694,125698..125703,
                     125731..125733,125740..125745,125749..125763,
                     125785..125790,125794..125796,125863..125865,
                     125869..125871))
                     /locus_tag="CNE_2c01100"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(125224..125544)
                     /locus_tag="CNE_2c01100"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            126102..127457
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /db_xref="GeneID:10920601"
     CDS             126102..127457
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /EC_number="4.2.1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="glucarate dehydratase"
                     /protein_id="YP_004680335.1"
                     /db_xref="GI:339321441"
                     /db_xref="GeneID:10920601"
                     /translation="MTPTAAPMASAHTPVVTELTVVPVAGHDSMLMNLSGAHGPYFTR
                     NIVIVRDSAGQTGVGEVPGGEGIRQTLEDARPLLVGQPIGQYQAILNRVRAAFASRDA
                     GGRGLQTFDLRITIHAVTALEAALLDLLGQHLEVPVAALLGEGQQRDAVEMLGYLFYI
                     GDRQRTTLDYRTEPDADNAWFRLRNEVAMTPAGVVRLAEAAYERYGFNDFKLKGGVLS
                     GDEEMEAILALAERFPKARITLDPNGAWSLAEAVRLCRDKRGVLAYAEDPCGAEDGYS
                     GREIMAEFRTATGLPTATNMIATDWRQMGHAVRLQSVDIPLADPHFWTMQGSVRVAQM
                     CAEWGLTWGSHSNNHFDISLAMFTHVAAAAPGRVTAIDTHWIWQDGENLTRNPLQIEG
                     GLVQVPKTPGLGVELDMDALARAHALYQRKGLGARDDAAAMQFLIPGWKFNNKAPCTV
                     R"
     misc_feature    126132..127454
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /note="glucarate dehydratase; Region: glucar-dehydr;
                     TIGR03247"
                     /db_xref="CDD:211799"
     misc_feature    126144..127364
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /note="D-Glucarate dehydratase (GlucD) catalyzes the
                     dehydration of both D-glucarate and L-idarate to form
                     5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction
                     of the catabolic pathway for (D)-glucarate. GlucD belongs
                     to the enolase superfamily of enzymes; Region:
                     D-glucarate_dehydratase; cd03323"
                     /db_xref="CDD:239439"
     misc_feature    order(126198..126200,126213..126215,126567..126569,
                     126732..126734,126738..126740,126822..126824,
                     126828..126830,126897..126899,126984..126986,
                     127134..127142,127221..127223)
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /note="active site"
                     /db_xref="CDD:239439"
     misc_feature    order(126360..126365,126372..126374,126498..126503,
                     126519..126530,126933..126938,126948..126950,
                     126954..126959,127002..127007,127017..127019,
                     127089..127091,127098..127100,127110..127121)
                     /gene="gudD"
                     /locus_tag="CNE_2c01110"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239439"
     gene            127545..128567
                     /locus_tag="CNE_2c01120"
                     /db_xref="GeneID:10920602"
     CDS             127545..128567
                     /locus_tag="CNE_2c01120"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680336.1"
                     /db_xref="GI:339321442"
                     /db_xref="GeneID:10920602"
                     /translation="MYTFQRQPALRLHHWLRAFALGSVVTVAALTVSAAAYAAPQDWP
                     QRPVSVVVPFPPGGSSDAIARMLTVPLNEKLGQPFVIDNRPGATGAIGATFVKRAPAD
                     GYTMMVASIGVYAVNPFLQKNLAYDPARDFDLLTVAVRAPNVLVANPQFPANTLQELV
                     AYMKKNPGKVSFASSGAGSSDHLTAALFWQKSATDGLHVPYKGGGPAISDLLAGQVDV
                     SFQNVNAVLQHIRTGKLKAMAVTSDKRSPVLPNVPTMAEAGVKDVEVYSWQGVAAPRG
                     LPPEVKSRLHGALVSSLNDPKMRQKLSENGFEVVANTPEQFSQFEAQELQRWKTVIEK
                     GKIALD"
     misc_feature    127731..128546
                     /locus_tag="CNE_2c01120"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            128668..129666
                     /locus_tag="CNE_2c01130"
                     /db_xref="GeneID:10920603"
     CDS             128668..129666
                     /locus_tag="CNE_2c01130"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680337.1"
                     /db_xref="GI:339321443"
                     /db_xref="GeneID:10920603"
                     /translation="MTQGRRTFLKQSSALAAGLAAGPLAGLSSAAHAAQDWPTRPIRL
                     VVPYTAGGSSDIIARLISKQLGEALGQSVVVDNRPGANGNVGAALVAQATDNHTLMLC
                     DIGALAISPSVYTKLTFNIAKDLKPVSMLAYSPHLLVVHPSVQAASVKELVALSQRSQ
                     LNFAVTAIGSAPHLAGVAVEQATGARWQYVPYKGGSQAIADTVGGSAQVLMNGMLATL
                     PHVQSGKLKLIAQSKRTRMPLLQNVPTIAEQGVPNFESGTWQGVMAPASMSDAMVARI
                     SGELIRIIRAPDLRAQLVAQGAEVVTMTPGETGKFFVAEQTRWAGVVKQAGIKLEA"
     misc_feature    128749..129651
                     /locus_tag="CNE_2c01130"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            complement(130216..131742)
                     /locus_tag="CNE_2c01150"
                     /db_xref="GeneID:10920604"
     CDS             complement(130216..131742)
                     /locus_tag="CNE_2c01150"
                     /EC_number="1.2.1.26"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dioxovalerate dehydrogenase/2-oxoglutarate
                     semialdehyde dehydrogenase"
                     /protein_id="YP_004680338.1"
                     /db_xref="GI:339321444"
                     /db_xref="GeneID:10920604"
                     /translation="MHITGDMLIGAQAVRGTEALLQAINPTTGEALGPDFHGGGQAEV
                     ERACALAEAAFDTYRNTTPEQRAALLEAIATGIEALGDTLTERARLESALPIARLQGE
                     RGRTAGQLRLFATVLREGRWQQATFDAALPERNPPRPDLRMQCIAIGPVAVFGASNFP
                     LAFSVAGGDTASALAAGCPVVVKAHPAHLGTSELVGRVIQKAVQDAGLPEGVFSLLVG
                     AGNAIGTALVSHPAIQAVGFTGSRAGGLALMQAAQRRPQPIPVYAEMSSINPVFLLPA
                     ALDARGEEIGRQLVDSLVMGVGQFCTNPGLVIGIEGPALDKFRAAALGALQGKPAATM
                     LTPGIHAAFEQGVAQLSSLDGLQRIGDGVDGNGANQARPVMFETTAAQFMADHRMQAE
                     VFGPSTVLVVCRDLDEMLTVARQLEGQLTATMQLDDADHAAARRLLPVLERKAGRVLC
                     NGYPTGVEVAYAMVHGGPFPATSDARSTSVGATAIDRFLRPVCYQNLPQALLPEAVKG
                     "
     misc_feature    complement(130255..131613)
                     /locus_tag="CNE_2c01150"
                     /note="Alpha-Ketoglutaric Semialdehyde Dehydrogenase;
                     Region: ALDH_KGSADH; cd07129"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(130258..130269,130273..130278,
                     130336..130341,130351..130356,130369..130371,
                     130393..130395,130399..130410,130414..130416,
                     130426..130428,130438..130440,130501..130503,
                     130996..130998,131005..131007,131314..131316,
                     131320..131322,131359..131361,131563..131565,
                     131575..131577))
                     /locus_tag="CNE_2c01150"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(131011..131013,131020..131022,
                     131029..131031,131068..131070,131185..131190,
                     131194..131196,131272..131274))
                     /locus_tag="CNE_2c01150"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(130840..130842,130849..130851,
                     130951..130953,131269..131271))
                     /locus_tag="CNE_2c01150"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143447"
     gene            complement(131847..132845)
                     /locus_tag="CNE_2c01160"
                     /db_xref="GeneID:10920605"
     CDS             complement(131847..132845)
                     /locus_tag="CNE_2c01160"
                     /EC_number="4.2.1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-4-deoxyglucarate dehydratase"
                     /protein_id="YP_004680339.1"
                     /db_xref="GI:339321445"
                     /db_xref="GeneID:10920605"
                     /translation="MTDNSDDLRRRSQPPLPPGATGPLRIAAMLAPNELKKIVSEGLL
                     SFPITDFDAQGDFAPHAYAARLEWLAPYGATALFAAGGTGEFFSLTPQDYSAVVDTAV
                     RTCAGMVPILAGAGGPTRTAIAYAQEAQRLGAAGVLLLPHYLTEASQDGIAAHVEQVC
                     KSVDIGVIVYNRANSKLDATQLARLAERCPNLVGFKDGVGDIEAMVSIRRKLGDRFSY
                     LGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHDTVGRLLDNFFL
                     PYLAIRNRKAGYAVSIVKAGARLVGRDGGPVRAPLTDLTGEEMEMLGTLINKLGPQ"
     misc_feature    complement(131862..132728)
                     /locus_tag="CNE_2c01160"
                     /note="5-dehydro-4-deoxyglucarate dehydratase, also called
                     5-keto-4-deoxy-glucarate dehydratase (KDGDH); Region:
                     KDGDH; cd00951"
                     /db_xref="CDD:188638"
     misc_feature    complement(order(132183..132185,132258..132260,
                     132330..132332,132336..132338,132597..132602))
                     /locus_tag="CNE_2c01160"
                     /note="putative active site [active]"
                     /db_xref="CDD:188638"
     misc_feature    complement(132258..132260)
                     /locus_tag="CNE_2c01160"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188638"
     gene            133174..134154
                     /locus_tag="CNE_2c01170"
                     /db_xref="GeneID:10920606"
     CDS             133174..134154
                     /locus_tag="CNE_2c01170"
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="YP_004680340.1"
                     /db_xref="GI:339321446"
                     /db_xref="GeneID:10920606"
                     /translation="MVGELQALLENHGLMLVFLNVLVEQAGLPVPAYPMLFVAGALGV
                     QDTGPSIGAVLAAVIFACLIADTGWYFAGRRLGQPMLRTICRVSISQDSCIRQTQSLY
                     LRVGPRSLVIAKLLPGAGALSTAMAGMTGTPLPVFLFYDAIGALVWAGSALLIGVVFS
                     DFIDAILEAFSAYGHMAVVGLLVAFALFLAWRWWRRLRLLRRTRRVPRMTVDELEARR
                     LAGSLPVVIDVRAHGDTPMERIPGSVVLDMQGALDSLDALGVPHAGADIVVYCACPNE
                     LSAALLAERLRVAGYPKTWALAGGFDEWKRRHGGTAPTEAANQPGPAEAA"
     misc_feature    133210..133743
                     /locus_tag="CNE_2c01170"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     misc_feature    133795..134091
                     /locus_tag="CNE_2c01170"
                     /note="GlpE sulfurtransferase (ST) and homologs are
                     members of the Rhodanese Homology Domain superfamily.
                     Unlike other rhodanese sulfurtransferases, GlpE is a
                     single domain protein but indications are that it
                     functions as a dimer. The active site contains a...;
                     Region: GlpE_ST; cd01444"
                     /db_xref="CDD:238721"
     misc_feature    133984..133986
                     /locus_tag="CNE_2c01170"
                     /note="active site residue [active]"
                     /db_xref="CDD:238721"
     gene            complement(134180..135136)
                     /locus_tag="CNE_2c01180"
                     /db_xref="GeneID:10920607"
     CDS             complement(134180..135136)
                     /locus_tag="CNE_2c01180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680341.1"
                     /db_xref="GI:339321447"
                     /db_xref="GeneID:10920607"
                     /translation="MALQQTLVIHEALDSPHANGAVVSELFVPYAGAGVSVEVTTVHN
                     APPENTANTTDFITIVIPGTTGKRSGGSAPTLGVIGRNGAIGARPELVGLVSDADGPI
                     GCLAVALKLAQMKARGDHLVGDVIVTTHLSTNVSMQPHDPVPFMGMPVSSDTMNDYQV
                     LPEMDAILSIDASKGNSIIKHRGFAISPTAMQGYILRVAPDLVATMESTTGCPAVTFP
                     ISQQDITPYHNGLYHFNSIMQPHVATQAPVVGVAVTAQSVVSGSATSANHEIDIAEAV
                     RFCVEVSKRFGAGKCQFFNAAEWEKIRAVYPDLSVFQTAGKR"
     misc_feature    complement(134183..135025)
                     /locus_tag="CNE_2c01180"
                     /note="Protein of unknown function (DUF1177); Region:
                     DUF1177; pfam06675"
                     /db_xref="CDD:253853"
     gene            complement(135195..136355)
                     /locus_tag="CNE_2c01190"
                     /db_xref="GeneID:10920608"
     CDS             complement(135195..136355)
                     /locus_tag="CNE_2c01190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680342.1"
                     /db_xref="GI:339321448"
                     /db_xref="GeneID:10920608"
                     /translation="MSHTTRHAGRLALPLLLGLPAAAMAQSGVTLYGVIDTALTYQSH
                     SNPAGDAQIGLQQGGEGFLSGSRFGLRGIEDLGGGLKAGFVLENGLLADTGKLDQQGQ
                     LFGRQAYVKIGNQWGELALGRQYTTANTMLYYVDPLGVGAAPSNAWMVYLTGQRYDNA
                     VSYTGNFGPVSVIAEYALGETAGNTRATSSMSFGVRYAAGPIAAVGDFQQTRDSQSRA
                     ASIYLAGLKAAVGRASLFANYIHSDRDAGFDSSKGGTDTATITSMSTAATPTNRAAIN
                     SVFGGSRHDDFFTLGASYPVTGNVTLIGSVMHNRTRADGFSGNRTTAYAVADYAFSKR
                     TDAYLALAYDRVHGDWSGLFGNNTTSWTGGSGKPLDGRDSQTTMMVGLRHQF"
     misc_feature    complement(135198..136277)
                     /locus_tag="CNE_2c01190"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(135198..135200,135204..135206,
                     135210..135212,135351..135353,135360..135365,
                     135879..135884,135888..135890,135987..135995,
                     136020..136034,136038..136043,136077..136088,
                     136092..136094,136098..136106,136110..136112,
                     136128..136142,136239..136247,136251..136253,
                     136269..136271,136275..136277))
                     /locus_tag="CNE_2c01190"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(135888..135890,135948..135950,
                     136038..136040,136155..136157,136254..136256))
                     /locus_tag="CNE_2c01190"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(136490..137245)
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /db_xref="GeneID:10920609"
     CDS             complement(136490..137245)
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /EC_number="3.4.13.21"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase E"
                     /protein_id="YP_004680343.1"
                     /db_xref="GI:339321449"
                     /db_xref="GeneID:10920609"
                     /translation="MTQRILLMSSSRKDNHGYLEHAGEQIHTLLRREPRKVLFVPFAG
                     VTFSFDTYEGMVKPVFETLGYALESIHHSADPLRAVEQAEAIAVGGGNTFALLKRMYD
                     AGIVDAIRARVRAGMPYVGWSAGSNAACPTIRTTNDMPIVQPPSLRALGLVPFQINPH
                     FISGKPAGHNGESREERLAEFLHINAPEQVFALPEGSALFSDGTRGTVLGERHALWFP
                     AEGKAETIREGETFPLSQITGPAGMPDWPGFAA"
     misc_feature    complement(136592..137236)
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in peptidase E; Region: GAT1_Peptidase_E;
                     cd03146"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(136661..136663,136724..136726,
                     136766..136768,136832..136834,136877..136879,
                     136973..136975))
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /note="active site pocket [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(136874..136876,136973..136975))
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(136661..136663,136766..136768,
                     136877..136879))
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(136877..136879)
                     /gene="pepE"
                     /locus_tag="CNE_2c01200"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153240"
     gene            complement(137290..138483)
                     /gene="csd"
                     /locus_tag="CNE_2c01210"
                     /db_xref="GeneID:10920610"
     CDS             complement(137290..138483)
                     /gene="csd"
                     /locus_tag="CNE_2c01210"
                     /EC_number="2.8.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="YP_004680344.1"
                     /db_xref="GI:339321450"
                     /db_xref="GeneID:10920610"
                     /translation="MDIQAIQAIRADTPLTASTIYLDTAAASLPPDAVLDTVRSYLLD
                     TGHVGIYLPAFRKETYTRVEAVRGKLAGLLNCAADEVAFTKNATESISIVARGIAWEA
                     GDEVLVADTEMLSNLLPWRRLEQSHGIVVKMVAANAEGLLSPEAFEGAVTPRTRLLTF
                     SHLPNSTGAVQPAKQICAVARRHGVLSLVNAAQSVGMLRSDVAELDCDFLAGCGRKAL
                     RATEGSGFLYVRRALIEQVEPALVGWWNGAYDRATGALSLVAGARRFEAGCPIVPAIL
                     GMGTAIDYAAAIGIDAIEARVRDLTGYAVAKFASIPGFELYGPADLANRIGIVPFNVR
                     GVDPARIVAALEAQQCIIEAGNFMADAILARYGVSTMARVSLHYFNTHEEIDRVAALI
                     RAAIA"
     misc_feature    complement(137311..138426)
                     /gene="csd"
                     /locus_tag="CNE_2c01210"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    complement(order(137836..137838,137845..137847,
                     137905..137907,137914..137916,137998..138000,
                     138211..138213,138220..138225))
                     /gene="csd"
                     /locus_tag="CNE_2c01210"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(137836..137838)
                     /gene="csd"
                     /locus_tag="CNE_2c01210"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(138551..140158)
                     /locus_tag="CNE_2c01220"
                     /db_xref="GeneID:10920611"
     CDS             complement(138551..140158)
                     /locus_tag="CNE_2c01220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680345.1"
                     /db_xref="GI:339321451"
                     /db_xref="GeneID:10920611"
                     /translation="MTMPTQLNAPMAAQPATRTRFMEPLLLLVSVGLSVFGAMIGMQL
                     IVSLGISANTSIIGALIAIVFSRIPLEITRRFRVLERQNLVQTAISSATFGAANSLMI
                     PIGVPYAMGMPELATPMLIGAVIAMFVDGAMLYFLFGSRIFPATGTWPAGIATAEAIW
                     AGDRGGRKAAFLGLGIAVGVGGAWLGVPMSAFGAAFLGNLAALTMFGIGLLVRGYSVA
                     LTGIDIAKAYIPHGLMIGAGIVALFQVANEIRRARYVPAADARTIEVPASRASRILSG
                     GFLIYLAIALLISVLAGHVSDMSLGMLVVFVLYAAFAAYVHELIVGIAAMHSGWFPAF
                     AVALITLTIGILIGFPPTALAVLVGFSAATGPAFADMGYDLKTGYLLRGEGRDMEAEL
                     AGRKQQFLAAMIGFAVAAVVVLVFHRTFFAQNMIPPVDRVYAASIKAGSSAEIARNLV
                     IWAIPGALLQLIGGSRRQLGILLSTGMLIASPLAGWAVLAGLAIRFVLQRLRGDKHVA
                     EMSAFAGGVIAGDALFSFFGSVTKLRK"
     misc_feature    complement(138560..140050)
                     /locus_tag="CNE_2c01220"
                     /note="OPT oligopeptide transporter protein; Region: OPT;
                     cl14607"
                     /db_xref="CDD:265433"
     gene            complement(140223..140936)
                     /locus_tag="CNE_2c01230"
                     /db_xref="GeneID:10920612"
     CDS             complement(140223..140936)
                     /locus_tag="CNE_2c01230"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004680346.1"
                     /db_xref="GI:339321452"
                     /db_xref="GeneID:10920612"
                     /translation="MLKTLDGALALLTHFTARQPSWGVRELARHSGVHHAVVHRVLAT
                     FAGNGFLVQDALGRYGLGLRWFELGQVMRRTLSPAEVVQPALEALARECGETVFLSWL
                     DGGEGLCTDIAQSQHQLRFSIEVGQRFALDAGAHAKAILAFQPEAFRRQVAGDAPELE
                     ARLDQIRADGWAYTCEESAATVAGLALPLRHRDTQAVVGSLAIAGPLQRLTPEAVPRL
                     LEALRTTRNTIGPVAGFMR"
     misc_feature    complement(140262..140930)
                     /locus_tag="CNE_2c01230"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(140664..140930)
                     /locus_tag="CNE_2c01230"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(140250..140570)
                     /locus_tag="CNE_2c01230"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            141140..143923
                     /locus_tag="CNE_2c01240"
                     /db_xref="GeneID:10920613"
     CDS             141140..143923
                     /locus_tag="CNE_2c01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680347.1"
                     /db_xref="GI:339321453"
                     /db_xref="GeneID:10920613"
                     /translation="MAAEHHGTGGSGDEATRIAQRRRQLGIAPRADDGQRNWALALSG
                     GGIRSATFCLGVMQAMAGTAMSAKAAAPAPAPEAATPAAATAAAAQTVPGLASLLAQF
                     DYLSTVSGGGYLGAFFVSLFVPGRLRRGAGPVQAATDAYHTLQCEPPGRIHTSVSYAA
                     DPGRGAVAWLRENGRYLSPTGAGDNLYAAALVVRNWLAMHFVIGSALLVLLAALALGQ
                     HIAVGVSYGLGRHEMDLLHDARQAYNQGECAIWWSTLLWLPLATALAGAVPPGLAYWL
                     IYPRANDPQATARFLSPAPLLATLLGLMLLAAARWSEWLGSGLVIGKLFAALGVLTLL
                     GVLWCLALLQGEPRTVAAYRVRATRALRGALTLTLWLAALGIADTIARTAYLFAHQAH
                     HQWGAALPATVLGVLVWLVRYGSRWRDAGRQGSTDTPWRALCARLPVSLLAGAVAAVL
                     ALLLFVLWSWLVLWVRWDGREPVDWLVFGNAYTGPALAMLTVVSLALALVVGRFAGFL
                     NLSTLQPFYAARLTRAYLGASNGERFAPPDPTTDQDGSQGARFSVAEPVPGDQLSLNT
                     YYDPRVLAPLHLINVTLNLTVDPAEQLVQRDRKGKPLCLAPGPCVAQSGVAAAIPPDA
                     YARFTIDGRGCCPDVSWPSSGKLAESRTVGDWMAISGAAVSTRLGRATTLGTSMLLGL
                     ANLRLGIWWPSYPASHAREGGRRGRARRHPERATHPWLAAGIALFRTQYYLGCELSAR
                     FHGTRRGWQFLSDGGHFDNTGVYELLRPGRDVSLIVLCDCGGDPDYRFGDLANLIRLA
                     RIDHGLEIVVDTEAATTHPVLSRVFGVPDDFMPGAPTGDKCAVLLNVFRTGPECGAPR
                     ARTCRIVLLKPRLVSWAPADVRHYGATHPAFPQEATGDQFFDEAQWESYRALGHAIGQ
                     RVLGGAVGKALLV"
     gene            complement(143936..144691)
                     /locus_tag="CNE_2c01250"
                     /db_xref="GeneID:10920614"
     CDS             complement(143936..144691)
                     /locus_tag="CNE_2c01250"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004680348.1"
                     /db_xref="GI:339321454"
                     /db_xref="GeneID:10920614"
                     /translation="MTLKTLDGALALLTHFTVRQPTWGVRELAKHSGVHYAVVHRVLA
                     TFAANGFLVQDAATGKYSLGLRLFELGQVVRKSFSPDEIVRPVLEKLAAQSGETVFLS
                     WLDGHEGLCVGLVQSQHQLRFSIELGERFPLYAGAHAKAMLAFQDDAFRDEVYRQGLA
                     RMAPHTTLNRERIEQQLAEVRERGWAHTREEAAASVAGLALPLWSRDRSAVVGSVAIA
                     GPQQRLDEAAVPRLLEALRDASGRLEDVIGFVR"
     misc_feature    complement(143948..144682)
                     /locus_tag="CNE_2c01250"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(144416..144682)
                     /locus_tag="CNE_2c01250"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(143975..144319)
                     /locus_tag="CNE_2c01250"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            144881..145921
                     /locus_tag="CNE_2c01260"
                     /db_xref="GeneID:10920615"
     CDS             144881..145921
                     /locus_tag="CNE_2c01260"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase"
                     /protein_id="YP_004680349.1"
                     /db_xref="GI:339321455"
                     /db_xref="GeneID:10920615"
                     /translation="MNHDSIPNGAGVAWSVLDLAPIPEGSDAGQAMRNSLDLARHAEQ
                     LGYHRYWLAEHHNMPGIASAATAVLIGYVANGTRTIRVGSGGVMLPNHSPLVIAEQFG
                     TLASLYPGRIDLGLGRAPGTDQATARALRRHLSADSADTFPQDVEELQAYFEDVRPGQ
                     RLRAVPGAGLKVPIWLLGSSLFSAQLAAAMGLPFAFASHFAPGFMRQAVDLYRRTFRP
                     SEALDRPYVMLGLNVFAAETGDQARRLFSSLQQQFLALVRGTPGQLRAPVDDIESLWT
                     ESEADHIRRSLACSVVGDPDAVRAGMQRFVDDLRPDELMLAGQIHDHQARLRSFAIAA
                     DAARSLKTSSAL"
     misc_feature    144959..145867
                     /locus_tag="CNE_2c01260"
                     /note="probable oxidoreductase, LLM family; Region:
                     LLM_2I7G; TIGR03858"
                     /db_xref="CDD:234374"
     misc_feature    <145394..145537
                     /locus_tag="CNE_2c01260"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cd00347"
                     /db_xref="CDD:238209"
     gene            146143..148149
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /db_xref="GeneID:10920616"
     CDS             146143..148149
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin catabolism regulatory protein"
                     /protein_id="YP_004680350.1"
                     /db_xref="GI:339321456"
                     /db_xref="GeneID:10920616"
                     /translation="MDLRQREHIETVVQATTYLAPPAVLADRIAHDAIIQNSWRRCVH
                     QYGLDPSRMQEARILPQPRLREHQERIDDFARIARHGLQSLYGQVAGLGYVVLLTDAQ
                     GVTVDYIGEARSDAALRHAGLYLGAEWSESGAGTCAVGTALATGQALTVHQADHFDAT
                     HIPLTCTAAPLFDTHGNLHAILDISALTSPQAKDSQGLALQMVRIYAAHIENANFLRA
                     HRRDWILKLNVAPEFVDVNPEYLLALDEAGRIVGHNHRARLMLEGELGGAPGATVLGQ
                     RFETLFDARLEDLGHYVYSRPSEQRLVALTRSGGLLYLSVLPPALRWQAPPAETQVEM
                     PAALAALTGGDAALQQQLQRAARLVDSPINLLIHGETGSGKEFLAKALHLASARRGGP
                     FVAVNCAAIPETLIESELFGHLPNSFSGAGPRGKRGLIQEADGGTLFLDEIGDMPREL
                     QSRLLRVLAEGEVLPVGAARPVPVRLRVISATHHSLEQLVADGRFREDLYYRLNGARF
                     TLPPLRARTDLDWLVRKLLQEGGAEGGEITLSPAARERLHRHRWPGNLRELRNVLEYA
                     RAVCADGYIDVPDLPDSLAGPAPSAALPQPGPAQSPAAAPFDPHQLPPEGMLLMQYLR
                     ASGWNLSAVARQIGVSRMTLYRRMERYGIQSPNRRDGGPEPTDA"
     misc_feature    146143..148101
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="Transcriptional activator of acetoin/glycerol
                     metabolism [Secondary metabolites biosynthesis, transport,
                     and catabolism / Transcription]; Region: AcoR; COG3284"
                     /db_xref="CDD:225822"
     misc_feature    147169..147678
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    147247..147270
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(147250..147273,147463..147465,147589..147591)
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    147451..147468
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    147646..147648
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    147985..148095
                     /gene="acoR"
                     /locus_tag="CNE_2c01270"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            148385..149464
                     /gene="acoX"
                     /locus_tag="CNE_2c01280"
                     /db_xref="GeneID:10920617"
     CDS             148385..149464
                     /gene="acoX"
                     /locus_tag="CNE_2c01280"
                     /EC_number="2.7.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin catabolism protein X, ATP-NAD kinase
                     AcoX"
                     /protein_id="YP_004680351.1"
                     /db_xref="GI:339321457"
                     /db_xref="GeneID:10920617"
                     /translation="MGHAAGASAQIAPVVGIIANPISARDIRRVIANANSLQLADRVN
                     IVLRLLAALASCGVERVLMMPDREGLRVMLARHLARRQGPDSGLPAVDYLDMPVTARV
                     DDTLRAARCMADAGVAAIIVLGGDGTHRAVVRECGAVPIAGLSTGTNNAYPEMREPTI
                     IGLATGLYATGRIPPAQALASNKRLDIVIRDGNGGFRRDIALVDAVISHEHFIGARAL
                     WKTDTLAAVYVSFADPEAIGLSSIAGLLEPVGRREEGGLAIELAAPGEGEFDLCAPIA
                     PGLMCTVPVAGWQRLEHGRPHRVRQRSGIVALDGERELAFGPDDEVTVTLHDHAFRSI
                     DVAACMRHAARHHLMRRLPRHAAAG"
     misc_feature    148700..149392
                     /gene="acoX"
                     /locus_tag="CNE_2c01280"
                     /note="ATP-NAD kinase; Region: NAD_kinase; pfam01513"
                     /db_xref="CDD:250675"
     gene            149536..150537
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /db_xref="GeneID:10920618"
     CDS             149536..150537
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit alpha"
                     /protein_id="YP_004680352.1"
                     /db_xref="GI:339321458"
                     /db_xref="GeneID:10920618"
                     /translation="MTARASQDSAALPLDKETLLTVYRKMRTIRDFEERLHVDFGRGD
                     IPGFVHLYAGEEAAGVGILHHLNDGDRIASTHRGHGHCIAKGVDPVAMMKEIYGKKGG
                     SCNGKGGSMHIADLSKGMMGANGILGAGAPLICGAALAAKFRGKGEVGITFCGDGASN
                     QGTFLESLNLAAVWNLPVIFVIENNGYAESTSRDYGTAVDSYVDRAAGFGIPGVTVDG
                     TDFFAVHEAAGEVIRRARDGGGPSLLECKMVRFYGHFEGDAQTYRAAGELDDIRANKD
                     CLKLFGRAVTQAGVVAREELDAIDREVAALIEHAVQEAKAAPQPGPEDLLTDVYVSY"
     misc_feature    149602..150477
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of
                     PDC_ADC_BCADC subfamily, TPP-binding module; composed of
                     proteins similar to the E1 components of the human
                     pyruvate dehydrogenase complex (PDC), the acetoin
                     dehydrogenase complex (ADC) and the branched chain...;
                     Region: TPP_E1_PDC_ADC_BCADC; cd02000"
                     /db_xref="CDD:238958"
     misc_feature    order(149671..149673,149827..149829,149908..149913,
                     150004..150006,150010..150021,150028..150030,
                     150040..150042,150052..150054,150097..150108,
                     150148..150150,150163..150165,150304..150306,
                     150316..150318)
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(149761..149766,149908..149910,149914..149916,
                     149998..150009,150088..150090,150094..150096,
                     150295..150297)
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238958"
     misc_feature    order(149893..149895,149899..149901,149905..149907,
                     149920..149922,149929..149934,149941..149946,
                     149950..149955,149962..149964,150019..150024,
                     150040..150045,150052..150054)
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(150280..150300,150301..150333,150358..150366)
                     /gene="acoA"
                     /locus_tag="CNE_2c01290"
                     /note="phosphorylation loop region [posttranslational
                     modification]"
                     /db_xref="CDD:238958"
     gene            150574..151590
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /db_xref="GeneID:10920619"
     CDS             150574..151590
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit beta"
                     /protein_id="YP_004680353.1"
                     /db_xref="GI:339321459"
                     /db_xref="GeneID:10920619"
                     /translation="MARKLSIKLAINEAIDQEMTRDPSVIMLGEDIVGGAGADGEKDA
                     WGGVLGVTKGLYAKHGDRLLDTPLSESAYVGAAIGAAACGMRPIAELMFIDFMGVCFD
                     QIFNQAAKFRYMFGGKAETPVVIRAMVGAGFRAAAQHSQMLTPLFTHIPGLKVVCPST
                     PYDTKGLLIQAIRDNDPVIFCEHKNLYGLEGEVPEGAYAIPFGEANIVRDGKDVSIVT
                     YGMMVHRSLEAAATLAKEGIEAEVIDLRTLSPLDMDTVLESVENTGRLVVVDEASPRC
                     NIATDISAQVAQQAFGALKAGIEMVCPPHTPVPFSPTLEDLYIPSAAQIVAAARKTMK
                     GGKH"
     misc_feature    150583..151578
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
                     dehydrogenase (E1) component, eukaryotic type, beta
                     subunit [Energy production and conversion]; Region: AcoB;
                     COG0022"
                     /db_xref="CDD:223101"
     misc_feature    150601..151125
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="Pyrimidine (PYR) binding domain of the beta
                     subunits of the E1 components of human pyruvate
                     dehydrogenase complex (E1- PDHc) and related proteins;
                     Region: TPP_PYR_E1-PDHc-beta_like; cd07036"
                     /db_xref="CDD:132919"
     misc_feature    order(150640..150642,150646..150648,150664..150666,
                     150757..150759,150766..150768,150772..150789,
                     150796..150801,150805..150813,150868..150870,
                     150877..150882,150907..150912,150976..150978,
                     150985..150987,151030..151035,151096..151101)
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="alpha subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132919"
     misc_feature    order(150661..150663,150775..150777,150781..150783,
                     150859..150861,150868..150870)
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132919"
     misc_feature    order(150664..150666,150766..150768,150772..150783,
                     150865..150870,150874..150876,150889..150891,
                     150901..150903,150910..150912,150976..150978,
                     150982..150987,151009..151011,151015..151020,
                     151024..151026)
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132919"
     misc_feature    151180..151548
                     /gene="acoB"
                     /locus_tag="CNE_2c01300"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            151590..152714
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /db_xref="GeneID:10920620"
     CDS             151590..152714
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /EC_number="2.3.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine-residue acetyltransferase
                     component of acetoin cleaving system"
                     /protein_id="YP_004680354.1"
                     /db_xref="GI:339321460"
                     /db_xref="GeneID:10920620"
                     /translation="MATAISPTIIPIVMPKWGLSMKEGTVNAWLVDEGTEITVGLPIL
                     DVETDKIANAVEAPDAGTLRRKVAQAGDVLPVKALLGVLAPAEVSDAQIDDYVAAYET
                     PADDAGEEEAAAAYQFADVDGIRVRYARKGGGAETVLFIHGFGGDLDNWLFNLDPLAD
                     AYTVVALDLPGHGQSSPRLAGTTLAQMAGFVARFMDETGIEAAHVVGHSMGGGVAAQL
                     AVDAPQRVLSVALVSPVGFGDAVNSGYTEGFVSAQSRRELKPVVELLFADAGLVSRQM
                     LDDLLRYKRLDGVTEALTALGQGLFGGGRQSEQPGQRLAGSGKRVLVVWGGQDQIIPA
                     AHAEAAPAGATVKVFADAGHMSQMEKANDFNALLKKHLAG"
     misc_feature    151611..152711
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /note="acetoin dehydrogenase E2 subunit
                     dihydrolipoyllysine-residue acetyltransferase;
                     Provisional; Region: PRK14875"
                     /db_xref="CDD:184875"
     misc_feature    151617..151838
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(151707..151709,151728..151745,151755..151757)
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    151737..151739
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    152001..>152435
                     /gene="acoC"
                     /locus_tag="CNE_2c01310"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            152795..153136
                     /locus_tag="CNE_2c01320"
                     /db_xref="GeneID:10920621"
     CDS             152795..153136
                     /locus_tag="CNE_2c01320"
                     /note="enzyme involved in degradation of aromatic
                     compounds"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin catabolism protein"
                     /protein_id="YP_004680355.1"
                     /db_xref="GI:339321461"
                     /db_xref="GeneID:10920621"
                     /translation="MTTDLKTRLTEINKQFGALGQAQPAAMSAFQGVMKAATQDGSLP
                     AAVKELIAVALAVQKGCDDCVLFHTSQALRHRATREQLAEVLAINIEMGGGPGAMYAS
                     KALAYFDALNV"
     misc_feature    152864..153112
                     /locus_tag="CNE_2c01320"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     gene            153183..153944
                     /locus_tag="CNE_2c01330"
                     /db_xref="GeneID:10920622"
     CDS             153183..153944
                     /locus_tag="CNE_2c01330"
                     /EC_number="6.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate-protein ligase A"
                     /protein_id="YP_004680356.1"
                     /db_xref="GI:339321462"
                     /db_xref="GeneID:10920622"
                     /translation="MPFEFVDAAHAGQAGSDPLQDELALLDLAAQGRQVAQLWEAPLS
                     LVVPRTYLRHAALETARADFAQQGCPVFLRMSGGGLVPQGPGILNLSLAYAVGQPPGA
                     RSDAVYLHLCEVIGDALQALGVDTHWQAVAGSFCDGRFNLAWGPPEAARKIAGTAQYW
                     RRAPAAMQAPDGQRHLVLAHAVLLVSADPVQINARANAFEAAIDSGRRYDAGKVVSVR
                     EALLAGGRAVDDDGALMAQVSDALRRSVGQTPPPA"
     misc_feature    153246..153905
                     /locus_tag="CNE_2c01330"
                     /note="Lipoate-protein ligase A [Coenzyme metabolism];
                     Region: LplA; COG0095"
                     /db_xref="CDD:223173"
     gene            complement(154127..154948)
                     /locus_tag="CNE_2c01340"
                     /db_xref="GeneID:10920623"
     CDS             complement(154127..154948)
                     /locus_tag="CNE_2c01340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680357.1"
                     /db_xref="GI:339321463"
                     /db_xref="GeneID:10920623"
                     /translation="MTNFIEAYCAQVRLAGAVGVIAKPVVVAQDSTYAMHYVPCEYLN
                     TQAPLVLVSTTPGHAHVRLAAAVTEELMRAHAPGRVIQRENKRRVELGGKLVRPNLIR
                     MLDHFRVPELVGLPHAAALWNDGFERLQPLALLPHATTRRGLAFDGPLEELLETPMLR
                     EVFEVQFLGAVRQMRTDALYIALGRTAWAGLRHAVSRRLLAKSQLLGMMPVPARAGSM
                     VRYFLREIAASDLSAKDPVRHRVAWLDAAHAELEASVRKLRTAIRPDPHSAYLIA"
     gene            complement(155384..155773)
                     /locus_tag="CNE_2c01350"
                     /db_xref="GeneID:10920624"
     CDS             complement(155384..155773)
                     /locus_tag="CNE_2c01350"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC-like protein"
                     /protein_id="YP_004680358.1"
                     /db_xref="GI:339321464"
                     /db_xref="GeneID:10920624"
                     /translation="MTIQATWQPSQGNSICHLTNGTAEWRADLDASAGGDTQYPNPHD
                     LLDSALAACTTLTLQLYAKRKGYVITGVHVSVAHEEANGTYTMNREVKVSGELTPQIL
                     DDLLRVANRCPVHKTLSGQFSIQTSIA"
     misc_feature    complement(155390..155773)
                     /locus_tag="CNE_2c01350"
                     /note="Predicted redox protein, regulator of disulfide
                     bond formation [Posttranslational modification, protein
                     turnover, chaperones]; Region: COG1765"
                     /db_xref="CDD:224679"
     gene            156346..157865
                     /gene="rrsA"
                     /locus_tag="CNE_2c01360"
                     /db_xref="GeneID:10920625"
     rRNA            156346..157865
                     /gene="rrsA"
                     /locus_tag="CNE_2c01360"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:10920625"
     gene            157933..158009
                     /gene="trnI1"
                     /locus_tag="CNE_2c01370"
                     /note="tRNA-Ile-GAT"
                     /db_xref="GeneID:10920626"
     tRNA            157933..158009
                     /gene="trnI1"
                     /locus_tag="CNE_2c01370"
                     /product="tRNA-Ile"
                     /codon_recognized="AUC"
                     /db_xref="GeneID:10920626"
     gene            158021..158096
                     /gene="trnA1"
                     /locus_tag="CNE_2c01380"
                     /note="tRNA-Ala-TGC"
                     /db_xref="GeneID:10920627"
     tRNA            158021..158096
                     /gene="trnA1"
                     /locus_tag="CNE_2c01380"
                     /product="tRNA-Ala"
                     /codon_recognized="GCA"
                     /db_xref="GeneID:10920627"
     gene            158395..161273
                     /gene="rrlA"
                     /locus_tag="CNE_2c01390"
                     /db_xref="GeneID:10920628"
     rRNA            158395..161273
                     /gene="rrlA"
                     /locus_tag="CNE_2c01390"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:10920628"
     gene            161402..161513
                     /gene="rrfA"
                     /locus_tag="CNE_2c01400"
                     /db_xref="GeneID:10920629"
     rRNA            161402..161513
                     /gene="rrfA"
                     /locus_tag="CNE_2c01400"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:10920629"
     gene            161653..161931
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /db_xref="GeneID:10920630"
     CDS             161653..161931
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /EC_number="3.1.25.-"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease Cho"
                     /protein_id="YP_004680359.1"
                     /db_xref="GI:339321465"
                     /db_xref="GeneID:10920630"
                     /translation="MSADSAWYLYLLECTGDSIYTGITTDVARRFAEHLSGKGAKYTR
                     SRKPIRVLGQLRFETKSEALKAEIEIKRLSSTQKRAFCAQLPAAEPAQ"
     misc_feature    161671..161874
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /note="The GIY-YIG domain of uncharacterized protein
                     family UPF0213 related to structure-specific endonuclease
                     SLX1; Region: GIY-YIG_UPF0213; cd10456"
                     /db_xref="CDD:198403"
     misc_feature    order(161674..161682,161710..161718)
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198403"
     misc_feature    order(161680..161682,161710..161712,161716..161718,
                     161740..161742,161752..161754,161851..161853)
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /note="putative active site [active]"
                     /db_xref="CDD:198403"
     misc_feature    161851..161853
                     /gene="cho1"
                     /locus_tag="CNE_2c01410"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198403"
     gene            complement(162001..162423)
                     /gene="ohr1"
                     /locus_tag="CNE_2c01420"
                     /db_xref="GeneID:10920631"
     CDS             complement(162001..162423)
                     /gene="ohr1"
                     /locus_tag="CNE_2c01420"
                     /codon_start=1
                     /transl_table=11
                     /product="organic hydroperoxide resistance protein Ohr"
                     /protein_id="YP_004680360.1"
                     /db_xref="GI:339321466"
                     /db_xref="GeneID:10920631"
                     /translation="MKLEKVVYTAHATATGGRDGRATTSDGQLDAKLAVPKEMGGAGN
                     GLNPEQLFAAGYSACFLGAMRYVAGQQKIAVPADATIEGAVGIGPIPQGFGIQVELKI
                     SLPGFEREAAEKLVEQAHQVCPYSNATRGNIDVTLTVV"
     misc_feature    complement(162007..162405)
                     /gene="ohr1"
                     /locus_tag="CNE_2c01420"
                     /note="peroxiredoxin, Ohr subfamily; Region:
                     organ_hyd_perox; TIGR03561"
                     /db_xref="CDD:234259"
     gene            complement(162470..162946)
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /db_xref="GeneID:10920632"
     CDS             complement(162470..162946)
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004680361.1"
                     /db_xref="GI:339321467"
                     /db_xref="GeneID:10920632"
                     /translation="MERDNDPSPNWLLLDRQLCFALYSSSLAMTKLYKPLLSELGLTY
                     PQYLVMLVLWETETLTVSELGARLALDSGTLTPLLKRLETARLVTRTRDAADERRVLV
                     SLTDSGRALRQRAEHIPEQMLCATQCPVEEIQALTQRLHALRSSLEQARTDSSLPD"
     misc_feature    complement(<162578..162874)
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(162578..162838)
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    complement(order(162620..162622,162758..162760,
                     162767..162769))
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(162641..162649,162671..162679,
                     162695..162700,162704..162709,162716..162721,
                     162725..162736,162761..162769))
                     /gene="ohrR"
                     /locus_tag="CNE_2c01430"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            163071..164594
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /db_xref="GeneID:10920633"
     CDS             163071..164594
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease do-like protein"
                     /protein_id="YP_004680362.1"
                     /db_xref="GI:339321468"
                     /db_xref="GeneID:10920633"
                     /translation="MTVSRRKVPTPDAQGKEPHMMRQTIARTAVGIAALAALGGGYAY
                     LQKEVITPGYAAPAPAVAPAQPAAAVATPTDFSGIVAQYGPAVVNISVTARAQRTAAQ
                     MPPGIDPDDPLFQFFKRFGPQFQGPQGGQQQLVRGLGSGFIVSPDGLILTNAHVVDGA
                     QEVTVKLTDRREFKAKVLGSDPQTDVAVIRIDARNLPTVRLGDPSRVRVGEPVLAIGS
                     PYGFENTVTAGIVSAKSRSLPDDTYVPFIQTDVAVNPGNSGGPLFNQRGEVVGINAQI
                     YSQTGGYQGLSFAIPIDVATKVQQQLVAHGKVTRGRLGISVQEVNQALAQSFGLPKPT
                     GALVNSVELDSPAARAGLKPGDVIVQLDNDVIDHSGDLPEHVADIKPGTQTSLKIIRK
                     GQPMTLSVTVGTAKDRAVAQKGGGSEAGGRLGLAVRPLTPAEKRDSGIDGGLVVEDVA
                     GPAARVGIQPGDVILSLNGTPISSAEQLRSLVSKSGKQVALLVQRDDARIFIPLDLG"
     misc_feature    163293..164582
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:233695"
     misc_feature    163485..163886
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    164001..164270
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    order(164004..164015,164019..164021,164172..164177,
                     164184..164189)
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    164331..164582
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    order(164334..164345,164349..164351,164490..164495,
                     164502..164507)
                     /gene="degP1"
                     /locus_tag="CNE_2c01440"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            164855..165187
                     /locus_tag="CNE_2c01450"
                     /db_xref="GeneID:10920634"
     CDS             164855..165187
                     /locus_tag="CNE_2c01450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680363.1"
                     /db_xref="GI:339321469"
                     /db_xref="GeneID:10920634"
                     /translation="MQLDFTRAITPGTDRARRLTSTTSTAGSAPKPRRRKKVVAPHWE
                     RGYRSHFYRNERGDKLGEVRLSERGDIPVVYHWAAGNYSGAEGSLAHARARVEETIGF
                     GMRQLSLF"
     gene            complement(165340..166923)
                     /locus_tag="CNE_2c01460"
                     /db_xref="GeneID:10920635"
     CDS             complement(165340..166923)
                     /locus_tag="CNE_2c01460"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein"
                     /protein_id="YP_004680364.1"
                     /db_xref="GI:339321470"
                     /db_xref="GeneID:10920635"
                     /translation="MNPGSPWQPLWRLRVSMRWLRWLSHRQRQTLLMMLLALATGVEF
                     LENIMFVFASSHIVGGLDADPRSFALVQAAYAVGSMLMILKQQWLSRRFGYRYYLTGA
                     LLLFMAGTVVAATSHALPQMVVARFIQGVGGGALFTSCRILVNVLFGPTARPRATRIF
                     MIGIFSASALGPAFAAELIDHGVWQDVFYGVLPFAALATLGAWLLLPDAEPRADTSGP
                     ALGPLLLFGAAIVTLQAALTEARFDVFSHPLRLALVAAAGLALLAVFLFHQWHHRDPV
                     LHLRALRQPVYLTGLAMYFVYYMISNLSGYLFPIYAEQALKIPLATTGWLNTFAALVS
                     LAGIFVYLQVAPRLTRKKPLMVAGLVLMAATAWWFSQMPPDAGPPALAWGLVGKGLFG
                     VLVIIPIAGLTFRALSPDEFAHGYRSKNLMRQVASSFASALGAVLLQNRQFAVHDSLL
                     HAVGQRPAETEHWMAAMQAALAARGFDAAQAHLGALAQLNGLIEQQARLIACEDIYRL
                     IAVLALGAAAYMLLQRRLA"
     misc_feature    complement(165589..166800)
                     /locus_tag="CNE_2c01460"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(165631..166794)
                     /locus_tag="CNE_2c01460"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(165643..165645,165652..165657,
                     165664..165669,165676..165681,165712..165714,
                     165721..165726,165736..165738,165745..165750,
                     165757..165759,165910..165912,165922..165924,
                     165931..165933,165943..165945,165955..165957,
                     165997..165999,166006..166011,166018..166023,
                     166030..166032,166420..166422,166438..166443,
                     166450..166455,166489..166491,166498..166503,
                     166510..166515,166522..166527,166663..166668,
                     166672..166677,166687..166689,166696..166701,
                     166708..166710,166759..166764,166768..166776,
                     166783..166785))
                     /locus_tag="CNE_2c01460"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(166920..167408)
                     /locus_tag="CNE_2c01470"
                     /db_xref="GeneID:10920636"
     CDS             complement(166920..167408)
                     /locus_tag="CNE_2c01470"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004680365.1"
                     /db_xref="GI:339321471"
                     /db_xref="GeneID:10920636"
                     /translation="MSFEQRIDRFCASHPEAPRDLILASRLLLRTARLLRGHIDQALA
                     PFELDMSQYLLLSMLAVDDNQPSMPSELGTTLDATRTQMTRLLDGLEARGLLRRRASA
                     SDRRSLELTLTPAGRRLLERAAPAVHAAYGEAWAPLGAGGLASATRALTQLHQTLEGL
                     QP"
     misc_feature    complement(166950..167288)
                     /locus_tag="CNE_2c01470"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(166989..167288)
                     /locus_tag="CNE_2c01470"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            complement(167533..169503)
                     /locus_tag="CNE_2c01480"
                     /db_xref="GeneID:10920637"
     CDS             complement(167533..169503)
                     /locus_tag="CNE_2c01480"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="YP_004680366.1"
                     /db_xref="GI:339321472"
                     /db_xref="GeneID:10920637"
                     /translation="MKPVARPLQHDDHGLLLGQLALVLAPQARTLPVAVSLLLVLLLG
                     WRWLLWRRRAPLPSRWMLGITAVMVLLVASALVWQDGGGMGRELAVALLGAFVILKLL
                     ECRALSDATLVTQLSFYLLLTLYLSDQPFWLALYSLAIGAWVLRNWLLLHHPEARSRL
                     AIWPLLGRMALLGLPWALALFVLFPRLEHPLWQLPQSAPRGTTGISDTMRPGSVGQLI
                     RSPEVALRAEVAGPPLPSAALYWRALVLWEYDGTTWHPSRQRRQQLAPAPAAGNTEGI
                     DISITLEPSQQRWLFALDRGQALSAGVDAAATPDGEFMVRGPVDQRIRYRTHSTLSPA
                     PEALTAATRRLALSLPDGNPRARALAAQWADRHADPAARVQAALRLFAAAPFAYTLSP
                     PPLGSEQVDSFLLDTRRGFCEHYASSFVFLMRAAGVPARVVTGYQGGEYNPIGNHYVV
                     RQSDAHAWAEVWLDGRGWVRVDPTGAVAPSRIEQGLDAVVGSEAADWRPSQQPAWLKD
                     LRWAYEGVVYTWQRWVLQYDHAQQQRLLLALGAGVGAGQLLAGVLGALCLLALVPLWR
                     RRGPADPVDAAYARFCALLARHGCERAQAEGPQDFAARASARLPRAADAIAAVSAAYV
                     GLRYSNLPAARHAQALAAMRAGIRQIAAALRH"
     misc_feature    complement(168505..169428)
                     /locus_tag="CNE_2c01480"
                     /note="Domain of unknown function (DUF3488); Region:
                     DUF3488; pfam11992"
                     /db_xref="CDD:256782"
     misc_feature    complement(168007..>168462)
                     /locus_tag="CNE_2c01480"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    complement(168085..168435)
                     /locus_tag="CNE_2c01480"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     misc_feature    complement(<167608..167778)
                     /locus_tag="CNE_2c01480"
                     /note="Domain of unknown function (DUF4129); Region:
                     DUF4129; pfam13559"
                     /db_xref="CDD:257876"
     gene            complement(169500..170531)
                     /locus_tag="CNE_2c01490"
                     /db_xref="GeneID:10920638"
     CDS             complement(169500..170531)
                     /locus_tag="CNE_2c01490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680367.1"
                     /db_xref="GI:339321473"
                     /db_xref="GeneID:10920638"
                     /translation="MAARKSVLRGAPAMAQRRTAGRRPAGETGGTLLLDRRHLYILPT
                     RGGLGFAVVLAAMLLTSLNYNISLGFALTFLLAGIGMACMWLAYRNLLDLAVAAGPAA
                     PAYAGQDAVFQLRIDNRDADARIGIEAHVPTLPNVAIAMLMLEGSASGMLALYVPTAR
                     RGRLVLPRVAIASRFPFGLFRVWSYADLDMSTLVYPAPEPDAPPPPAAYRPDGGDAVH
                     TTASAASSDDGVDQLRRYRSGDPLHRIAWKHSARTGRWLSRAGDPPQQPARWLDWHAL
                     PAGMEAEARLSRLCAWLLAAGDDAEIGLRLPGVELPPARGASHRRACLEALALWPQRP
                     AACRAGDRV"
     misc_feature    complement(169644..169838)
                     /locus_tag="CNE_2c01490"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:250938"
     gene            complement(170537..171463)
                     /locus_tag="CNE_2c01500"
                     /db_xref="GeneID:10920639"
     CDS             complement(170537..171463)
                     /locus_tag="CNE_2c01500"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="MoxR-like ATPase"
                     /protein_id="YP_004680368.1"
                     /db_xref="GI:339321474"
                     /db_xref="GeneID:10920639"
                     /translation="MTARPRIVASLSEAQAQLGRIVLGKPQQVRLALACMLARGHLLL
                     EDVPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSVFVRDAGEFRFHRGPVF
                     AQVVLADEINRAPPKTQSALLEAMAEGQVTHDGTTHALPSPFFVIATQNPLEQIGTHA
                     LPESQLDRFTMRLSLGYPDPVFERVLYLGGASAPELPPVMDGSQVLALQEAAAQVYAS
                     PALVDYVLALVQATRSHGGFAAGLSPRAGLALLACARAWALLAQRNMVLPEDVQAVFT
                     AVATHRLLPAGAGGHAAVAGELAALQAGVAIP"
     misc_feature    complement(170609..171463)
                     /locus_tag="CNE_2c01500"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    complement(170933..171373)
                     /locus_tag="CNE_2c01500"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(171305..171328)
                     /locus_tag="CNE_2c01500"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(171014..171016,171137..171139,
                     171302..171325))
                     /locus_tag="CNE_2c01500"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(171134..171151)
                     /locus_tag="CNE_2c01500"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(170960..170962)
                     /locus_tag="CNE_2c01500"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            171719..172540
                     /locus_tag="CNE_2c01510"
                     /db_xref="GeneID:10920640"
     CDS             171719..172540
                     /locus_tag="CNE_2c01510"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium channel protein"
                     /protein_id="YP_004680369.1"
                     /db_xref="GI:339321475"
                     /db_xref="GeneID:10920640"
                     /translation="MTSLDPCADLPSSVLSADPGALPRLVQAFHANGFVILRGFADEP
                     ACAALEAVTREHLAVAVPPVEFEADLGYPGAPAARDAAGGGTVRRLRQAYGRDEVFRR
                     WASDPQLVAVVQALLGEPARITLAHHNCVMTKHPHYGSQTGWHRDTRYWSFARPELVT
                     VWLALGDEDERNGVLRVIPGSHQAKLEPGQLDPAEFLIEAHPASQPLLDAAQPLALHR
                     GDVLFFDSRLFHAAGRNASNAVKLSVAFAYFGASNRPLDGTRSAEFGSVELPAAV"
     misc_feature    171788..172498
                     /locus_tag="CNE_2c01510"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     cl17312"
                     /db_xref="CDD:266621"
     gene            complement(172556..173389)
                     /locus_tag="CNE_2c01520"
                     /db_xref="GeneID:10920641"
     CDS             complement(172556..173389)
                     /locus_tag="CNE_2c01520"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004680370.1"
                     /db_xref="GI:339321476"
                     /db_xref="GeneID:10920641"
                     /translation="MASPADSRQNPPQAPQTAAATPEKPSDSYVQSFARGLSVIRAFN
                     AQHPAQTLTEIAQASGLTRAGARRILLTLVGLGYVQADGRLFRLTPKILDLGFAYLTS
                     MPFWNLAEPIMETLSQQVHESCSISVLDGTEIVYVLRVPARKIMTINLSIGSRLPAYC
                     SSMGRVLLAGLAEPELDSVLRATELRARTGRTVTDVDALKAIVADIRKRGWALNDQEL
                     EEGLVSLAAPIRNRAGHTIAAINISGQANRTSAQEMLERFLPPLLEASEKISGLVGLR
                     T"
     misc_feature    complement(172571..173314)
                     /locus_tag="CNE_2c01520"
                     /note="beta-ketoadipate pathway transcriptional
                     regulators, PcaR/PcaU/PobR family; Region: pcaR_pcaU;
                     TIGR02431"
                     /db_xref="CDD:131484"
     misc_feature    complement(173039..173302)
                     /locus_tag="CNE_2c01520"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    complement(172580..172957)
                     /locus_tag="CNE_2c01520"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(173508..175109)
                     /locus_tag="CNE_2c01530"
                     /db_xref="GeneID:10920642"
     CDS             complement(173508..175109)
                     /locus_tag="CNE_2c01530"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein"
                     /protein_id="YP_004680371.1"
                     /db_xref="GI:339321477"
                     /db_xref="GeneID:10920642"
                     /translation="MQQTPVPAGPDASAPAVPAALAPAAPTPQRPRMQLASHPEMGHW
                     RLSLFGLTLGLVTGIDFSSTLMMGVASQHIQGGVGAAPEDYLYAISAYAATAVLMNMV
                     LDQVARRITYKRFTMGSLLVFVLGSLICAEFASPTGLITGKAVQGLGAGGLFAASRIL
                     VQLVSTPAERGPLMLRFGGGAFSMLAITPWLTSIFLDDIGWRAVFLFQAGIALPVLLS
                     VALTYPTRAPRDPHPPVSTLDWPAAIAAALGALVFLHTLQEMRYTRFFSSLEMPLAAL
                     CGLALFAFSGWRLYRHPDPWIDFSRLAGRQYLYGLGFYTLYYLLSSAWSFLLPSLTQT
                     GLGLTFRTTCMLLSTSGTVSTIGAVVITLGMALVFRKRRVIAIGFVVYACAAMLLSHQ
                     LMPGAPDYALVPVVLLEGLTPVLLMVQVASMTYLEVPVEDFSHAYQFKNVCKQIASAM
                     GTGLASVFMQDGLAQHRTHLVEHITRYNPVLQAPDALSATSLAKISLEVDRQATLLAG
                     MDMLHGFAVLCVVAAVFVLAQRSFR"
     misc_feature    complement(173661..174974)
                     /locus_tag="CNE_2c01530"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    complement(<174435..174959)
                     /locus_tag="CNE_2c01530"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(174555..174557,174573..174578,
                     174585..174590,174624..174626,174633..174638,
                     174645..174650,174657..174662,174798..174803,
                     174807..174812,174822..174824,174831..174836,
                     174843..174845,174894..174899,174903..174911,
                     174918..174920))
                     /locus_tag="CNE_2c01530"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            175171..176151
                     /locus_tag="CNE_2c01540"
                     /db_xref="GeneID:10920643"
     CDS             175171..176151
                     /locus_tag="CNE_2c01540"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680372.1"
                     /db_xref="GI:339321478"
                     /db_xref="GeneID:10920643"
                     /translation="MNETIQWNDWEAFCCVVEQGTFTAAAEQLDCPKSRVSAAVARLE
                     TAIGAKLLERTTRRMRLTDAGKAVYRDVAPLFARLREIRQETLAREERVQGVLRIATP
                     YEFGAQQLGGVICRTLAAHPALDVAVEITQGLVDPIRDGFDVAFVVVDTDLPDSGTVA
                     RRIYHVERGLFAAPALADSLPAQLRPEDLANMPTLTTPGDTVWEFTRDGQTVSVPIRP
                     RMQTHNAELRVQGALAGLGIARLSVIYCEAEIAQGRLVRVLPDYPLPPLRVFALLPDR
                     RLQPRKVRAFMEAIESMMVSELEPNAGLDGGMGAEAAASGHAEGEAHPAG"
     misc_feature    175183..176070
                     /locus_tag="CNE_2c01540"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    175189..175368
                     /locus_tag="CNE_2c01540"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    175453..176040
                     /locus_tag="CNE_2c01540"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(175483..175485,175495..175497,175612..175614,
                     175660..175662,175666..175668,175843..175845,
                     175894..175896,175975..175977)
                     /locus_tag="CNE_2c01540"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(175486..175491,175501..175506,175510..175515,
                     175522..175524,175534..175536,175540..175560,
                     175747..175749,175825..175839,175858..175863,
                     175870..175872)
                     /locus_tag="CNE_2c01540"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(176205..176486)
                     /locus_tag="CNE_2c01550"
                     /db_xref="GeneID:10920644"
     CDS             complement(176205..176486)
                     /locus_tag="CNE_2c01550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680373.1"
                     /db_xref="GI:339321479"
                     /db_xref="GeneID:10920644"
                     /translation="MKTITQRRSLALSLLCAVSLSFAAAAAHASEPVSDIARLDGSIA
                     HVGKADPFLDGAKIGQPDPYTDGARVGKPDPFTDGANVTDRRDAFTDGA"
     gene            complement(176627..177439)
                     /locus_tag="CNE_2c01560"
                     /db_xref="GeneID:10920645"
     CDS             complement(176627..177439)
                     /locus_tag="CNE_2c01560"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004680374.1"
                     /db_xref="GI:339321480"
                     /db_xref="GeneID:10920645"
                     /translation="MLGIRWRKSAKRRKARAQRARPRARGRSRNRGARNYRGRAPRRQ
                     HKPVSQVTCPAHSCIVPASGYGRICAVADTFTRHRKNAPMFSEIALFLLDTVFTLFGM
                     ALLLRVWMQLTRLPTRNAVSQGVFQITDWLVRPLRRIIPGLGGIDWATVVGAWLTAVV
                     FLVLVALISGIDLLGFLPAMLLTALLYVLKWAISLVMWVTLLMAILSWVNPHSPVTPA
                     IDHLTAPVLRPIQRVVPRLGGFDVSPLVLFVIAQILLMVIARLGAGIFGMHY"
     misc_feature    complement(176939..177163)
                     /locus_tag="CNE_2c01560"
                     /note="YGGT family; Region: YGGT; pfam02325"
                     /db_xref="CDD:251224"
     misc_feature    complement(176657..176875)
                     /locus_tag="CNE_2c01560"
                     /note="YGGT family; Region: YGGT; pfam02325"
                     /db_xref="CDD:251224"
     gene            177429..177887
                     /locus_tag="CNE_2c01570"
                     /db_xref="GeneID:10920647"
     CDS             177429..177887
                     /locus_tag="CNE_2c01570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680375.1"
                     /db_xref="GI:339321481"
                     /db_xref="GeneID:10920647"
                     /translation="MPSKSAPSRKSTSLTKADFEALSDFRYQLRRFLRFSEDAAREEG
                     LTVQQYLLLLHIRGCADKDWASIGELAERLQAKQHGVVALVNRCEAAGLVKRRLNPED
                     RRVVQVHLLAKGERYLNRLAMLHRSELESLRGAFRVARITQFNDDGAERG"
     misc_feature    177504..177824
                     /locus_tag="CNE_2c01570"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    177549..177830
                     /locus_tag="CNE_2c01570"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            178020..178739
                     /locus_tag="CNE_2c01580"
                     /db_xref="GeneID:10920646"
     CDS             178020..178739
                     /locus_tag="CNE_2c01580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680376.1"
                     /db_xref="GI:339321482"
                     /db_xref="GeneID:10920646"
                     /translation="MSIPFRSVVLAVLGAGALAGCASPYGYDNGYGGGYGGSYGGGYN
                     SSGYGSSGYGGSTTISGYPAQQGYPQASGYPQGYPQQGYPQQGYPQQGYPQQEYPQSS
                     YPQQPYPQQSYPDGSYGNNHGNQAYGVRYGWVEAIEVVPGQPPSTSGAGAVVGGIVGG
                     LLGHQVGGGRGNTVATIGGAVAGAVAGNEVEKRTGSSAAAYRVRVRTSDNAYLTLTQS
                     NAYQMRIGDRVKVENGVAVPY"
     misc_feature    <178200..>178454
                     /locus_tag="CNE_2c01580"
                     /note="Topoisomerase II-associated protein PAT1; Region:
                     PAT1; pfam09770"
                     /db_xref="CDD:255543"
     gene            complement(178736..180286)
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /db_xref="GeneID:10920648"
     CDS             complement(178736..180286)
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase LcfB"
                     /protein_id="YP_004680377.1"
                     /db_xref="GI:339321483"
                     /db_xref="GeneID:10920648"
                     /translation="MQSEQQRALRNTIPDAIARAVRRSPGKTAIRFGDRAWTYRQLDE
                     AAARVAGALAQWGLRSGDRVAAFGKNSDAYVLLWLACLRSGLIHVPVNFSMTRAEAEY
                     IVTQSGASAIFADPALADRVDGLPCKVSGTLHGGKVRDILVAAAANGPVSPVSEALTD
                     NTPAQILYTSGTTSAPKGAVLTHRALLAEYGSTIAACDIRASDYSLAALPLYHSAQMH
                     VFLMPLLLCGGTTLIADSPEAGYCLRTIHAEGITSFFAPPTVWIALLRHADFDPARLG
                     SLTKAYYGASIMPVPVLLELQQKLPALRFYNCYGQSEIGPLATVLGPDEHAGRPASAG
                     RPVLNVETRIVDETMQDVLPGELGEIVHRSPQLLTEYWAKPEQTAEAFTGGWFHSGDL
                     GYMDAEGYLYVVDRIKDVINSGGVLVSSREVEECLYTHGAVAEAAVFALPHPKWVEAV
                     AACVVRKRGHEDAAEEELIAHARQALAPFKVPKRIVFVADLPRNTAGKLLKRQLREDY
                     AQLFGTQA"
     misc_feature    complement(178748..180286)
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="acyl-CoA synthetase; Validated; Region: PRK08316"
                     /db_xref="CDD:181381"
     misc_feature    complement(<179621..180175)
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(178772..179800)
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="Bacterial Bile acid CoA ligases and similar
                     proteins; Region: BACL_like; cd05929"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(179756..179761,179765..179782,
                     179789..179791))
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(179756..179761,179765..179782,
                     179789..179791))
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(178793..178795,179036..179038,
                     179069..179071,179078..179080,179114..179116,
                     179351..179368,179432..179437,179780..179782))
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(178850..178852,179036..179047,
                     179069..179071,179078..179080,179114..179116,
                     179351..179368,179432..179437,179498..179500,
                     179507..179512,179516..179518,179657..179662,
                     179780..179782))
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="putative active site [active]"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(178850..178852,178868..178870,
                     179039..179047,179435..179437,179498..179500,
                     179507..179512,179660..179662))
                     /gene="lcfB1"
                     /locus_tag="CNE_2c01590"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213295"
     gene            complement(180399..181109)
                     /gene="clcD"
                     /locus_tag="CNE_2c01600"
                     /db_xref="GeneID:10920649"
     CDS             complement(180399..181109)
                     /gene="clcD"
                     /locus_tag="CNE_2c01600"
                     /EC_number="3.1.1.45"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymethylenebutenolidase ClcD"
                     /protein_id="YP_004680378.1"
                     /db_xref="GI:339321484"
                     /db_xref="GeneID:10920649"
                     /translation="MTAIPDSQWICVDTAAGSFDAYLSLPPAGVQPGAPGIVLLQEIF
                     GVNEHIRAVADQYAADGYAVLAPDVFWRQAPRVQLGYEGDDMARAMALRKAVDVPAAL
                     DDIAATVQVLRQHTGAGKVAAVGYCFGGLLSYLSAARGLVDAAVPYYGGGIQNQLQEA
                     ANIRVPVQFHYGALDAHIPPGAVQGVRDAMTGKPGSEIFVYEGADHGFNCWARGSYHQ
                     PSAALAHGRALVFLSEAL"
     misc_feature    complement(180402..181076)
                     /gene="clcD"
                     /locus_tag="CNE_2c01600"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     gene            complement(181204..181971)
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /db_xref="GeneID:10920650"
     CDS             complement(181204..181971)
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /EC_number="3.1.4.4"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D"
                     /protein_id="YP_004680379.1"
                     /db_xref="GI:339321485"
                     /db_xref="GeneID:10920650"
                     /translation="MRRAARACCHSPTQRSAVTYRFIRRAVLGLGLAAAVSAFTSFSP
                     FALLAHARSASTFDQVTDTIANSISETFNEAVANHFPTRAGKPAQPAQPPDAKPVPAR
                     PFADGSGYTLCFVPDGASCQALLVNAIRSTRHRLLIQAYSFTSAPIAEAVAQAHRRGV
                     DVRVILDKSQQSERYTSATYLKHAGVPVVIDNKPAIAHNKVMVFDDQAVFTGSFNFTK
                     SAQERNAENGMLIRGDAAVVRAYTDNWNKRYKQSRAY"
     misc_feature    complement(181219..181647)
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /note="Catalytic domain of EDTA-resistant nuclease Nuc
                     from Salmonella typhimurium and similar proteins; Region:
                     PLDc_Nuc; cd09170"
                     /db_xref="CDD:197267"
     misc_feature    complement(181234..181599)
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(order(181294..181296,181327..181329,
                     181333..181335,181372..181374,181378..181380))
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /note="putative active site [active]"
                     /db_xref="CDD:197267"
     misc_feature    complement(181378..181380)
                     /gene="pld1"
                     /locus_tag="CNE_2c01610"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197267"
     gene            182154..182360
                     /locus_tag="CNE_2c01620"
                     /db_xref="GeneID:10920651"
     CDS             182154..182360
                     /locus_tag="CNE_2c01620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680380.1"
                     /db_xref="GI:339321486"
                     /db_xref="GeneID:10920651"
                     /translation="MSNHTYKLVEIVGSSPDGCDQAIQSAIEKAGETIKNIDWFEVVE
                     TRGHITNGKIAHYQVTLKVGFRVT"
     misc_feature    182163..182354
                     /locus_tag="CNE_2c01620"
                     /note="Dodecin; Region: Dodecin; pfam07311"
                     /db_xref="CDD:254151"
     gene            complement(182537..184204)
                     /locus_tag="CNE_2c01630"
                     /db_xref="GeneID:10920652"
     CDS             complement(182537..184204)
                     /locus_tag="CNE_2c01630"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin activation/secretion protein"
                     /protein_id="YP_004680381.1"
                     /db_xref="GI:339321487"
                     /db_xref="GeneID:10920652"
                     /translation="MRARHRVAALLVSVGAFHHGLVQADPRSPVQGDPTQTLPKIAPA
                     RPDSSVTVQVERPQAAMQDLLNTRLTPRRFRIEGAKTLPFEEVAAQFKPLANREITVA
                     QLLEAASTVTQMYKDRGYPLSFAFVPAQDFANGDVLITVVEGYVAKVTVTGKAGPAEG
                     RLRAIAEKLQQDRPLRQDRFEHYVNALALQPGLQVAATVQPPTTTDGACEMVLDVKRK
                     PFTFGTGIEYMSPGLRAIATATTNSLTPLGEQISVSALFPKGRDNEEYYAASYAQPLG
                     TEGMIARLNASHYRGVPQNATLEAIGFNPRYVNDTKRIGGSLSYPLLLSNAHSLTLTG
                     GFYGADQFERYTHTATGTRVTLGTNVRVGTAELTYAQRGEGVSRNATLGLYKGFDALG
                     ASRQNNTNDLSFFRTRLLLSQSKDLPAGFGLTVAAAGQYSGDRLASGEQISFGGRFFG
                     LGYPAGEVAGDKGWGASAEISRLFLPDMAYLRTIQPYVSADVARVFSNSVSLSHRSLS
                     SVAIGARFSDRRYYTLDLSVAQPVGDKPTNASHRSPRINMTYSYQFD"
     misc_feature    complement(182543..184189)
                     /locus_tag="CNE_2c01630"
                     /note="Hemolysin activation/secretion protein
                     [Intracellular trafficking and secretion]; Region: FhaC;
                     COG2831"
                     /db_xref="CDD:225387"
     misc_feature    complement(183773..184000)
                     /locus_tag="CNE_2c01630"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     gene            complement(184388..185893)
                     /locus_tag="CNE_2c01640"
                     /db_xref="GeneID:10920653"
     CDS             complement(184388..185893)
                     /locus_tag="CNE_2c01640"
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin-like transmembrane protein"
                     /protein_id="YP_004680382.1"
                     /db_xref="GI:339321488"
                     /db_xref="GeneID:10920653"
                     /translation="MRKQQLAVTALLATLLALGGCASGSGSTSMGTSDTAGTNGGTKT
                     TGTDGTGGMGGSGGSTDLAGGGTGGTGGGTGGTGGTGGTGGNGGNTGGGETPTSLTPT
                     ATVINNAGTVLGNTGSTVTDLGNQLGSANLPLVPTQTQSGLGGVVASTGDAVGALATG
                     LQAGLGSIPNSTNPVGTTVASTGNVVTELGKGVSSAGTAVSGLGTGQLAPLAPLTSPL
                     GTVVDKLGDTVTSTGGTLTTVLSTGAVEQVTTTTSKLIVPITSQLTGATQTLGAATGL
                     GAPTGGLLATVGGALATAGIKLQQTNTPVVSGIGGVVNATGTTVASLGGAVNGPASGG
                     GLGALSPVLAPVTALAGGLTGGAGAGGTGSPLAPVTSLVSTITGGLGSATGGGSGSPL
                     APVTSLVSTFTGGLGSATGGSTGSPLAPATTAVSGVVNGVVGGVSGAAAGTGTTSPLA
                     PVTNVVAAVTGGATSTAGSTTSKGSTTGATGPIGGLVGGLLGGLTGALGQK"
     gene            186624..187730
                     /locus_tag="CNE_2c01650"
                     /db_xref="GeneID:10920654"
     CDS             186624..187730
                     /locus_tag="CNE_2c01650"
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin transmembrane protein"
                     /protein_id="YP_004680383.1"
                     /db_xref="GI:339321489"
                     /db_xref="GeneID:10920654"
                     /translation="MQTKHPSQHSMTSLAAAGVAAIALLMAGCSSSGGGSGANPRPNS
                     NIDTPVTPGPSASGETTPTAKVTEGAGNTVVATGNAISEVGKSIQEAPLPLLPTKARE
                     GAGDVVINAGRAVGSLGAGVRDGLGQIGSVDNPVGVTVASTSNVVHDVGETLISGGDL
                     VYGLGTEKLAPLAPVTEPVGGLVRHVGIAVHDSSGKVHSVLSEGPVAQVTNSVSKVIV
                     PLTSKVTDGTQTLGAVTHLGDPANGLLYKVGNTAAAGGSMISNSHAPVVSPLGGVVTE
                     AGKTVAAAGALLNGNGQGGGNPLGGVVNNLPLAKVAGGGEGGSAGGALSPVTALLAPV
                     TGLVGGLKQGAQDSQGGSGDVKTLQLPLVGGLLR"
     misc_feature    <186879..>186986
                     /locus_tag="CNE_2c01650"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK08591"
                     /db_xref="CDD:236307"
     gene            188101..188280
                     /locus_tag="CNE_2c01660"
                     /db_xref="GeneID:10920655"
     CDS             188101..188280
                     /locus_tag="CNE_2c01660"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbriae protein"
                     /protein_id="YP_004680384.1"
                     /db_xref="GI:339321490"
                     /db_xref="GeneID:10920655"
                     /translation="MKRLIARFIKDERGATAIEYGLIVGLVALAIAVGAGQLGTELNA
                     SFTRLSVKVSGWFVN"
     misc_feature    188101..188265
                     /locus_tag="CNE_2c01660"
                     /note="Flp pilus assembly protein, pilin Flp
                     [Intracellular trafficking and secretion]; Region: Flp;
                     COG3847"
                     /db_xref="CDD:226366"
     gene            188305..188832
                     /gene="cpaA"
                     /locus_tag="CNE_2c01670"
                     /db_xref="GeneID:10920656"
     CDS             188305..188832
                     /gene="cpaA"
                     /locus_tag="CNE_2c01670"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protease CpaA"
                     /protein_id="YP_004680385.1"
                     /db_xref="GI:339321491"
                     /db_xref="GeneID:10920656"
                     /translation="MIAALLCAATLYTDLAYRRVPNALLAAAVLVLGLALLAGQATEL
                     PLAARLTGAGLGLAVTLPAYALGRMAAGDVKFLAVVGLFTGPQGLVVAWVVGSLLGLV
                     HALLALALDSSVLAALRQRAAARLRVAASTPATEQALHHQDRPIPTAQFSRARGIPYA
                     AYLAVGVLVWMAAGQ"
     misc_feature    188305..>188595
                     /gene="cpaA"
                     /locus_tag="CNE_2c01670"
                     /note="Flp pilus assembly protein, protease CpaA
                     [Posttranslational modification, protein turnover,
                     chaperones / Intracellular trafficking and secretion];
                     Region: CpaA; COG4960"
                     /db_xref="CDD:227295"
     gene            188905..189381
                     /gene="tadG"
                     /locus_tag="CNE_2c01680"
                     /db_xref="GeneID:10920657"
     CDS             188905..189381
                     /gene="tadG"
                     /locus_tag="CNE_2c01680"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein TadG"
                     /protein_id="YP_004680386.1"
                     /db_xref="GI:339321492"
                     /db_xref="GeneID:10920657"
                     /translation="MLLHARANRGINRRRHGAGSAAIEFAIVAPVLLAIVIGIIYYGV
                     MLALQQVLTLAAEEGARAALRYPAGVSGSGLAATQGARVDAAAAMARGTLPTSIRNLL
                     PPGNVAQAVPCAPGSTDVCVQVTLNLPTTNILPAVPMVPIPAMLSGSAMVQLSPDI"
     misc_feature    188905..189378
                     /gene="tadG"
                     /locus_tag="CNE_2c01680"
                     /note="Flp pilus assembly protein TadG [Intracellular
                     trafficking and secretion]; Region: TadG; COG4961"
                     /db_xref="CDD:227296"
     misc_feature    188959..189087
                     /gene="tadG"
                     /locus_tag="CNE_2c01680"
                     /note="TadE-like protein; Region: TadE; pfam07811"
                     /db_xref="CDD:254446"
     gene            189432..190385
                     /gene="cpaB"
                     /locus_tag="CNE_2c01690"
                     /db_xref="GeneID:10920658"
     CDS             189432..190385
                     /gene="cpaB"
                     /locus_tag="CNE_2c01690"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein CpaB"
                     /protein_id="YP_004680387.1"
                     /db_xref="GI:339321493"
                     /db_xref="GeneID:10920658"
                     /translation="MTSKQIRLLAGVLLGLALLLALLAWQVGRQPAQVPAASNAARPL
                     HPVVVTTRAAEAGKPLDADALKVEMLPIDPAGAYSEVARVTGQVPLLALGANVPVLES
                     QLLAGLATQVREGERAVAVSVDEVIGVGNQVQPGDYVDVFLVLRRDQQEIPESQARML
                     LSRLRVLAYGVASVNRPQNAKPEQMMARQEGAKTAVLSVPLEQVSRLAMAQQSGRLLL
                     ALRNPQDEAMPSDGMFAEPQPALAARAGVPADAPRAAPDKAMAGVVLSGLAATTGASA
                     PRAPVAAPVPRPLQVAAPPAPALARQSAGVEVIRAGKREIE"
     misc_feature    189567..189743
                     /gene="cpaB"
                     /locus_tag="CNE_2c01690"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     gene            190405..191844
                     /gene="cpaC"
                     /locus_tag="CNE_2c01700"
                     /db_xref="GeneID:10920659"
     CDS             190405..191844
                     /gene="cpaC"
                     /locus_tag="CNE_2c01700"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein secretin CpaC"
                     /protein_id="YP_004680388.1"
                     /db_xref="GI:339321494"
                     /db_xref="GeneID:10920659"
                     /translation="MHIQKNQARKYQARKYPHSAALRRRLMQLALAAMLATTAWCALA
                     PRARAQEAVNARQLRLLAGAQKEIRSAQPVERVAVGNPAVADALVLRTRGAPSVLLVA
                     KQPGVTDVMVWTRGGAEPLTYNVQVDAIAPDADGAKLGYSAAGTTITGQSPDAYAAAR
                     AQAAARAATNGKSDGKPGLVVDRSTVPLSGTVQVDVKVVEISKTVLKEVGINFFRNNS
                     GFAFGTFSPSTLNKFTFTPGSGGAPGSFSADIASPMSNAFNLVAASLTHGIFANISLL
                     EANGLVRVLAEPSLVALSGQSASFLAGGEIPIPVPQALGTTTIQFKPFGIGLTVSPTV
                     LSADRIALKVAPEASDLDPSRGISINGAVVPAIVTRRADTTVELGDGESFVIGGLVSR
                     NTVSNVNKVPVLGDLPVIGAFFKNLNFHQEDRELMIVVTPRLVKPLAKGAPAAQAVGA
                     DGRTSGNPNVWGWYVLGEYADPTLPGFSK"
     misc_feature    190564..190788
                     /gene="cpaC"
                     /locus_tag="CNE_2c01700"
                     /note="Pilus formation protein N terminal region; Region:
                     T2SS-T3SS_pil_N; pfam13629"
                     /db_xref="CDD:257939"
     misc_feature    190576..191838
                     /gene="cpaC"
                     /locus_tag="CNE_2c01700"
                     /note="Flp pilus assembly protein, secretin CpaC
                     [Intracellular trafficking and secretion]; Region: CpaC;
                     COG4964"
                     /db_xref="CDD:227299"
     misc_feature    191227..191712
                     /gene="cpaC"
                     /locus_tag="CNE_2c01700"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            191891..193132
                     /gene="cpaE"
                     /locus_tag="CNE_2c01710"
                     /db_xref="GeneID:10920660"
     CDS             191891..193132
                     /gene="cpaE"
                     /locus_tag="CNE_2c01710"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly ATPase CpaE"
                     /protein_id="YP_004680389.1"
                     /db_xref="GI:339321495"
                     /db_xref="GeneID:10920660"
                     /translation="MDYFLLHATQGEVKDWLGRVLGGLGTLVAEGGAQEAFLERAAQL
                     RPGLVFLHFSTELAGASARLGEQLLRLFPGLPLVAVGHADEPGIMLAALRVGVKDFID
                     LRDAPADAEAVVKRLAVPGEQVRPAQSVRQGKIVALLGARPGVGVTSLAVNLAAAARR
                     HLPLNEKTDARAEVLLLDLGLPARDGALYLNLSPGFHFVEAVRNLRRFDQVFVQTALT
                     RHGNGVCVLPLPAALGELRDISYSEASSLLERLRAFFDMQIIDLGGFGNAEFTAQIFK
                     AADSVVLVADQSVGAIVSAAELVHELRAREVERDDLHLLVSRFDARLGVDAAQIAQRV
                     GVQSVGTLPDSRAPLVLAMNRGAVLADDDPHDPYVRALADLLARLGYRAAQARETSLL
                     ARMKDKLPEALRAVRVARTGS"
     misc_feature    191942..193063
                     /gene="cpaE"
                     /locus_tag="CNE_2c01710"
                     /note="Flp pilus assembly protein, ATPase CpaE
                     [Intracellular trafficking and secretion]; Region: CpaE;
                     COG4963"
                     /db_xref="CDD:227298"
     misc_feature    192290..192772
                     /gene="cpaE"
                     /locus_tag="CNE_2c01710"
                     /note="AAA domain; Region: AAA_31; pfam13614"
                     /db_xref="CDD:257927"
     misc_feature    <192815..>193072
                     /gene="cpaE"
                     /locus_tag="CNE_2c01710"
                     /note="inner capsid protein lambda-1 or VP3; Region:
                     lambda-1; cd11674"
                     /db_xref="CDD:212564"
     gene            193134..194450
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /db_xref="GeneID:10920661"
     CDS             193134..194450
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly ATPase CpaF"
                     /protein_id="YP_004680390.1"
                     /db_xref="GI:339321496"
                     /db_xref="GeneID:10920661"
                     /translation="MTQAIEFSDNTPAPFPVSQEFQNIKEAAHEHLLTRIEELGAEFG
                     RWSRTAIQRFVDLELESFTRLRRIPINEAELRQIAEALTKELAGFGPIEDLLNDPAVE
                     DILVNGHLDVYVSRHGVLERIPVRFTDSGHLLRIVRRILAPIGRRLDESNPMVDARLP
                     DGGRINVVIPPLALEGPVVSIRKFRKDPMTPADLQALGTMSPEICDLLQAAVQARCNI
                     LVSGGTSSGKTSLLNALATFVPTTERVITIEDTAELALNHPHVVRLESRPGGFEGTGA
                     VSIRDLLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRL
                     EMLAGFAGFQGSEASLRRQIANAIDFIVQIARLSNGKRRIVSITEITGLGDNIISTQE
                     LYRHEPFMNPDGTETDRWLSLGLLPHSPKLARMRGQGFMLDDRFDV"
     misc_feature    193704..194261
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /note="Type IV secretory pathway component VirB11, and
                     related ATPases. The homohexamer, VirB11 is one of eleven
                     Vir proteins, which are required for T-pilus biogenesis
                     and virulence in the transfer of T-DNA from the Ti
                     (tumor-inducing) plasmid of bacterial to...; Region:
                     VirB11-like_ATPase; cd01130"
                     /db_xref="CDD:238550"
     misc_feature    order(193713..193715,193806..193823,194238..194240)
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238550"
     misc_feature    order(193797..193802,193812..193820)
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238550"
     misc_feature    order(193803..193808,193863..193865,193887..193889,
                     193908..193919,193923..193928,193995..194003,
                     194007..194009,194046..194048,194058..194060,
                     194067..194072,194100..194108,194118..194120,
                     194127..194129,194229..194231)
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238550"
     misc_feature    194010..194027
                     /gene="cpaF"
                     /locus_tag="CNE_2c01720"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238550"
     gene            194443..195369
                     /gene="tadB"
                     /locus_tag="CNE_2c01730"
                     /db_xref="GeneID:10920662"
     CDS             194443..195369
                     /gene="tadB"
                     /locus_tag="CNE_2c01730"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein TadB"
                     /protein_id="YP_004680391.1"
                     /db_xref="GI:339321497"
                     /db_xref="GeneID:10920662"
                     /translation="MSSATLLLAAMALVITGLGLLLLASAQARARREQQQAFLQAQTE
                     QVRLRYAQAPDPALQAPARDLRRRWDDFLRRADLAPTRRTAIVWITPVVLCTLAGAVA
                     GQWLGAVSALIVALAVAAFAAWNRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQ
                     NSIANTEAPLRQCLVQAIHLQRAGKELDQAVLQVGRVYKVEELVLVASVLRLSVRYGG
                     RADVVMERTAAFMRDREQAQRELMALSAETRLSAWILGLLPLVVAGGLFMLNAGYIMM
                     MWKDPTGKSMLLSALALEIAGAFMLYRLAKSI"
     misc_feature    194515..195363
                     /gene="tadB"
                     /locus_tag="CNE_2c01730"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; cl19503"
                     /db_xref="CDD:267856"
     gene            195401..196447
                     /gene="tadC"
                     /locus_tag="CNE_2c01740"
                     /db_xref="GeneID:10920663"
     CDS             195401..196447
                     /gene="tadC"
                     /locus_tag="CNE_2c01740"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein TadC"
                     /protein_id="YP_004680392.1"
                     /db_xref="GI:339321498"
                     /db_xref="GeneID:10920663"
                     /translation="MDRLTLISLSLLVAACGVGVLTLPLLRDWRQRRLAARTIDGALA
                     RQRAAEAAQAAHAAQAAAPAAPGAQAAAKAGAAAPQGRGGAATAIGVQLGARVGERIS
                     AHWLDSRLGRAVVTPEDQQLLEQCGWYGPQSRMLFGVLRLGLPLALALAAMLWQVGAG
                     AFAIVAWGFGTFALAYLAPKWHLRRRAAARLRMVDDELPVLIDMLRLLQGVGLSIDQS
                     LQVIVAEFGSMLRVLGPELARANQQFASGRSREQTLLRIGRLFDSEDLKSLITLLTQV
                     DKHGGAVQEPLRQFGLRMQEARKSRMKDEIGRLTVKMTAVMVVSLLPVLLILTAGPGF
                     LGVIRMLAHMGGTR"
     misc_feature    <195884..196429
                     /gene="tadC"
                     /locus_tag="CNE_2c01740"
                     /note="Flp pilus assembly protein TadC [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: TadC; COG2064"
                     /db_xref="CDD:224975"
     gene            196444..197307
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /db_xref="GeneID:10920664"
     CDS             196444..197307
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein TadD"
                     /protein_id="YP_004680393.1"
                     /db_xref="GI:339321499"
                     /db_xref="GeneID:10920664"
                     /translation="MTRSVGPALGRISKTAACLLLAALSGCAANQNGAAAMHEQAEAQ
                     VELAKLRDKTARAEYSEQAVYLGLIRKMQQDGLYFASLAHIEVYVKRFGAGPEIQAMR
                     ADALRETGQDKAATDAYQQLAATSQGEQAAHAHHGLGLLAGRQDDFARAVTELRQAAA
                     LDPVNPRISGDLGYALMRAGALQDARVPVMQALELDAHNPRVISNAVVWLMADGKRAQ
                     ANAMMQKAALPEATRSAIRKEADRIARATAARDRAAARPAPAVRAPSKPATTAPATSV
                     AAVAATAGATP"
     misc_feature    196831..197031
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    196852..197121
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(196852..196854,196861..196866,196951..196956,
                     196960..196965,196972..196977,197053..197058,
                     197065..197070,197077..197082)
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(196858..196860,196894..196896,196906..196908,
                     196915..196917,196960..196962,196996..196998,
                     197008..197010,197017..197019,197062..197064,
                     197098..197100,197110..197112,197119..197121)
                     /gene="tadD"
                     /locus_tag="CNE_2c01750"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            197304..197651
                     /locus_tag="CNE_2c01760"
                     /db_xref="GeneID:10920665"
     CDS             197304..197651
                     /locus_tag="CNE_2c01760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680394.1"
                     /db_xref="GI:339321500"
                     /db_xref="GeneID:10920665"
                     /translation="MTAIFRIAIPALCLLMLALAAQAQTDRATTEAATTGMPAGSPAQ
                     REIGADTRAILAIQREGTQAGPMLPMHGEQAALGYERYMNSFRFALPEFYTGQANAST
                     ARSGSAGQMLGGK"
     misc_feature    197427..197600
                     /locus_tag="CNE_2c01760"
                     /note="Protein of unknown function (DUF3613); Region:
                     DUF3613; pfam12266"
                     /db_xref="CDD:152701"
     gene            197648..199336
                     /locus_tag="CNE_2c01770"
                     /db_xref="GeneID:10920666"
     CDS             197648..199336
                     /locus_tag="CNE_2c01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680395.1"
                     /db_xref="GI:339321501"
                     /db_xref="GeneID:10920666"
                     /translation="MSLRQPRLRRAPRSARGAISVMAALLIATVAIAALVSIDVGHVF
                     MRQRQLQNMVDLAAMSAAQQLKRADSAANLNAAVLGTVRNIGAKNGYPSGIAMGCGDA
                     TGGSADAMTACLGVWDPASGGPRHFSAAYNPAQVSPNAVRVQATQTVPILFVINGGGG
                     RQLFAESIASGSPPVAAFSLATGLLDVSTANSMLSVLLGNTVSLSLVDWQGLVNTNVT
                     LDQLRLKADVGTVDQLLNTSLNLRDFYALVLGAAGRDALLTTMLGSPPTALGASGAAA
                     TVSLARLLDLGVMAPAASSAVEVGLNVAQLLLASAQVARGDTAVALPLNIPKLPLGLG
                     GISANLRVIEPPVTAAGPARQLSSNPDTWQTTASASQVKLTLMLQITANILKPVLDAN
                     LNVPLYLDVANATADLTKLQCAANPGDRRATMHVKSGLVTACLTDGCTSSDVVLGQAK
                     LGLFDIADVIATDVPRYGSTAGQEVTLAPGGHAQVGTADPFGGLFSQVLALKVRTKLL
                     GILSVPIDLGPLLAPVGAALDALVPPLLNSLGIQLGTADLWVHSIDCNNAELVY"
     misc_feature    197681..199330
                     /locus_tag="CNE_2c01770"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4655"
                     /db_xref="CDD:227002"
     misc_feature    197696..197839
                     /locus_tag="CNE_2c01770"
                     /note="Putative Flp pilus-assembly TadE/G-like; Region:
                     Tad; pfam13400"
                     /db_xref="CDD:257725"
     misc_feature    197825..198154
                     /locus_tag="CNE_2c01770"
                     /note="Putative Tad-like Flp pilus-assembly; Region:
                     Tad_C; pfam09977"
                     /db_xref="CDD:255671"
     gene            199375..200739
                     /locus_tag="CNE_2c01780"
                     /db_xref="GeneID:10920667"
     CDS             199375..200739
                     /locus_tag="CNE_2c01780"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="PspF family transcriptional regulator"
                     /protein_id="YP_004680396.1"
                     /db_xref="GI:339321502"
                     /db_xref="GeneID:10920667"
                     /translation="MKTDRWAYENLEVYVWEGKYEIADRVTRFLAPLGVDVIRAGALE
                     ALPAEPRLKPCIAVISVSVIGAARFSLDWEAAHGMPVIWVAGPGREADPGRFPPEYAH
                     ILADDFTGADLRSQIGKLLPQLLATDAPGEREADLVAGSPAMRQLLQHVETFADFGSN
                     VMLYGETGAGKERIARLFHERNGTYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGA
                     SFAHRGYFEQANGGTLFLDEIGDLPLFQQVKLLRVLEENVITRLGSTLAVKLDFRLVA
                     ATNKDLRDAVRQGRFRADLFFRLAVIEMRIPSLEERGQADKVALLQSFLRHMLGESGF
                     DALPPMPDWLKGAVGTAYFTGNVRELRNLAERVGITVQQTGHWDEERIRPLFRSLHPG
                     AFDGGERNDLRADTEERRRILAALDANGWRRQDTAASLGISRKVLWEKMRKYQIADSE
                     AEPV"
     misc_feature    199582..200724
                     /locus_tag="CNE_2c01780"
                     /note="Transcriptional regulators containing an AAA-type
                     ATPase domain and a DNA-binding domain [Transcription /
                     Signal transduction mechanisms]; Region: PspF; COG1221"
                     /db_xref="CDD:224142"
     misc_feature    199801..200280
                     /locus_tag="CNE_2c01780"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    199867..199890
                     /locus_tag="CNE_2c01780"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(199870..199893,200083..200085,200209..200211)
                     /locus_tag="CNE_2c01780"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    200071..200088
                     /locus_tag="CNE_2c01780"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    200266..200268
                     /locus_tag="CNE_2c01780"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    200596..200706
                     /locus_tag="CNE_2c01780"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(200755..201111)
                     /locus_tag="CNE_2c01790"
                     /db_xref="GeneID:10920668"
     CDS             complement(200755..201111)
                     /locus_tag="CNE_2c01790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680397.1"
                     /db_xref="GI:339321503"
                     /db_xref="GeneID:10920668"
                     /translation="MKRILTATALTLALGLAATGASAQYTGPSAIPAMTVKALQAEGK
                     DDQHAMLRGKIVSNVGHEHYLFSDGTGQMKVKVKARLWPAQKPVDAQTTVELVGEYDK
                     ELIGESHFDVKEIRLQ"
     misc_feature    complement(200761..>201042)
                     /locus_tag="CNE_2c01790"
                     /note="Bacterial OB fold (BOF) protein; Region: BOF;
                     cl01196"
                     /db_xref="CDD:260828"
     gene            201250..202398
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /db_xref="GeneID:10920669"
     CDS             201250..202398
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /EC_number="3.1.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease SbcD"
                     /protein_id="YP_004680398.1"
                     /db_xref="GI:339321504"
                     /db_xref="GeneID:10920669"
                     /translation="MRFLHTADWHLGRLFHARSLLEDQAHILDQFVELVRTERPDAVL
                     IAGDVYDRAVPPPEAVALLDDVLGRIVIDTGVPVVMIAGNHDSAQRLEFGARLMRAQG
                     LHVAGRTLAEAACVTLHDAHGEVRIYALPYAEPAVVRDAMGTDLPSHEAALRAQLDAI
                     RAVHPPGVRAVVVGHAFVVGGAASESERPLSVGGSGAVAADLFAGFDLVALGHLHRPQ
                     TLGGGRVHYAGSLLKYSLSECAHDKSVSSIELGADGAVTITPVALQALRDVRVVEGEL
                     AQVLAAGADDPQRDDYIHARLTDTGALLDPMARLRQVYPNALAIERTVLARTGTASEA
                     GRKLRQLGTGELFANFFREVADAELEPDQRAVLDQVLTGIAAADRESA"
     misc_feature    201250..202365
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="DNA repair exonuclease [DNA replication,
                     recombination, and repair]; Region: SbcD; COG0420"
                     /db_xref="CDD:223497"
     misc_feature    201253..201960
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="Mre11 nuclease, N-terminal metallophosphatase
                     domain; Region: MPP_Mre11_N; cd00840"
                     /db_xref="CDD:163616"
     misc_feature    order(201271..201273,201277..201279,201391..201393,
                     201499..201504,201772..201774,201886..201894)
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="active site"
                     /db_xref="CDD:163616"
     misc_feature    order(201271..201273,201277..201279,201391..201393,
                     201499..201501,201772..201774,201886..201888,
                     201892..201894)
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163616"
     misc_feature    order(201283..201303,201400..201402,201508..201510,
                     201514..201519,201646..201651)
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:163616"
     misc_feature    202039..202317
                     /gene="sbcD"
                     /locus_tag="CNE_2c01800"
                     /note="Type 5 capsule protein repressor C-terminal domain;
                     Region: SbcD_C; pfam12320"
                     /db_xref="CDD:256978"
     gene            202395..205457
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /db_xref="GeneID:10920670"
     CDS             202395..205457
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /EC_number="3.1.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease SbcC"
                     /protein_id="YP_004680399.1"
                     /db_xref="GI:339321505"
                     /db_xref="GeneID:10920670"
                     /translation="MRPLHLTLQAFGPFAATEQVDFTRLGEQAFVLIHGPTGAGKTTL
                     LDAICFALYGDTSGGERSAQAMRSANAAPALRTEVTLEFSLGAQRWRVARSPVQERPK
                     QRGEGWVTEPARAQLDLHDGNDWVSKASQPARVSDAVRDLLGFDSAQFRQVIVLPQGR
                     FRELLTASSQARQAILERLFRTELYRRVEELLKAEAAGIRRDAERIAIQRDEALRQVG
                     VESAQALAEGIEALQAELQALQGQEQGARATLATAQAALGAGEQVAARLQERQLAQAA
                     HAALLARQPAMEDERARLHAAQRAARVRPALQAWQAAQRDQAASAVALTRAGEQAARA
                     AQQATQAAAALQAETARAEARQSAQRRVSQLADMLPRAQQLGAQLAALQAAEARQVAA
                     ATARERAAAQLATRQADAVAAESALAQGQIAAAQAQATALQLAALQERARQLDRHQQA
                     ARALDVANAQAATAAAAEQLALRQREQCRAALAEAEAAWRAGQAARLAATLAAGDACP
                     VCGSTAHPAPAQHVAAPLSDQALEQARHAALEAESHAVRSAGQHQAAQAAIAQARERL
                     DELAQALGEVGDESARKLKAEITALEAALAEGRQAAASLAQCEVAIVSCRTALAAAEA
                     ASRDAAAAAEAAAQALAHCRGEWQAASAQVPEDSRDPVALGEALRQAQAMLAALEQAL
                     AAAQAAERQAAADAAGAQAGLVSAQQAQAQAAHRLAEAESALAQALAQQGFANEPAHA
                     AACLGDDAMQALDATLRAFDTQLATAADRRERAEAAAQTLDAPDLDGLRAARDASTAA
                     VEALVRQQAERGRSRDTLLQCQLRLQQLDAQGRDIEARYAVLGRLAEVANGNNPRRMT
                     FQRFVLATLLDEVLEAASARLLAMSRGRYVLQRVREQADQRSAGGLDIEVFDHDTGAA
                     RPANTLSGGEGFLASLSLALGLADVVQSRAGGIQLDTLFVDEGFGTLDPESLDFAIRT
                     LLDLQQAGRLVGIISHVTELRERIDVRLEVRPGVGGSRVLLTGVATPA"
     misc_feature    202395..205427
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: SbcC; COG0419"
                     /db_xref="CDD:223496"
     misc_feature    202395..>202892
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    202497..202520
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(202506..202511,202515..202523,202866..202868)
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    202857..202868
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    <205134..205424
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    205152..205181
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    205245..205262
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    205269..205280
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    205344..205364
                     /gene="sbcC"
                     /locus_tag="CNE_2c01810"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(205476..205733)
                     /locus_tag="CNE_2c01820"
                     /db_xref="GeneID:10920671"
     CDS             complement(205476..205733)
                     /locus_tag="CNE_2c01820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680400.1"
                     /db_xref="GI:339321506"
                     /db_xref="GeneID:10920671"
                     /translation="MATVHVPFTSTPHAAALARILHVTQQAWGLKPRKDRLQSPVPAP
                     AGTDMPSRPPPLSRRARLARAAARAFEAQVMAIRCRQVFVA"
     gene            206156..206878
                     /gene="pcaI"
                     /locus_tag="CNE_2c01830"
                     /db_xref="GeneID:10920672"
     CDS             206156..206878
                     /gene="pcaI"
                     /locus_tag="CNE_2c01830"
                     /EC_number="2.8.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /protein_id="YP_004680401.1"
                     /db_xref="GI:339321507"
                     /db_xref="GeneID:10920672"
                     /translation="MRRVLRPAPVAWRIFRPGTQVINKLYDTVEAAVAGIHDGATILI
                     GGFGLAGMPAELIDALIEQGARDLTIVNNNAGNGDTGLAALLKTKRVRKIVCSFPRQA
                     DSYVFDSLYHAGEIELELVPQGNLAERIRAAGAGIGGFFTRTAYGTPLAEGKETRIID
                     GQGYVFETPIHADFALIKADTADRWGNLTYRKTARNFGPIMAMAANCAIVQVSRVVEL
                     GEMDPEHIVTPGLFVKRVVKVA"
     misc_feature    206216..206875
                     /gene="pcaI"
                     /locus_tag="CNE_2c01830"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            206901..207542
                     /gene="pcaJ"
                     /locus_tag="CNE_2c01840"
                     /db_xref="GeneID:10920673"
     CDS             206901..207542
                     /gene="pcaJ"
                     /locus_tag="CNE_2c01840"
                     /EC_number="2.8.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="YP_004680402.1"
                     /db_xref="GI:339321508"
                     /db_xref="GeneID:10920673"
                     /translation="MQRLTRDQMAARVAKDIPEGAVVNLGIGLPTLVGNHLPADKEIL
                     LHSENGLLGMGSAPAPGEEDGDLINAGKQPVTIKPGGSYFHHADSFAMMRGGHLDFCV
                     LGAFQVSEKGDLANWHTGAPGAIPAVGGAMDLAIGAKQVFVMMEHQTKQGESKIVPQC
                     TYPLTGIGCVTRIYTDLATIDVTADGLVARDLVEGLSFDELQRITGVPLKLAA"
     misc_feature    206910..207533
                     /gene="pcaJ"
                     /locus_tag="CNE_2c01840"
                     /note="3-oxoacid CoA-transferase, B subunit; Region:
                     pcaJ_scoB_fam; TIGR02428"
                     /db_xref="CDD:188219"
     gene            207583..208785
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /db_xref="GeneID:10920674"
     CDS             207583..208785
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /EC_number="2.3.1.174"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoadipyl-CoA thiolase"
                     /protein_id="YP_004680403.1"
                     /db_xref="GI:339321509"
                     /db_xref="GeneID:10920674"
                     /translation="MTEAFICDAIRTPIGRYGGSLSAVRPDDLGAVPLKALMARNPNL
                     DWKAIDDVIYGNANQAGEDNRNVARMSALLAGLPQEVPGATLNRLCGSGMDATGTAAR
                     AIKAGEATLMIAGGVESMSRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGV
                     DSMPETAENVATDYKISREDQDLMALRSQEKASRAQADGTLAQEITPVTIAQKKGDPI
                     VVERDEHPRATSMEALAKLRGVVRPDGTVTAGNASGVNDGACALLLASEAGIKQHGLT
                     PRARIVGMATAGVAPRVMGIGPAPASQKLLKQLGMTMDQIDVIELNEAFAAQGLAVLR
                     ELGVADDDKRVNPNGGAIALGHPLGMSGARLVTTAMYQLHRTGGRFALCTMCIGVGQG
                     IAMVIERV"
     misc_feature    207583..208782
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /note="beta-ketoadipyl CoA thiolase; Validated; Region:
                     PRK09050"
                     /db_xref="CDD:181624"
     misc_feature    207595..208779
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(207649..207651,207733..207735,207778..207780,
                     207787..207789,207799..207801,207832..207843,
                     207865..207867,207886..207891,207898..207900,
                     207943..207945,208432..208434,208438..208440,
                     208444..208446,208504..208506,208747..208752)
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(207850..207852,208648..208650,208738..208740)
                     /gene="pcaF1"
                     /locus_tag="CNE_2c01850"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            208876..209607
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /db_xref="GeneID:10920675"
     CDS             208876..209607
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /EC_number="1.1.1.36"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetyl-CoA reductase"
                     /protein_id="YP_004680404.1"
                     /db_xref="GI:339321510"
                     /db_xref="GeneID:10920675"
                     /translation="MSLPVATLVTGGSSGIGRAICEMLLADGVTQVVNVDYAEPAWSH
                     PNMTFFQADLTDAEATRAVAAQVTSRFAVTRLVNNAGATRPGTADTATVADLDYVTGL
                     HLQATLLLTQACLPAMRAAGFGRIVNMASRAALGKAERVVYSATKAGLIGMTRTLAME
                     LGGDGVTVNAVAPGPIATELFRKSNPEGAEQTRRILASITVKRMGTPEDVARAALFFL
                     SPDSGFVTGQVLYVCGGTTLGVAPV"
     misc_feature    208897..209589
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    208897..209580
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(208906..208908,208912..208917,208921..208923,
                     208978..208986,209110..209118,209260..209268,
                     209302..209304,209314..209316,209392..209403)
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(209182..209184,209266..209268,209302..209304,
                     209314..209316)
                     /gene="phbB"
                     /locus_tag="CNE_2c01860"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            209812..210819
                     /locus_tag="CNE_2c01870"
                     /db_xref="GeneID:10920676"
     CDS             209812..210819
                     /locus_tag="CNE_2c01870"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680405.1"
                     /db_xref="GI:339321511"
                     /db_xref="GeneID:10920676"
                     /translation="MRQDSQTSTTRRRLLAAGVALATTIAGFAGAAHAQGGYPTKPIT
                     LIVPFSAGGTTDILARIVGLQLGKALGQPVVIDNRPGAGGNIGASLAAKAPGDGYTLF
                     MGTIGTHAINQSLYSKLPYDPVKDFAPITRVAMVPNLVVVNPKVPVNNVKELITYVKA
                     NPDKLSYGSSGSGSSMHLSGELFNSMTGLHIQHIPYKGSAPAVNDLLGNQIGLMFDNM
                     PSSYPHVKAGKLRAIAVTSAKRSPALPNVPTVAESGVPGYEATSWFALYATGGTPQPI
                     VDRLNAEVVKILAMPEVKKQMADQGAEPNPEKPAQLAAFMKSETAKWAKVVKASGATV
                     D"
     misc_feature    209986..210807
                     /locus_tag="CNE_2c01870"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(210920..212119)
                     /locus_tag="CNE_2c01880"
                     /db_xref="GeneID:10920677"
     CDS             complement(210920..212119)
                     /locus_tag="CNE_2c01880"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_004680406.1"
                     /db_xref="GI:339321512"
                     /db_xref="GeneID:10920677"
                     /translation="MQKLEALAREAAQLAGQDAATPAPQSRIIRVLPLTDNEAEVARQ
                     MQICNACRYCEGFCAVFPAMTRRLEFGKADVNYLANLCHNCGACYHACQYAPPHDFGV
                     NVPQAMAKVRLETYSEYAWPAPLGKLYQRNGLTVSVALAFGLALFLVLAATLGGALWQ
                     THARGNFYAVFPHNTLAALFGGVFAFAVLALGLGVRRFWRDVSAGTASAPAVAEAARN
                     VLALTYLDGGHGDGCNEASDRFTLARRRFHHFTFYGFMLCFASTVVATGYHYLLGWHA
                     PYPVMSLPVLLGTAGGVGLLVGPAGLMWLNLRRHPMHGDARQRPMDRGFIALLLLTSA
                     TGLGLLAGRGTAAMPLLLAVHLGVVMALFATLPYGKFAHGIYRSAALLKAAIEKRQKN
                     KLQLGSD"
     misc_feature    complement(210923..212119)
                     /locus_tag="CNE_2c01880"
                     /note="tricarballylate utilization protein B; Provisional;
                     Region: PRK15033"
                     /db_xref="CDD:237885"
     misc_feature    complement(211820..211978)
                     /locus_tag="CNE_2c01880"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     gene            complement(212106..213515)
                     /locus_tag="CNE_2c01890"
                     /db_xref="GeneID:10920678"
     CDS             complement(212106..213515)
                     /locus_tag="CNE_2c01890"
                     /EC_number="1.3.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate
                     reductase,flavoprotein"
                     /protein_id="YP_004680407.1"
                     /db_xref="GI:339321513"
                     /db_xref="GeneID:10920678"
                     /translation="MVDVLVIGGGNAALCAALMAREAGASVLLLESAPRAWRGGNSQH
                     TRNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTGGITDENLARLVIRASSTCRPWMRRH
                     GVRFQPPLSGALHVARTNAFFMGGGKALVNAYYRSAEAMGVQVRYETPVDTIELDGDR
                     FVAARSGSQRFTARTCVLAAGGFESNREWLREAWGQNERGEWPADNFLIRGTRFNQGV
                     LLRHMIDAGADTIGDPSQSHCVAIDARAPLYDGGICTRIDCVSLGIVVNCDAVRFYDE
                     GEDFWPKRYAIWGRLVAQQPGQIGYSIIDSQAIGRFMPPVFPGEKADTLPELARKLGL
                     PEAQFVRTVQDHNAACRVGTFDHTALDDCHTEGLAPAKTHWARPLDQAPFYGYALRPG
                     ITFTYLGLKVNDCAQVHFGGKPSGNLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIA
                     GTQAALAAGINTGAVHAEA"
     misc_feature    complement(212127..213515)
                     /locus_tag="CNE_2c01890"
                     /note="tricarballylate dehydrogenase; Validated; Region:
                     PRK08274"
                     /db_xref="CDD:236214"
     misc_feature    complement(212142..213500)
                     /locus_tag="CNE_2c01890"
                     /note="precorrin 3B synthase CobZ; Region: CobZ_N-term;
                     TIGR02485"
                     /db_xref="CDD:233889"
     gene            complement(213627..214553)
                     /locus_tag="CNE_2c01900"
                     /db_xref="GeneID:10920679"
     CDS             complement(213627..214553)
                     /locus_tag="CNE_2c01900"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680408.1"
                     /db_xref="GI:339321514"
                     /db_xref="GeneID:10920679"
                     /translation="MELRQLRYFVSVIEHGSMGKAALELGVVTSALSQQISRLESELS
                     TRLLQRTSTGVVATDAGLAFWRQAQLALRHIDDAALAARQARLSGHVSVGLPPSTAAV
                     LALPFMQAMRERYPDVRLRMVESLSGYLGTMLSARQIDLAVLFSEEPAQRWSVLPLLD
                     ERLFVIGAEGLAGMPRGEQTSVAALGKLPLILPSGSHGLRALVAACFRQAKREPQVVA
                     EIDGLAILMDAVRGGLGATIQPGAALARSHGTPYRSILVTDDGATRPNLLVSLSDDEL
                     SPAGLAARVVLADVATTLVREGRWPGATLRPR"
     misc_feature    complement(213663..214553)
                     /locus_tag="CNE_2c01900"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(214371..214547)
                     /locus_tag="CNE_2c01900"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(213693..214286)
                     /locus_tag="CNE_2c01900"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(213858..213863,213867..213872,
                     213888..213905,214182..214202,214206..214208,
                     214218..214220,214227..214232,214236..214241))
                     /locus_tag="CNE_2c01900"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            214753..215739
                     /locus_tag="CNE_2c01910"
                     /db_xref="GeneID:10920680"
     CDS             214753..215739
                     /locus_tag="CNE_2c01910"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680409.1"
                     /db_xref="GI:339321515"
                     /db_xref="GeneID:10920680"
                     /translation="MTTVSRMRRAVVAGLAGTAVLGAPAAFAADNWPTKPITLVVPFA
                     SGGTTDILARTIGQKLGEALQQPVVVDNRPGAGGTLGAANVARAPADGYTFLLATVAH
                     TMAPAIHKSLPYEFTRDLDPVGLVALTPNVLVVNPAIPVKSVSDLIAYIKAHPGKVNY
                     GSAGIGSTEHLSGELFRALTGTDIAHVPYKGGAPMMTDLIAGQIQMAIETSPSASQHV
                     RSGKVRALAVTTAKRSAAYPGVPTLAESGVRGYEVTTWFALMAPRGTPAAIEQRVSAE
                     LGKLLKAPEVQKRFDEQGVTAGDMTPTQLAAFIRAETDKWAKVARDSGAKAE"
     misc_feature    214909..215727
                     /locus_tag="CNE_2c01910"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            215856..217070
                     /locus_tag="CNE_2c01920"
                     /db_xref="GeneID:10920681"
     CDS             215856..217070
                     /locus_tag="CNE_2c01920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680410.1"
                     /db_xref="GI:339321516"
                     /db_xref="GeneID:10920681"
                     /translation="MDVASLNTEEPTMHDLSFVHADAAHVEWQVALADCQRQLDTQDF
                     LRQAKADNAPPLTLGWCYLSDYYALAAEAILAALQQNWPGVSWVGTVGLGVSASGKEY
                     FDEPAMVLMAAPFPRDAFQLFSGRQPLPSASSGFVPHTALVHAEGSTPDVQDLLHELS
                     ARTATGYLFGGLSSARNRTLHIADGVFSGGLSGVLFGPEIELVSRVTQGCQPIGPVRA
                     VTRSDHNLLFELDGKPALDCILHDLGVERDAQVETMAEALSGTLAGLNSAADDAPVLP
                     GRFGSDTLVRHLIGLDVQHRMLALADMVEPGMRLAFCMRNADAARADLVRVATEIRTE
                     IERGGSRARGALYISCSGRGGPHFGAPHAELQTVRRALGDLPLAGFFAGGEIARDHLY
                     GYTGVLTVFTGH"
     misc_feature    216018..216557
                     /locus_tag="CNE_2c01920"
                     /note="FIST N domain; Region: FIST; pfam08495"
                     /db_xref="CDD:254834"
     misc_feature    216558..217019
                     /locus_tag="CNE_2c01920"
                     /note="FIST C domain; Region: FIST_C; pfam10442"
                     /db_xref="CDD:255992"
     gene            complement(217072..218118)
                     /locus_tag="CNE_2c01930"
                     /db_xref="GeneID:10920682"
     CDS             complement(217072..218118)
                     /locus_tag="CNE_2c01930"
                     /EC_number="2.5.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="farnesyl-diphosphate farnesyltransferase"
                     /protein_id="YP_004680411.1"
                     /db_xref="GI:339321517"
                     /db_xref="GeneID:10920682"
                     /translation="MRDPSRAFLLGPLLKGVSRSFYLTLRVLPVHMRDPVGLAYLLAR
                     AADTIADTSLIPPQRRLTLLLSLRDQVNGATADSALADSIATEVAGRQEQSDERILLQ
                     SLGPALALLAQLEPDDQQAVRQIVSTLTEGMEFDLRTFPDEHAGRIVALGEPEALDRY
                     TYLVAGCVGEFWTSMTAAHVPGAIRVPDAMLRRGVRFGKALQMTNVLRDCGKDLRIGR
                     CYLPATMLHQHGLSPQDLLLPDASLRARALMLELVHDTLDHFHEAMAYTLAIPPHFIR
                     LRLACLWPVLIGMETLLLLVRNDDWLDPAKTSRLQRSKVYRIIACSLPMVPSNSLLRI
                     WFARQMRNIDAVIR"
     misc_feature    complement(217168..218082)
                     /locus_tag="CNE_2c01930"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-head; Region: Trans_IPPS_HH; cd00683"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(217183..217194,218056..218070))
                     /locus_tag="CNE_2c01930"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(217276..217281,217465..217467,
                     217480..217485,217492..217497,217516..217518,
                     217525..217527,217612..217614,217624..217626,
                     217639..217641,217966..217968,217978..217980,
                     217987..217989,217999..218001,218056..218058,
                     218062..218064))
                     /locus_tag="CNE_2c01930"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(217264..217266,217276..217281,
                     217465..217467,217480..217482,217492..217497,
                     217516..217518,217603..217605,217615..217617,
                     217639..217641,217966..217968,217978..217980,
                     217999..218001,218056..218058))
                     /locus_tag="CNE_2c01930"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(217480..217494,217966..217980))
                     /locus_tag="CNE_2c01930"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173831"
     misc_feature    complement(217966..217980)
                     /locus_tag="CNE_2c01930"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173831"
     misc_feature    complement(217480..217494)
                     /locus_tag="CNE_2c01930"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173831"
     gene            complement(218230..218886)
                     /locus_tag="CNE_2c01940"
                     /db_xref="GeneID:10920683"
     CDS             complement(218230..218886)
                     /locus_tag="CNE_2c01940"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="YP_004680412.1"
                     /db_xref="GI:339321518"
                     /db_xref="GeneID:10920683"
                     /translation="MRSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRL
                     SPRNRYVAAELNRCGMATLLMDLLLPEEDQVQAIRFDVELLATRLAQATSWVARQQAV
                     PQRFGYFGASVGGAASIRAACQSPIPIHAVVSRGGRVDLAGPDALAKLLAPTMLIIGG
                     LDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALESVARLAAQWFERYLGKDSP
                     "
     misc_feature    complement(218317..218793)
                     /locus_tag="CNE_2c01940"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            219044..219529
                     /gene="sixA"
                     /locus_tag="CNE_2c01950"
                     /db_xref="GeneID:10920684"
     CDS             219044..219529
                     /gene="sixA"
                     /locus_tag="CNE_2c01950"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidine phosphatase SixA"
                     /protein_id="YP_004680413.1"
                     /db_xref="GI:339321519"
                     /db_xref="GeneID:10920684"
                     /translation="MKTLFLVRHAKSSKDDPSLPDRERPLNDRGRQDAPEMGKRLAER
                     KLKPDLLLSSPALRALTTAQLIADELGYARKDIALDDQLYATSAEELLAVVRALDKKL
                     DCVMLFGHNPEFTDFAHRLSDEITDMPTCAVARFSFDTKAWEDVGEITPSKVTLESPK
                     E"
     misc_feature    219050..219466
                     /gene="sixA"
                     /locus_tag="CNE_2c01950"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    order(219065..219070,219215..219217,219371..219376)
                     /gene="sixA"
                     /locus_tag="CNE_2c01950"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            219655..220581
                     /locus_tag="CNE_2c01960"
                     /db_xref="GeneID:10920685"
     CDS             219655..220581
                     /locus_tag="CNE_2c01960"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680414.1"
                     /db_xref="GI:339321520"
                     /db_xref="GeneID:10920685"
                     /translation="MIPPVSTLHGRLKMQHLRLLLAVEERGSLRQAAEALTLTQPAVS
                     KMLQDMEDLLGVPLFERHARGLRATRFGLAATRYARLVFADMGGLRDELVALESGKIG
                     RVRVGAVMAPTPGLLADVIRRLNRDHPRLEVAVHVETSDVLMPQLERDQLDIVLGRVP
                     DGWDSSGLEFEQLGDEGLAIVVGPQHPLARRRKLSFEELTGYPWIMQPRPSPMRALID
                     RSFEDAGVPAPPSTIETAAVLMTTSLLADSELIAVLPESVAAYYGRLGALAVLPLPLP
                     RKLGPYGIVTRRGRPPTASMSLLIDALRALSR"
     misc_feature    219682..220578
                     /locus_tag="CNE_2c01960"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    219694..219870
                     /locus_tag="CNE_2c01960"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    219961..220563
                     /locus_tag="CNE_2c01960"
                     /note="The C-terminal substrate binding domain of
                     galactose-binding protein regulator contains the type 2
                     periplasmic binding fold; Region: PBP2_GbpR; cd08435"
                     /db_xref="CDD:176126"
     misc_feature    order(220006..220011,220015..220020,220027..220029,
                     220039..220041,220045..220065,220348..220365,
                     220381..220386,220390..220395)
                     /locus_tag="CNE_2c01960"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176126"
     gene            complement(220585..222168)
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /db_xref="GeneID:10920686"
     CDS             complement(220585..222168)
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /EC_number="1.2.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent fatty aldehyde dehydrogenase
                     AldH"
                     /protein_id="YP_004680415.1"
                     /db_xref="GI:339321521"
                     /db_xref="GeneID:10920686"
                     /translation="MTLSGELLIGRRAERGGNGTIRAIDAATGATLEPAFGGATAAQL
                     DRACALAWQAFDAYRETAPERRADFLEAIAANILALGDALIERCTSESGLPRARIEGE
                     RGRTVGQLRMFASLLRQGDFLELRVDPAQPERKPLPRVDLRLRHIPLGPVAVFGASNF
                     PLAFSVAGGDTASALAAGCPVVVKAHPAHPGTSELVGRAIRKAVDDMDLPEGTFSLLF
                     DAGLKVGQGLVADPRIKAVGFTGSRAGGMALMAIAAARSEPIPVFAEMSSINPVLLFP
                     HALANRAEAIGTAFADSLTLGAGQFCTNPGLVLAVAGDDLDRFLHAAAARLGVLPAAT
                     MLTPGIHRAYCAGVDTLASHAQVQTVARGAAGSAAQGQAALFATDAGAFLADEALRHE
                     VFGAASLVVRCRDLTEMRRVIDALEGQLTAALHIDDADHDAARTLLPALERLAGRILV
                     NGFGTGVEVGHAMVHGGPWPATSDGRSTSVGSLAIARFLRPVSYQDMPPGLLPASLRP
                     DSPQRHAWRLDGKLQGMPG"
     misc_feature    complement(220681..222039)
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /note="Alpha-Ketoglutaric Semialdehyde Dehydrogenase;
                     Region: ALDH_KGSADH; cd07129"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(220684..220695,220699..220704,
                     220762..220767,220777..220782,220795..220797,
                     220819..220821,220825..220836,220840..220842,
                     220852..220854,220864..220866,220927..220929,
                     221419..221421,221428..221430,221737..221739,
                     221743..221745,221785..221787,221989..221991,
                     222001..222003))
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(221434..221436,221443..221445,
                     221452..221454,221491..221493,221608..221613,
                     221617..221619,221695..221697))
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(221263..221265,221272..221274,
                     221374..221376,221692..221694))
                     /gene="aldH1"
                     /locus_tag="CNE_2c01970"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143447"
     gene            complement(222189..223121)
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /db_xref="GeneID:10920687"
     CDS             complement(222189..223121)
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /EC_number="4.2.1.52"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase DapA"
                     /protein_id="YP_004680416.1"
                     /db_xref="GI:339321522"
                     /db_xref="GeneID:10920687"
                     /translation="MTRTPSPNVYRGVFPVAPTIFDAQGGLDLDGQRRCIDFMIDAGS
                     HGICILANFSEQFVLSDDERNVLMKTVLEHVDGRVPVIVTTTHFSSRLCAERSRAAQD
                     AGAAMVMVMPPYHGATIRVPERSIYEFFATVSDAIDIPIMIQDAPVSGTILSAPFLAR
                     MAREIGNVSYFKIEVPQAAAKLRELIELGGDAIVGPWDGEEAITLMADLEAGATGAMT
                     GAGFPDGIRQILDAWQAGDAELAAQRYQQWLPLINYENRQGWLATSKVLMQAGGVIAS
                     DAVRHPLQPMHPATREGLLKIARRLDPLVLRWAR"
     misc_feature    complement(222231..223085)
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(222606..222608,222690..222692,
                     222963..222971,222978..222980,223074..223076))
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(222471..222473,222606..222608,
                     222690..222692,222963..222971,222978..222980))
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(222276..222281,222735..222737,
                     222747..222749,222777..222782,222852..222857,
                     222948..222953,222966..222968))
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(222606..222608)
                     /gene="dapA1"
                     /locus_tag="CNE_2c01980"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            223234..224190
                     /locus_tag="CNE_2c01990"
                     /db_xref="GeneID:10920688"
     CDS             223234..224190
                     /locus_tag="CNE_2c01990"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680417.1"
                     /db_xref="GI:339321523"
                     /db_xref="GeneID:10920688"
                     /translation="MKSTLDTLTGRLRMKQLQLLIALDEHSSLHQAAAAMAMTQSAAS
                     KSLQELESMLEAPLFERSKRGMRPNAFGHCVIRHARQLVADLGAMCEEVAGIRAGSGG
                     RVAIGVIMGAVPEVLVPALAQLREAQPELALEIIEDTSLRLLGLLDDGHLDLVIGRSL
                     VSDEPARYHYHPLGDEQVAVVAGHAHPAPRARAMGFADLAGYRWITYAGHMPMHALLQ
                     RELDLAGMSFPANAISTSSALVTVAMLQGDPGLVSLLPTGVAAMFERQKMLRILPVRL
                     QSRQQTFGIVTRRGGTLSASARQLVAILKALPRTAQQAAAEV"
     misc_feature    223267..224151
                     /locus_tag="CNE_2c01990"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    223273..223452
                     /locus_tag="CNE_2c01990"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    223540..224145
                     /locus_tag="CNE_2c01990"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(223585..223590,223594..223599,223606..223608,
                     223618..223620,223624..223644,223927..223944,
                     223960..223965,223969..223974)
                     /locus_tag="CNE_2c01990"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            224300..225268
                     /locus_tag="CNE_2c02000"
                     /db_xref="GeneID:10920689"
     CDS             224300..225268
                     /locus_tag="CNE_2c02000"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680418.1"
                     /db_xref="GI:339321524"
                     /db_xref="GeneID:10920689"
                     /translation="MKTWIAGALAGLVTVAAVTGNAWAQDTRPVRLMVGAAPGGGTDV
                     MARIVSDKLAAQLKQPVVVDNRPGASNTIAADLTAKAAPDGNTLLMGVVTSQAIAPHL
                     LKLQFDPLKDLAPVALVSSVPNVLVVNNQVQARDVKALVAQIQANPDKFRYSSSGVGS
                     TQHLAGASFARQIKGKLLHVPYKSSSSALVDLMGGQVDMSFETMPSVISHIKAGKLHA
                     LAVTADQRSALLPNVPTLAEAGVPGIQMSAWYGVYAPAGTPPATLQKLSSALATVIKD
                     PDTVRRLADVGAVPGALTAAQFDAFSRAEYVRYGKLIAELGVKLDQ"
     misc_feature    224432..225250
                     /locus_tag="CNE_2c02000"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            225284..226300
                     /gene="pdxA"
                     /locus_tag="CNE_2c02010"
                     /db_xref="GeneID:10920690"
     CDS             225284..226300
                     /gene="pdxA"
                     /locus_tag="CNE_2c02010"
                     /EC_number="1.1.1.262"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="YP_004680419.1"
                     /db_xref="GI:339321525"
                     /db_xref="GeneID:10920690"
                     /translation="MNSRPRIAMVLGDPAGIGPELIARLLADPATAAQAEILLIADRD
                     EWRHGMRIAGVELALAETDAPAFADDGKPRLYHWQLPERPTFARGEASAEGGRYSLGT
                     LALALQLAQAGQADAILFGPLNKSSLHAAGMAHSDELHWFAEQLGYHGNFCEFNVLDG
                     LWTSRVTSHVALKDVPAMITQERVGGAIDLIDHALRRAGMARPRIAVCGLNPHNGDNG
                     AFGREEIDVIAPAVAAARERGVAADGPFPADTIFLKVQGGPSQRQFDAIVTMYHDQGQ
                     IGIKLMGFSRGVTVQGGLPVPITTPAHGTAFDITQQGRADPGATLQAFQIACRMGAQR
                     RAAP"
     misc_feature    225284..226291
                     /gene="pdxA"
                     /locus_tag="CNE_2c02010"
                     /note="4-hydroxythreonine-4-phosphate dehydrogenase;
                     Reviewed; Region: pdxA; PRK00232"
                     /db_xref="CDD:234696"
     gene            226391..227566
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /db_xref="GeneID:10920691"
     CDS             226391..227566
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /EC_number="4.2.1.90"
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnonate dehydratase RhmD"
                     /protein_id="YP_004680420.1"
                     /db_xref="GI:339321526"
                     /db_xref="GeneID:10920691"
                     /translation="MKITNVRARVFEWKGKTVPPQAHFCTNATDILFERGDAMGSFRF
                     HGWLVVEVETDTGLVGIGNCALAPRVAKEIVDQYLAPVVIGQDPFDNEYLWQKMYRRT
                     HAWGRKGIGMAAISAVDIALWDLMGKAVGKPVFKLLGGRTKEKIWCYASKLYNNDDRD
                     AFLAEAQGYLDQGFTAMKMRFGYGPKDGPAGMQKNIEQVRLLRELVGDGVDIMLECYM
                     GWTLEYARRMLPRLAEFNPRWLEEPVIADDIEGYAELKKASPFPISGGEHEFTSYGFK
                     DLLERRAVDVIQYDTNRVGGITAAQKINAMAEAWSVPVIPHAGQMHNYHLTMASTASP
                     MSEYFPVHDVEVGNELFYYIFKGDPAPDNGYLQLDDNLPGLGLELNEEYFSQFNIIG"
     misc_feature    226502..227551
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    226520..227530
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily, subgroup 2. Enzymes of this subgroup
                     share three conserved carboxylate ligands for the
                     essential divalent metal ion (usually Mg2+), two
                     aspartates and a glutamate, and conserved catalytic...;
                     Region: MR_like_2; cd03327"
                     /db_xref="CDD:239443"
     misc_feature    order(226835..226837,226922..226924,226928..226930,
                     227033..227035,227105..227107,227111..227113,
                     227189..227191,227258..227260,227339..227341,
                     227399..227401)
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239443"
     misc_feature    order(227033..227035,227111..227113,227189..227191)
                     /gene="rhmD"
                     /locus_tag="CNE_2c02020"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239443"
     gene            227642..228955
                     /gene="garP"
                     /locus_tag="CNE_2c02030"
                     /db_xref="GeneID:10920692"
     CDS             227642..228955
                     /gene="garP"
                     /locus_tag="CNE_2c02030"
                     /codon_start=1
                     /transl_table=11
                     /product="galactarate transporter GarP"
                     /protein_id="YP_004680421.1"
                     /db_xref="GI:339321527"
                     /db_xref="GeneID:10920692"
                     /translation="MTTSVTPEAAASPPAAIASAEAPSRVRWRIFAVVFVLVVMNLLD
                     RISLSIAMPTIGKEFGLSPTMQGLVLSSFFWSYALLQVPGGWLIDRFGPRKVITGSTA
                     LWGAFQALAAFATGGISLMATRMALGAAEAPLFPAGAKLNALWLSSGERSRGAVLVDA
                     GSPLGAAIGGIVISYLIVAFGSWRTAFFIAGAVTVVMSWVSWRYLRDQPSQHPGVNDG
                     ELAHIRATAGNAAAAAQDRRIAPRSWCGLTIGRACWAMVFFGLLTWGPNYLAHARGFD
                     LKQIGMAMFFIFLSGAVGSLASGFGADALMRRLPRALVLKGMLTVSGLVICAVFLLLP
                     RIDDPVEAVVLLCLAAFITMWGSLYWSLPAILAPAHRVGIVGATMNLAGSLGGIVVPI
                     LVGLILQHLGSYQTVLHFFAGCAVVFVACTLLIDLGSGKLNKELR"
     misc_feature    227732..228916
                     /gene="garP"
                     /locus_tag="CNE_2c02030"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    227747..228916
                     /gene="garP"
                     /locus_tag="CNE_2c02030"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    order(227774..227776,227783..227791,227795..227800,
                     227849..227851,227858..227863,227870..227872,
                     227882..227887,227891..227896,228032..228037,
                     228044..228049,228056..228061,228068..228070,
                     228104..228109,228116..228121,228137..228139,
                     228404..228406,228413..228418,228425..228430,
                     228437..228439,228479..228481,228491..228493,
                     228503..228505,228512..228514,228524..228526,
                     228689..228691,228695..228700,228707..228709,
                     228719..228724,228731..228733,228764..228769,
                     228776..228781,228788..228793,228800..228802)
                     /gene="garP"
                     /locus_tag="CNE_2c02030"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            228952..229890
                     /locus_tag="CNE_2c02040"
                     /db_xref="GeneID:10920693"
     CDS             228952..229890
                     /locus_tag="CNE_2c02040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680422.1"
                     /db_xref="GI:339321528"
                     /db_xref="GeneID:10920693"
                     /translation="MNASTRYDGPIVDAHHHFWDPVTNYHPWLSDPGLIPFRYGDYSA
                     LKRRYYPADYFADAGGHDVRKTVYVETEWDPCDPIGETAFISRVAAEHGTPHAVVAQA
                     WLHHDDAADVLARQAEFPLVRSVRHKPGGAPDALSAARMPSLMEDERWRRGFAELGRH
                     GLHFDLQVPWWHAQEAVRLARDFPATTIILNHAGLPADRSPAALAAWEDAMAMLAECP
                     NVVIKVSGLGQAGQPWTAAANARIVLACIRLFSPARVMFASNFPVDGLCASFDQIFSG
                     FKVITAGFTPAEQRAMFHDNACRIYSLAADTAVPQG"
     misc_feature    228967..229863
                     /locus_tag="CNE_2c02040"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            complement(229881..230915)
                     /locus_tag="CNE_2c02050"
                     /db_xref="GeneID:10920694"
     CDS             complement(229881..230915)
                     /locus_tag="CNE_2c02050"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680423.1"
                     /db_xref="GI:339321529"
                     /db_xref="GeneID:10920694"
                     /translation="MKSSAIAISIPALVLTLVLMQAPANSPAPDAAPLWQSHTRLKSR
                     QLLLLLAVADEGSIHRAAERLAMTQPAASKLLRELEEMLSVLLFERLPRGMAPTDYGR
                     AMIRHARAVIGSLNQAREEVLALKAGRLGHVAIGAITSPGVRLLPPAIAQIKARYPGL
                     RVSVEIDNSNVLLDRLGQEKLHMVVARLFPEHDKGRLRYEPLSEEPVCAVVRPGHPML
                     SAQGLSLADTTEAAWLIPPAGTVLRHRFELMFQRASLAPPVNVVETAALLFLTRMVTQ
                     SDMIAVLTADVAQYYAAFGMVEILPMEMPCHMDDFGLITPTDRLMSPGALLVADALRE
                     SGQQIYGAQP"
     misc_feature    complement(229902..230801)
                     /locus_tag="CNE_2c02050"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    complement(230610..230765)
                     /locus_tag="CNE_2c02050"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(229920..230522)
                     /locus_tag="CNE_2c02050"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(230088..230093,230097..230102,
                     230118..230135,230418..230438,230442..230444,
                     230454..230456,230463..230468,230472..230477))
                     /locus_tag="CNE_2c02050"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            231070..232815
                     /gene="ilvD1"
                     /locus_tag="CNE_2c02060"
                     /db_xref="GeneID:10920695"
     CDS             231070..232815
                     /gene="ilvD1"
                     /locus_tag="CNE_2c02060"
                     /EC_number="4.2.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase IlvD"
                     /protein_id="YP_004680424.1"
                     /db_xref="GI:339321530"
                     /db_xref="GeneID:10920695"
                     /translation="MSDSKDKQRKPLRSTAWFGSADKNGFMYRSWMKNQGIPDHAFDG
                     RPVIGICNTWSELTPCNAHFRKLAEHVKRGVYEAGGFPIEFPVFSNGESNLRPTAMLT
                     RNLAAMDVEEAIRGNPIDAVVLLTGCDKTTPALLMGAASCDVPAIVVTGGPMLNGKLD
                     GKDIGSGTAVWQLHESLKAGEINLHQFLSAEAGMSRSAGTCNTMGTASTMACMAEALG
                     TSLPHNAAIPAVDSRRYVLAHMSGIRIVEMAREDLTLSRILTRQAFENAIRVNAAIGG
                     STNAVIHLKAIAGRIGVPLELEDWSKVGRDTPTIVDLMPSGRFLMEEFYYAGGLPAVL
                     RRMGEAGLLPHPGALTVNGKAIWDNVRDAPITNDEVIRPLDQPLIRDGSIRILRGNLS
                     PRGAVLKPSAATPRLLRHRGRAVVFENLEHYKERIVDEALDVDENSVLVLKRCGPRGY
                     PGMAEVGNMGLPPKLLRQGVKDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAIVRD
                     GDWIELDCEAGRLHLDIDEAEFARRMADVQPLEAPADGGYRKLYVNHVLQADEGCDLD
                     FLVGCRGREVPRHSH"
     misc_feature    231094..232812
                     /gene="ilvD1"
                     /locus_tag="CNE_2c02060"
                     /note="dihydroxy-acid dehydratase; Validated; Region:
                     PRK06131"
                     /db_xref="CDD:235708"
     gene            232883..234226
                     /gene="ttuB1"
                     /locus_tag="CNE_2c02070"
                     /db_xref="GeneID:10920696"
     CDS             232883..234226
                     /gene="ttuB1"
                     /locus_tag="CNE_2c02070"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate transporter TtuB"
                     /protein_id="YP_004680425.1"
                     /db_xref="GI:339321531"
                     /db_xref="GeneID:10920696"
                     /translation="MHGTQTAPMERAAPTQGEDSQAIEESRIIGMLVRRLIPFLALIY
                     VVAYIDRSVVGFAKLHMNAAIGISDAAYGLGAGLFFIGYFLCEVPSNLALERFGARRW
                     FARILLTWGVITMAMALTSGPYSFYALRFLLGAAEAGLYPGILYFLTKWFPMRHRARI
                     IGLLVLAQPIALIITGPLAGLVLSTHGLFGMNNWQTLFVLSGLPAVLLCLPTLKLLPE
                     SPASAAWLAPGDRAWIERELAADQAAYALKSYGNPLQALKDKRVLLLSLLFLPFPLSI
                     YGLSLWLPTIIKQFGVTDVMTGMLSAVPYLFAVVGLYLVPRHSDRKRERYGHIVVVSG
                     MAAVTMALSAWVQSPVLQFLFICLTAFSIYSIQAVVWALPGEFLTGASAAVGIATINS
                     LANLGGYFGPYGIGVIKDATGSLAAGLYFLAVMLLFAVLMAFVVRAALRPAAARA"
     misc_feature    232964..234163
                     /gene="ttuB1"
                     /locus_tag="CNE_2c02070"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    232991..234190
                     /gene="ttuB1"
                     /locus_tag="CNE_2c02070"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(233033..233035,233042..233050,233054..233059,
                     233108..233110,233117..233122,233129..233131,
                     233141..233146,233150..233155,233291..233296,
                     233303..233308,233315..233320,233327..233329,
                     233363..233368,233375..233380,233396..233398,
                     233699..233701,233708..233713,233720..233725,
                     233732..233734,233771..233773,233783..233785,
                     233795..233797,233804..233806,233816..233818,
                     233960..233962,233969..233974,233981..233983,
                     233993..233998,234005..234007,234038..234043,
                     234050..234055,234062..234067,234074..234076)
                     /gene="ttuB1"
                     /locus_tag="CNE_2c02070"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(234251..234487)
                     /locus_tag="CNE_2c02080"
                     /db_xref="GeneID:10920697"
     CDS             complement(234251..234487)
                     /locus_tag="CNE_2c02080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680426.1"
                     /db_xref="GI:339321532"
                     /db_xref="GeneID:10920697"
                     /translation="MYMVYWSEGDGTGLSPHAQSFPSDAMREALRFTEALRQRQHAGE
                     PVSFVTLCSENPNSVGRAGAADPPPDYEWKKRRP"
     gene            234671..235216
                     /locus_tag="CNE_2c02090"
                     /db_xref="GeneID:10920698"
     CDS             234671..235216
                     /locus_tag="CNE_2c02090"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase, (GNAT) family"
                     /protein_id="YP_004680427.1"
                     /db_xref="GI:339321533"
                     /db_xref="GeneID:10920698"
                     /translation="MSDLALIPATAADAERLAAMHAASWQHTYPGMLPAAYLRDQAYP
                     ERLAAWRARMHDGADGPVEVTLAMVDGEAAGFACLLPEAEPRFGIYLDNLHVLPAFHG
                     QGLGKRLLAHCAQRVAARWPGRPLFLYVLEANTQAREFYQRLGGEESEAFEDDFHGPD
                     LRVMVRRVTWPDVAALVRRLG"
     misc_feature    234707..235105
                     /locus_tag="CNE_2c02090"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    234866..235057
                     /locus_tag="CNE_2c02090"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(234950..234958,234986..234991)
                     /locus_tag="CNE_2c02090"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            235276..236421
                     /locus_tag="CNE_2c02100"
                     /db_xref="GeneID:10920699"
     CDS             235276..236421
                     /locus_tag="CNE_2c02100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680428.1"
                     /db_xref="GI:339321534"
                     /db_xref="GeneID:10920699"
                     /translation="MLQAIALVVPRKPCRALAGASIAMAVLAGCASAPDTPSAARAIE
                     AAATPAQTKPHWQRVHLGTGAGYDFPVYANHQLDADLSRIREVVFVQHGLQRNGDDYY
                     AAGAALLKASGRNPDEVLLVAPNFPGTPDHGKGFDGMPQWSVQGWMSGQNAVNSPFTV
                     SSLQVLDDLMAFVTDKARLPQVARVTVAGHSGGAQIVHRYAVLNNVDERIRARGIDLR
                     YVVANPSSYLYFTPVRPAGADGRSFAPYDKAACPDYDKYRYGMQDIVPYAKGANGPSL
                     YQRYAGRQVTYLAGTEDNDPNHRVLDKACGAEAEGPTRLQRARGYLRYERYLASPGLV
                     IRHQAYEVVGVGHDQARMFGSQCGARAVFGMAETANPDGAACLAPQL"
     gene            complement(236525..236752)
                     /locus_tag="CNE_2c02110"
                     /db_xref="GeneID:10920700"
     CDS             complement(236525..236752)
                     /locus_tag="CNE_2c02110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680429.1"
                     /db_xref="GI:339321535"
                     /db_xref="GeneID:10920700"
                     /translation="MTGRILLAEERDVAWEADAGELPFGILPPMRDKAPIYYRLPDTP
                     DGHHIKEYASGLRQLVRFVGVEEQVVKFSLG"
     gene            237092..237640
                     /locus_tag="CNE_2c02120"
                     /db_xref="GeneID:10920701"
     CDS             237092..237640
                     /locus_tag="CNE_2c02120"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004680430.1"
                     /db_xref="GI:339321536"
                     /db_xref="GeneID:10920701"
                     /translation="MSTQHALLISLIEKPSSGYDLARRFDRSIGYFWHATHQQIYREL
                     GRMADSGWIAADEAEAAEGETGAGDRKNRKKVYRVLPAGRDELARWVLTPGASLDQRE
                     EILVKLRADAVIGPLGLGDEMRRLIALHRARLETYLAIERRDFSAPDMDRAQQLRYAL
                     LQRGIRFEQDWVAWGEELLPLL"
     misc_feature    237101..237502
                     /locus_tag="CNE_2c02120"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1695"
                     /db_xref="CDD:224609"
     misc_feature    237386..237637
                     /locus_tag="CNE_2c02120"
                     /note="Virulence activator alpha C-term; Region:
                     Vir_act_alpha_C; pfam10400"
                     /db_xref="CDD:150982"
     gene            complement(237695..238690)
                     /locus_tag="CNE_2c02130"
                     /db_xref="GeneID:10920702"
     CDS             complement(237695..238690)
                     /locus_tag="CNE_2c02130"
                     /EC_number="1.13.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="YP_004680431.1"
                     /db_xref="GI:339321537"
                     /db_xref="GeneID:10920702"
                     /translation="MALPAQLQNRLSLPVVCSPLFIISNPDLVIAQCKAGVVGSFPAL
                     NARPAPKLEEWLDRITTELAEHDAKHPDRPSAPFAVNQIVHKSNDRLEHDLELCVRYK
                     VPIVITSLGARKEVNDAVHSYGGIVLHDVINNTFARKAIEKGADGLVAVAAGAGGHAG
                     TLSPFALLHEIREWFDGPLLLSGSISSGDAILAAQAAGADLAYIGSAFIATQEANAQD
                     GYKQMIVDSNANDIVYSNLFTGVHGNYLRGSIERAGLDPNALPESDPSKMNFGSTSVK
                     AWKDIWGAGQGVGAIKRVVPAGELVRRFAEEYALARRRLGLGEARQAGTRAVDLA"
     misc_feature    complement(237746..238690)
                     /locus_tag="CNE_2c02130"
                     /note="Dioxygenases related to 2-nitropropane dioxygenase
                     [General function prediction only]; Region: COG2070"
                     /db_xref="CDD:224981"
     misc_feature    complement(237953..238660)
                     /locus_tag="CNE_2c02130"
                     /note="2-Nitropropane dioxygenase (NPD), one of the
                     nitroalkane oxidizing enzyme families, catalyzes oxidative
                     denitrification of nitroalkanes to their corresponding
                     carbonyl compounds and nitrites. NDP is a member of the
                     NAD(P)H-dependent flavin oxidoreductase...; Region:
                     NPD_like; cd04730"
                     /db_xref="CDD:240081"
     misc_feature    complement(order(238073..238084,238139..238147,
                     238226..238228,238238..238240,238301..238303,
                     238364..238366,238442..238444,238631..238636))
                     /locus_tag="CNE_2c02130"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240081"
     misc_feature    complement(238223..238225)
                     /locus_tag="CNE_2c02130"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240081"
     gene            complement(238752..239186)
                     /locus_tag="CNE_2c02140"
                     /db_xref="GeneID:10920703"
     CDS             complement(238752..239186)
                     /locus_tag="CNE_2c02140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680432.1"
                     /db_xref="GI:339321538"
                     /db_xref="GeneID:10920703"
                     /translation="MTTTNLIPAAQASLEAWHQMLANGSMAGLDAIVADEVVFRSPVA
                     HTPYPGRAAIGLVLTTVNQVFQDFRYHRSFVSEDGHSVVLEFSAAVDGKALKGIDMIR
                     FDDAGRIAEFEVMVRPRSGLEALAAAMGARLASQRDVLTGTA"
     misc_feature    complement(238851..239147)
                     /locus_tag="CNE_2c02140"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            239410..240432
                     /locus_tag="CNE_2c02150"
                     /db_xref="GeneID:10920704"
     CDS             239410..240432
                     /locus_tag="CNE_2c02150"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004680433.1"
                     /db_xref="GI:339321539"
                     /db_xref="GeneID:10920704"
                     /translation="MTTKPSAAHPEQAALFDADLAAWRDHPERAFDGWLARHGFRHGT
                     SVVYRAMWGKLLRWSAERGLPPLSWSAEQIGEFLDAQQLHKSHRYRYTRLIERVFHHL
                     ARLREGMHNPASQAVRAHLADGENDPTAFLLPGERDLLVARILGPAGMLAGDTHTAAS
                     PTQWKRARDAALLAVLLGGGLKVGEARALRVDAIEAGAPGRMALRMVRADNGRAYTVP
                     LFSLAHAPLRAWLALREASGTLGGLVFPAMPSGRPMHAASVYRRVEILLDEAGVLASR
                     SERASPQTLRNTCAAMHFEAGTAPAEVAQCLGMRDLESGWRLRAAYEAWQARAGLVAE
                     APASRA"
     misc_feature    239956..240351
                     /locus_tag="CNE_2c02150"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(239956..239958,240037..240039,240253..240258)
                     /locus_tag="CNE_2c02150"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(240037..240039,240256..240258,240265..240267,
                     240334..240336)
                     /locus_tag="CNE_2c02150"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(240256..240258,240265..240267,240334..240336)
                     /locus_tag="CNE_2c02150"
                     /note="active site"
                     /db_xref="CDD:238587"
     gene            240592..241611
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /db_xref="GeneID:10920705"
     CDS             240592..241611
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /EC_number="5.1.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="YP_004680434.1"
                     /db_xref="GI:339321540"
                     /db_xref="GeneID:10920705"
                     /translation="MPETLLLTGATGYIASHTWVALLNAGYHVIGLDNLCNSSPVVLE
                     RLATITGQTPHFVQGDVRDRALLDRLFAEHRISGVIHFAALKAVGESVSQPLEYYSNN
                     LGGLLTVCAAMGAAGVKQLVFSSSATVYGNPHAVPILEDFPLSATNPYGQTKLMGEQI
                     LRDLETSDPDWRIAYLRYFNPVGAHESGLIGEDPRGIPNNLMPYVAQVAGGRRERLMV
                     FGGDYPTPDGTGVRDYIHVCDLADGHLAALGYLRAQGKSMTVNLGTGRGYSVLEVVQA
                     YQRASGKPVPHDIVARRPGDIASCYADPALANQLLGWRARHDIDRMCEDSWRWQSMNP
                     QGFDA"
     misc_feature    240601..241602
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="UDP-glucose 4-epimerase; Region: PLN02240"
                     /db_xref="CDD:177883"
     misc_feature    240601..241584
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="UDP-glucose 4 epimerase, subgroup 1, extended (e)
                     SDRs; Region: UDP_G4E_1_SDR_e; cd05247"
                     /db_xref="CDD:187558"
     misc_feature    order(240616..240618,240622..240633,240688..240705,
                     240766..240774,240835..240843,240847..240849,
                     240892..240894,240961..240969,241039..241041,
                     241051..241053,241123..241128,241132..241134)
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187558"
     misc_feature    order(240865..240867,240871..240879,240886..240891,
                     240898..240903,240910..240915,240919..240924,
                     240931..240933,241036..241038,241045..241047,
                     241057..241059,241066..241071,241075..241083)
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187558"
     misc_feature    order(240895..240897,240967..240969,241039..241041,
                     241051..241053)
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="active site"
                     /db_xref="CDD:187558"
     misc_feature    order(240967..240975,241039..241041,241123..241131,
                     241186..241194,241237..241248,241279..241281,
                     241285..241287,241291..241293,241399..241401,
                     241468..241470,241477..241479)
                     /gene="galE"
                     /locus_tag="CNE_2c02160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187558"
     gene            complement(241722..242030)
                     /locus_tag="CNE_2c02170"
                     /db_xref="GeneID:10920706"
     CDS             complement(241722..242030)
                     /locus_tag="CNE_2c02170"
                     /codon_start=1
                     /transl_table=11
                     /product="H-NS-like DNA-binding protein"
                     /protein_id="YP_004680435.1"
                     /db_xref="GI:339321541"
                     /db_xref="GeneID:10920706"
                     /translation="MATYQEIVQKISELQKQAEEIKAREQATVIADIREKIEQYGLTA
                     EDLGFGAKVPAGKKAVNRKVPVRYRDSAGNTWTGRGKRPGWLTQALAQGKAVEDFLIR
                     "
     misc_feature    complement(241749..242018)
                     /locus_tag="CNE_2c02170"
                     /note="H-NS histone family; Region: Histone_HNS;
                     pfam00816"
                     /db_xref="CDD:250154"
     misc_feature    complement(241728..241865)
                     /locus_tag="CNE_2c02170"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; smart00528"
                     /db_xref="CDD:128801"
     gene            242558..244264
                     /locus_tag="CNE_2c02180"
                     /db_xref="GeneID:10920707"
     CDS             242558..244264
                     /locus_tag="CNE_2c02180"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_004680436.1"
                     /db_xref="GI:339321542"
                     /db_xref="GeneID:10920707"
                     /translation="MSFHNNIQIKTLLRGAMGMLSLLLLLVGGAGLHGISQSNDALRE
                     TYANQLGSTVALSEAMQATTRMRLALDRNVMQGEQDDPKVHVDRSRVFVEASEAAWKR
                     YMSLPQNPEEKALAAELGKQRQVFMEQGVLPLQAASLAGNQEEALRLAKKVLPDLQRS
                     MSGVHEKLQKFQMTAGQANFDAAQASFARIRMLSIVLIVLGLAVAVLCTVTLNRAIVT
                     PVQEALAVFERIARGDLTSRIASVSKNEIGRMMQALAAMQASLSGIVAEVRTGADSMA
                     SATQQISTGNLDLSQRTEEQASSLEQTAASMEELTTVVRQNADNARQAGVLANEASQI
                     ALKGGDVVGRVVDTMNEINGASRKVVEIISVIEGIAFQTNILALNAAVEAARAGEQGR
                     GFAVVAGEVRSLAQRSASAAKEIEALIGESGQRVESGTRLVAEAGQTMGEIVQAVRRV
                     TDIMNEIGAASQEQTSGIEQVNQAVTQMDEVTQQNAALVEEAAAAAGALEVQAQKLKN
                     VVSVFNLGTGTGVGAGAAATAVAGRTARTMSVRPAALPAGRPAARPALAVAGADDDWS
                     AF"
     misc_feature    242720..243073
                     /locus_tag="CNE_2c02180"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cd00181"
                     /db_xref="CDD:206638"
     misc_feature    order(242735..242740,242747..242752,242756..242761,
                     242768..242773,242780..242785,242789..242794,
                     242993..242998,243011..243013,243017..243022,
                     243029..243031)
                     /locus_tag="CNE_2c02180"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    order(242756..242758,242771..242773,242783..242785,
                     242993..242998,243011..243013,243017..243019)
                     /locus_tag="CNE_2c02180"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    243089..>243400
                     /locus_tag="CNE_2c02180"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5375"
                     /db_xref="CDD:227667"
     misc_feature    243203..243340
                     /locus_tag="CNE_2c02180"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(243203..243208,243215..243220,243224..243229,
                     243236..243241,243245..243247,243293..243298,
                     243302..243307,243314..243319,243323..243328,
                     243335..243340)
                     /locus_tag="CNE_2c02180"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    243356..244096
                     /locus_tag="CNE_2c02180"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    243437..244012
                     /locus_tag="CNE_2c02180"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(243461..243466,243473..243478,243485..243487,
                     243494..243499,243503..243508,243515..243517,
                     243524..243529,243536..243538,243545..243550,
                     243557..243562,243569..243571,243578..243583,
                     243587..243592,243602..243604,243608..243613,
                     243620..243622,243629..243634,243641..243646,
                     243653..243655,243662..243664,243671..243676,
                     243683..243685,243695..243697,243704..243706,
                     243725..243727,243737..243739,243746..243748,
                     243755..243760,243767..243769,243776..243781,
                     243788..243793,243797..243802,243809..243814,
                     243851..243856,243863..243865,243872..243877,
                     243884..243886,243893..243898,243902..243907,
                     243914..243919,243926..243928,243935..243940,
                     243947..243949,243956..243961,243965..243970,
                     243977..243982,243986..243991,243998..244000,
                     244007..244012)
                     /locus_tag="CNE_2c02180"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    243671..243772
                     /locus_tag="CNE_2c02180"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            244378..246348
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /db_xref="GeneID:10920708"
     CDS             244378..246348
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein CheX"
                     /protein_id="YP_004680437.1"
                     /db_xref="GI:339321543"
                     /db_xref="GeneID:10920708"
                     /translation="MIALSSVLLLLAALLGVAAALGVRAGRADQSAGGRSLRTLTWSA
                     ALLSQLSVSVPVLVVMLSGSVPAANDTAQMAASFAAAAAATAAAKLLVQWLRQGTRLW
                     RGAAIMAVVAGAGLVAAAGTHLGRACGAGSASARACIDAAGLPHPAWLAGGLTALCAL
                     MFAVHRAQSRGLLPAHHEAGLADELADEAHGLPRGHEPRLARRGARIPGRPGRLTVRA
                     AARGQGTVGEYSVATTMPDRVAFGRWLDQAIAQARLAETGCAVLLIHIADYREVDEVF
                     EIRADDILAQDAGALAQAVLEPHDFLARLARDEFAVGVPELVHHGRAQELGSRMLGSL
                     AEFIAARGLQMQIGVNIGIAIYPRDAQTSEALMQAARVSLAEARQSGSNQVRLFNSAA
                     GERARRTRVIRRDLWLAIQDDALSLQFQPKYDARRRTLVGAEALCRWRHPALGQVSPA
                     EFITVAEQSGQIDKLDDWVLTSVCRQVRQWRDAGVPTVPVAINVSGLRFASRNFPQYL
                     LEQIHQHDIPPSAITLEITETAAMKDIGKSLETLAELQSLGIQVALDDFGSGYSSLGY
                     LKRLRVGTLKIDRTLIGGLDTDAQGRAIVGSMVALAHELRMKVVAEGVESASQLEILN
                     EMGCDEVQGYLLSLPLDAAGFADALREQGGGA"
     misc_feature    245074..245535
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(245170..245172,245299..245301)
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(245185..245187,245194..245199,245206..245208,
                     245218..245220,245287..245289,245293..245304)
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(245275..245277,245362..245364)
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    245590..246306
                     /gene="cheX"
                     /locus_tag="CNE_2c02190"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            246501..246893
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /db_xref="GeneID:10920709"
     CDS             246501..246893
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator"
                     /protein_id="YP_004680438.1"
                     /db_xref="GI:339321544"
                     /db_xref="GeneID:10920709"
                     /translation="MSSPSILVVDDSPSLRRMIGACLRAGGFDVTEAADGDQAHALAA
                     GASFGMLVTDQVMPGMDGLTLIRSLRATERYACIPILMLTTEQDGSIREQARAAGASG
                     FLPKPFDPDQLMQAVTALLSTAPPTSEG"
     misc_feature    246519..246863
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(246528..246533,246660..246662,246684..246686,
                     246750..246752,246807..246809,246816..246821)
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    246660..246662
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(246669..246674,246678..246686)
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    246816..246824
                     /gene="cheY1"
                     /locus_tag="CNE_2c02200"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            247035..247511
                     /gene="cheW1"
                     /locus_tag="CNE_2c02210"
                     /db_xref="GeneID:10920710"
     CDS             247035..247511
                     /gene="cheW1"
                     /locus_tag="CNE_2c02210"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="YP_004680439.1"
                     /db_xref="GI:339321545"
                     /db_xref="GeneID:10920710"
                     /translation="MKHIDKADGAGEEFLAFTLGREEYGVDILKVQEIRGYESVTQIA
                     NAPDYIKGVINLRGIIVPIIDLRIKFRQQNVSYDQYTVVIIVDLNDRTTGIVVDGVSD
                     VLTLAAEQIKPTPHFSGELATDYIRGLGSVEQRMLILVDIEKLLNTEELAALDAVA"
     misc_feature    247065..247484
                     /gene="cheW1"
                     /locus_tag="CNE_2c02210"
                     /note="CheW, a small regulator protein, unique to the
                     chemotaxis signalling in prokaryotes and archea. CheW
                     interacts with the histidine kinase CheA, most likely with
                     the related regulatory domain of CheA. CheW is proposed to
                     form signalling arrays together...; Region: CheW; cd00732"
                     /db_xref="CDD:238374"
     misc_feature    order(247197..247214,247296..247298,247302..247304,
                     247461..247484)
                     /gene="cheW1"
                     /locus_tag="CNE_2c02210"
                     /note="putative CheA interaction surface; other site"
                     /db_xref="CDD:238374"
     gene            247615..249264
                     /locus_tag="CNE_2c02220"
                     /db_xref="GeneID:10920711"
     CDS             247615..249264
                     /locus_tag="CNE_2c02220"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_004680440.1"
                     /db_xref="GI:339321546"
                     /db_xref="GeneID:10920711"
                     /translation="MRNNQPVTQREYKLSPSDYLISRTDLKGRITFANRTFIEASGFA
                     AEELLGAAHNLVRHPDMPPEAFADLWQDLQAGRTWMGVVKNRRKNGDFYWVNAAVTPT
                     RVDGSVVGYTSVRSMATREQVEAAGAAYARLRAGRAEGLAIRHGAVVRTGLRGLVQGL
                     LRLNLKRRILWAQAGGMVWFLAALVAVEALGGAGVAAVRPWLWGGFALALASSFAAGT
                     MLLARVHRPVRHMLDFALRMGAGDLTTRFEHRSADEIGALAQAMQTMQRSLQSVVHEI
                     QEGMASISTATRQVAAGYNDLSQRTEQQAAALEQTASSMEELTSTVRQNADNARQASG
                     LAANASETALRGGEVVGRVVQTMDEINDASKKIVDIIGVIEGIAFQTNILALNAAVEA
                     ARAGEQGRGFAVVAGEVRSLAQRSANAAKEIKGLIGDTVERVDNGSALVGQAGKTMDE
                     IVQAVERVTDIMGEISAASAEQSAGIEQVNQAVAQMDEGTQQNAALVEEAAAAAGSLE
                     EQAMRLRDAIATFRVSMQAEVRPQRLPAHARADAAQSLAQA"
     misc_feature    247663..247956
                     /locus_tag="CNE_2c02220"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    247702..247959
                     /locus_tag="CNE_2c02220"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(247711..247713,247723..247725,247741..247743,
                     247780..247791,247867..247869,247882..247884)
                     /locus_tag="CNE_2c02220"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(247771..247773,247783..247785,247807..247809,
                     247816..247821,247903..247905,247909..247911)
                     /locus_tag="CNE_2c02220"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    248290..248424
                     /locus_tag="CNE_2c02220"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(248296..248301,248305..248310,248317..248322,
                     248326..248328,248374..248379,248383..248388,
                     248395..248400,248404..248409,248416..248421)
                     /locus_tag="CNE_2c02220"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    248437..249180
                     /locus_tag="CNE_2c02220"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    248518..249093
                     /locus_tag="CNE_2c02220"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(248542..248547,248554..248559,248566..248568,
                     248575..248580,248584..248589,248596..248598,
                     248605..248610,248617..248619,248626..248631,
                     248638..248643,248650..248652,248659..248664,
                     248668..248673,248683..248685,248689..248694,
                     248701..248703,248710..248715,248722..248727,
                     248734..248736,248743..248745,248752..248757,
                     248764..248766,248776..248778,248785..248787,
                     248806..248808,248818..248820,248827..248829,
                     248836..248841,248848..248850,248857..248862,
                     248869..248874,248878..248883,248890..248895,
                     248932..248937,248944..248946,248953..248958,
                     248965..248967,248974..248979,248983..248988,
                     248995..249000,249007..249009,249016..249021,
                     249028..249030,249037..249042,249046..249051,
                     249058..249063,249067..249072,249079..249081,
                     249088..249093)
                     /locus_tag="CNE_2c02220"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    248752..248853
                     /locus_tag="CNE_2c02220"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            249385..251244
                     /locus_tag="CNE_2c02230"
                     /db_xref="GeneID:10920712"
     CDS             249385..251244
                     /locus_tag="CNE_2c02230"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_004680441.1"
                     /db_xref="GI:339321547"
                     /db_xref="GeneID:10920712"
                     /translation="MHWFNQLRVTTRLVAGFLVVAVIGAVMGLLGVVNMGRMADWTGK
                     IYNGDLQALKAVQDANINLVYASRAQIALLSASTMGERSAEKEQIVKSLGAMDERIRQ
                     VAGVFDKPEGKALVKQYQELSPAFRARMEKYVELVSKQPLDTSQFESQVFSESADLLK
                     DSHALEAVMFQMVKRRDDRARNNMEEARSVYNASRLWMLGLVLGGLALSVLLGVLLAR
                     ALSRQLGGEPAYAAAIAARIAEGDFSSPVTTRAGDKSSLVYAMQQMQQQLSRMVRDFK
                     VSAESIGSASREIAAGNNDLSQRTEQQAAALEQTASSMEELTSTVRQNADNARQASGL
                     AANASETALRGGEVVGRVVQTMDEINDASKKIVDIIGVIEGIAFQTNILALNAAVEAA
                     RAGEQGRGFAVVAGEVRSLAQRSANAAKEIKGLIGDTVERVDNGSALVGQAGKTMDEI
                     VQAVKRVTDIMGEISAASAEQSAGIEQVNQAVAQMDEGTQQNAALVEEAAAAAGALEE
                     QASRLQAAVATFRLAAEDARAGSFAAQPLPAATALPARASRAAGAVRAIAAGKRVAKA
                     LPASTKAAAVPAADHAAAPEAADAVAAQPARLVAGRTARPALAAADNGDWSAF"
     misc_feature    249394..250956
                     /locus_tag="CNE_2c02230"
                     /note="methyl-accepting chemotaxis protein II;
                     Provisional; Region: PRK15048"
                     /db_xref="CDD:185008"
     misc_feature    249403..>249813
                     /locus_tag="CNE_2c02230"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    250285..250860
                     /locus_tag="CNE_2c02230"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(250309..250314,250321..250326,250333..250335,
                     250342..250347,250351..250356,250363..250365,
                     250372..250377,250384..250386,250393..250398,
                     250405..250410,250417..250419,250426..250431,
                     250435..250440,250450..250452,250456..250461,
                     250468..250470,250477..250482,250489..250494,
                     250501..250503,250510..250512,250519..250524,
                     250531..250533,250543..250545,250552..250554,
                     250573..250575,250585..250587,250594..250596,
                     250603..250608,250615..250617,250624..250629,
                     250636..250641,250645..250650,250657..250662,
                     250699..250704,250711..250713,250720..250725,
                     250732..250734,250741..250746,250750..250755,
                     250762..250767,250774..250776,250783..250788,
                     250795..250797,250804..250809,250813..250818,
                     250825..250830,250834..250839,250846..250848,
                     250855..250860)
                     /locus_tag="CNE_2c02230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    250519..250620
                     /locus_tag="CNE_2c02230"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            251289..252023
                     /locus_tag="CNE_2c02240"
                     /db_xref="GeneID:10920713"
     CDS             251289..252023
                     /locus_tag="CNE_2c02240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680442.1"
                     /db_xref="GI:339321548"
                     /db_xref="GeneID:10920713"
                     /translation="MTTEINLALPHDDAARLRKEFEQFVGVSTGLDREFLPPDFQEFL
                     RARLLQHNGPLTERAVSRLLSGGEYGWARRVFDKQLPNALAALMRDAQRFGFGLAVQP
                     DWTPDQRLAHAREWAAQVLSECGADAAFTEALATQVAASAEDVRVLEERMRTPAWRLA
                     ESLRQRAYDLMYALQTEDSEAAGRARVGELRGMLGLALEYGSVRPEEASRVLEQVERM
                     RPALFREAPDDVFARLAAWLRRMFGH"
     misc_feature    251334..252020
                     /locus_tag="CNE_2c02240"
                     /note="Protein of unknown function (DUF4088); Region:
                     DUF4088; pfam13317"
                     /db_xref="CDD:205497"
     gene            252509..252826
                     /gene="flhD"
                     /locus_tag="CNE_2c02250"
                     /db_xref="GeneID:10920714"
     CDS             252509..252826
                     /gene="flhD"
                     /locus_tag="CNE_2c02250"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator FlhD"
                     /protein_id="YP_004680443.1"
                     /db_xref="GI:339321549"
                     /db_xref="GeneID:10920714"
                     /translation="MESSEVLQEIREVNLAYLLLAQRLVRENQVEAMFRLGVSKEIAD
                     ILAKLTSAQLVKLAASNMVLCRFRFDDHALLSTLTHTAKSHDMQQIHAAILLARQPVE
                     SLN"
     misc_feature    252509..252823
                     /gene="flhD"
                     /locus_tag="CNE_2c02250"
                     /note="transcriptional activator FlhD; Provisional;
                     Region: PRK02909"
                     /db_xref="CDD:179497"
     gene            252823..253428
                     /gene="flhC1"
                     /locus_tag="CNE_2c02260"
                     /db_xref="GeneID:10920715"
     CDS             252823..253428
                     /gene="flhC1"
                     /locus_tag="CNE_2c02260"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar transcriptional activator FlhC"
                     /protein_id="YP_004680444.1"
                     /db_xref="GI:339321550"
                     /db_xref="GeneID:10920715"
                     /translation="MTALLQAEPTRSYTATSVPSRKSVLQDANQTQLAIELIGLGARL
                     QVLEAETTLSRDRLIRLYKELRGVSPPKGMLPFSTDWFTTWLPNIHSSLFFSAYQFMV
                     QEGETVGIRAVVAAYRLYLEHVSLLGGEIVLSFTRAWTLVRFFESNMLQLSRCTCCGG
                     QFVTHAYEPHANFVCSLCRPPSRAGKVKKLSKDAAAVQTNT"
     misc_feature    252880..253413
                     /gene="flhC1"
                     /locus_tag="CNE_2c02260"
                     /note="transcriptional activator FlhC; Provisional;
                     Region: PRK12722"
                     /db_xref="CDD:237181"
     gene            253548..254411
                     /gene="motA"
                     /locus_tag="CNE_2c02270"
                     /db_xref="GeneID:10920716"
     CDS             253548..254411
                     /gene="motA"
                     /locus_tag="CNE_2c02270"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor component MotA"
                     /protein_id="YP_004680445.1"
                     /db_xref="GI:339321551"
                     /db_xref="GeneID:10920716"
                     /translation="MLVVLGYVVVVVAVLGGYAMTGGHMGALYQPAEFVIIGGAAFGA
                     FIATNTAKAIKATARALPGLFKSSKYKKELYLDVMSLLYVLLSKARREGILFLEKEIA
                     DPAASSVFSQYPRILSDPVVMEFLTDYLRMMVNGNMNAFEIEALMDHEIETFRHEAEI
                     PAHALSRVGDALPAFGIVAAVMGVVHALGSADLPPAELGALIAHAMVGTFLGILLAYG
                     FVSPLAARIELQVSENVKVYECIKVVLLASLNGYAPLVAVEFGRKVLYSTVRPSFLEL
                     DDHVREVKSLN"
     misc_feature    253602..254396
                     /gene="motA"
                     /locus_tag="CNE_2c02270"
                     /note="flagellar motor protein MotA; Validated; Region:
                     PRK09110"
                     /db_xref="CDD:181655"
     gene            254439..255404
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /db_xref="GeneID:10920717"
     CDS             254439..255404
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein MotB"
                     /protein_id="YP_004680446.1"
                     /db_xref="GI:339321552"
                     /db_xref="GeneID:10920717"
                     /translation="MSSAHDMRPIIVRRAKSHAKPHGNHSWKIAYADFMTAMMALFLV
                     LWLLSSANKKTLEGIAEYFRMPLKVAVVGGERSSQTPSVIPGGGQDALRKDGDTMRAR
                     ANEPSDEQRRNEQQEAQRLRALKQRLEQIIENNPVLRQFRPQLLLDITSEGLRIQILD
                     TQNRPMFRTGSATVETYMRTILREIGPVLNELPNKVSLSGHTDAANYSNGERTYSNWE
                     LSGDRANASRRELIAGGMQEGKVLRVLGLAATMPLDKEDLLAPVNRRISIVVLNHKAQ
                     ARFEAENASAAEVSVAAQAGKAVQEMQAGLAAASAPAPAPTGSKP"
     misc_feature    254442..255353
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /note="flagellar motor protein MotB; Validated; Region:
                     motB; PRK09041"
                     /db_xref="CDD:236365"
     misc_feature    254466..254642
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /note="Membrane MotB of proton-channel complex MotA/MotB;
                     Region: MotB_plug; pfam13677"
                     /db_xref="CDD:257982"
     misc_feature    254937..255248
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(254943..254948,255042..255047,255066..255068,
                     255078..255080,255084..255086,255093..255095,
                     255228..255230)
                     /gene="motB"
                     /locus_tag="CNE_2c02280"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            255457..257472
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /db_xref="GeneID:10920718"
     CDS             255457..257472
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="YP_004680447.1"
                     /db_xref="GI:339321553"
                     /db_xref="GeneID:10920718"
                     /translation="MSVDIDITQFYQTFFEEAEELLVEMEQLLLGLDIESPDPEHLNA
                     IFRAAHSIKGGAATFGFAALTETTHIFENLLDRTRRQELALTRTIIDTFLETKDVLQD
                     QLNAYRNGTEPDPETLARICAVLQQLAQEAAGDAGATAAPAPAPAPVAAMTPAAAATG
                     GGLKIRLIRVSASDQALLREELANLGEITGQQEVNGELVVWLNTQCSADDIIAVCCFV
                     IDLDQIVIEAEAEAPAAAPAVVEAPVPAPVPVAAAPVAAAAAPAAAREKAKPQASAAH
                     GEGSIRVPTEKVDQIINLVGELVITQSMLAQTASALDPVLFDRLFSGMGQLERNARDL
                     QEAVMSIRMMPMDYVFSRFPRLVRDLASKLGKQIDLVTFGKATELDKSLIERIIDPLT
                     HLVRNSLDHGIETPDKRVAAGKDATGQLILSAQHHGGNIVIEVSDDGGGLNRERILAK
                     AIQNGLPVSEAITDEEVWQLIFAPGFSTAEVVTDVSGRGVGMDVVKRNIQEMGGHVQI
                     SSRPGLGTTIRIVLPLTLAILDGMSVKVGEETFILPLNCVMESLQPKAEDVHTAANSD
                     RVMHVRGEYLPLLEMHRVFNVAGALQEPTQGIAVILQAEGKRFALLVDQLIGQHQVVL
                     KNLETNYRKVPCISAATILGDGSVALIVDVGALQRTGVRRQEPALAQ"
     misc_feature    255469..257433
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="chemotaxis protein CheA; Provisional; Region:
                     PRK10547"
                     /db_xref="CDD:236712"
     misc_feature    255475..255771
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    order(255604..255606,255613..255618,255661..255663,
                     255670..255672)
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    255604..255606
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="active site"
                     /db_xref="CDD:238041"
     misc_feature    255943..256134
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="CheY binding; Region: CheY-binding; pfam09078"
                     /db_xref="CDD:255168"
     misc_feature    256288..256479
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="Signal transducing histidine kinase, homodimeric
                     domain; Region: H-kinase_dim; pfam02895"
                     /db_xref="CDD:251602"
     misc_feature    256615..257022
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(256633..256635,256645..256647,256654..256656,
                     256759..256761,256765..256767,256771..256773,
                     256777..256782,256921..256932,256978..256980,
                     256984..256986,256999..257004,257008..257010)
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    256645..256647
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(256771..256773,256777..256779,256921..256923,
                     256927..256929)
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    257032..257427
                     /gene="cheA1"
                     /locus_tag="CNE_2c02290"
                     /note="CheA regulatory domain; CheA is a histidine protein
                     kinase present in bacteria and archea. Activated by the
                     chemotaxis receptor a histidine phosphoryl group from CheA
                     is passed directly to an aspartate in the response
                     regulator CheY. This signalling...; Region: CheA_reg;
                     cd00731"
                     /db_xref="CDD:238373"
     gene            257515..258009
                     /gene="cheW2"
                     /locus_tag="CNE_2c02300"
                     /db_xref="GeneID:10920719"
     CDS             257515..258009
                     /gene="cheW2"
                     /locus_tag="CNE_2c02300"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="YP_004680448.1"
                     /db_xref="GI:339321554"
                     /db_xref="GeneID:10920719"
                     /translation="MAGIGHIDTPGSDASGQEFLVFTLGSEEYGIDILKVQEIRSYET
                     VTRISSAPDFIKGVTNLRGVIVPIVDLRLKFRLGNVRYDHQTVVIILNVAGRVVGIVV
                     DGVSDVLTLTGDAIKPAPEFGVSISTEHLTGLGTIDGRMLVLIDIERLMTSAEMALVE
                     AELA"
     misc_feature    257560..257979
                     /gene="cheW2"
                     /locus_tag="CNE_2c02300"
                     /note="CheW, a small regulator protein, unique to the
                     chemotaxis signalling in prokaryotes and archea. CheW
                     interacts with the histidine kinase CheA, most likely with
                     the related regulatory domain of CheA. CheW is proposed to
                     form signalling arrays together...; Region: CheW; cd00732"
                     /db_xref="CDD:238374"
     misc_feature    order(257692..257709,257791..257793,257797..257799,
                     257956..257979)
                     /gene="cheW2"
                     /locus_tag="CNE_2c02300"
                     /note="putative CheA interaction surface; other site"
                     /db_xref="CDD:238374"
     gene            258040..258951
                     /gene="cheR1"
                     /locus_tag="CNE_2c02310"
                     /db_xref="GeneID:10920720"
     CDS             258040..258951
                     /gene="cheR1"
                     /locus_tag="CNE_2c02310"
                     /EC_number="2.1.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="YP_004680449.1"
                     /db_xref="GI:339321555"
                     /db_xref="GeneID:10920720"
                     /translation="MTPFRTAASVPGQTGSVLAPGAILRRDDARDFLLTERDFEKIRA
                     LIHRRAGISLGSHKREMVYSRLVRRLRALQLSDFASYLALLDADDRSSEWEFFTNALT
                     TNLTSFFREAHHFPLLAEHAKKTGRPYSVWCSAASTGEEPYSIAITLAEALGDRAGTV
                     LATDIDTQVLAKARGGVYSAEQVARLSPERLKRFFLKGTGPRTGSVKVKPELAATIAF
                     EPLNLLAPDWGMREQFDAIFCRNVMIYFDKPTQGRILERFVPLLKPHGLLFAGHSENF
                     SYVTRAFQLRGQTVYELAPDAARAGRP"
     misc_feature    258139..258927
                     /gene="cheR1"
                     /locus_tag="CNE_2c02310"
                     /note="chemotaxis methyltransferase CheR; Provisional;
                     Region: PRK10611"
                     /db_xref="CDD:236725"
     misc_feature    258142..258303
                     /gene="cheR1"
                     /locus_tag="CNE_2c02310"
                     /note="CheR methyltransferase, all-alpha domain; Region:
                     CheR_N; pfam03705"
                     /db_xref="CDD:202731"
     misc_feature    258349..258912
                     /gene="cheR1"
                     /locus_tag="CNE_2c02310"
                     /note="CheR methyltransferase, SAM binding domain; Region:
                     CheR; pfam01739"
                     /db_xref="CDD:250828"
     gene            258951..259601
                     /gene="cheD"
                     /locus_tag="CNE_2c02320"
                     /db_xref="GeneID:10920721"
     CDS             258951..259601
                     /gene="cheD"
                     /locus_tag="CNE_2c02320"
                     /EC_number="3.5.1.44"
                     /codon_start=1
                     /transl_table=11
                     /product="chemoreceptor glutamine deamidase CheD"
                     /protein_id="YP_004680450.1"
                     /db_xref="GI:339321556"
                     /db_xref="GeneID:10920721"
                     /translation="MRTPHLPEALATRTYFDREFGKQAIKLLPNEYYVTREDVVLTTV
                     LGSCVAACIRDESAGVGGMNHFMLPDDDGSADRMLSASMRYGSYALEVLINELLKMGA
                     RRERLEAKVFGGGAVLANMTTLNIGDRNADFVLRYLKTEEIRVAAQDLRGPHARRVSY
                     FPVGGLALVRRLTRQDDQVSVARDERALARAIATSARAPAQSPELFARQSFARQLP"
     misc_feature    258978..259589
                     /gene="cheD"
                     /locus_tag="CNE_2c02320"
                     /note="chemoreceptor glutamine deamidase CheD;
                     Provisional; Region: PRK13489"
                     /db_xref="CDD:237398"
     gene            259625..260707
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /db_xref="GeneID:10920722"
     CDS             259625..260707
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /EC_number="3.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase"
                     /protein_id="YP_004680451.1"
                     /db_xref="GI:339321557"
                     /db_xref="GeneID:10920722"
                     /translation="MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVAR
                     DLIKRLNPDVLTLDVEMPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELG
                     AVDFVTKPKLGIRDGLLEYTHTIADKLRAASRARVRAAAQPAAPTAAGAEPVPMLRSP
                     LLSTEKLIILGASTGGTEAIKEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRI
                     TVKEAVHGERVLPGHAYIAPGDSHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSA
                     AQHGGKNVIGVILTGMGKDGARGMLRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVH
                     EVVPLPAMTQRVMARLATYGTRAQRV"
     misc_feature    259637..260686
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="chemotaxis-specific methylesterase; Provisional;
                     Region: PRK00742"
                     /db_xref="CDD:234828"
     misc_feature    259649..259954
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(259658..259663,259796..259798,259820..259822,
                     259877..259879,259940..259942,259949..259954)
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    259796..259798
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(259805..259810,259814..259822)
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    259949..259954
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    260123..260668
                     /gene="cheB1"
                     /locus_tag="CNE_2c02330"
                     /note="CheB methylesterase; Region: CheB_methylest;
                     pfam01339"
                     /db_xref="CDD:250544"
     gene            260796..261182
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /db_xref="GeneID:10920723"
     CDS             260796..261182
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator"
                     /protein_id="YP_004680452.1"
                     /db_xref="GI:339321558"
                     /db_xref="GeneID:10920723"
                     /translation="MDKSIKILVVDDFPTMRRIIRNLLKELGFVNVEEAEDGAAGLEK
                     AKDGSFQFVISDWNMPNMDGLTMLQAIRADANIGKIPVLMVTAEAKKENIIAAAQAGA
                     NGYVVKPFTAATLDEKITKIFEKLGG"
     misc_feature    260811..>261152
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    260817..261164
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(260826..260831,260961..260963,260985..260987,
                     261051..261053,261108..261110,261117..261122)
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    260961..260963
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(260970..260975,260979..260987)
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    261117..261125
                     /gene="cheY2"
                     /locus_tag="CNE_2c02340"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            261200..261832
                     /gene="cheZ"
                     /locus_tag="CNE_2c02350"
                     /db_xref="GeneID:10920724"
     CDS             261200..261832
                     /gene="cheZ"
                     /locus_tag="CNE_2c02350"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase CheZ"
                     /protein_id="YP_004680453.1"
                     /db_xref="GI:339321559"
                     /db_xref="GeneID:10920724"
                     /translation="MTPTLSNDSAEQLILRIGNLTRMLRDNMRELGLDKEIERAAQAI
                     PDARDRLNYIAAMTEQAAERTLNAVELAQPIQSGIEQQAETLDKRWDAWFEQPVELAD
                     ARSLVLDTRAFLSEVPAQARATNSHLLDIMMAQDFQDLTGQVIKKMMDMIRALEQELL
                     QVLIDNVPSERRVEAPAATLLNGPQISPEGKPDVVSDQAQVDDLLASLGF"
     misc_feature    261200..261829
                     /gene="cheZ"
                     /locus_tag="CNE_2c02350"
                     /note="chemotaxis regulator CheZ; Provisional; Region:
                     PRK11166"
                     /db_xref="CDD:236868"
     gene            262396..263076
                     /locus_tag="CNE_2c02360"
                     /db_xref="GeneID:10920725"
     CDS             262396..263076
                     /locus_tag="CNE_2c02360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680454.1"
                     /db_xref="GI:339321560"
                     /db_xref="GeneID:10920725"
                     /translation="MNKVTAISLVAAAGLLAMLGGCATESSTALPVQKVESASRPYAG
                     VRTPISVGKFDNRSSYMRGVFSDGVDRLGGQAKTVLITHLQQTNRFNVLDRDNMDEIK
                     REAAIKSQAQRLKGADYVITGDVTEFGRKETGDHQLFGILGRGKSQVAYAKVALNVVN
                     IATSEVVFTAQGAGEYSLSSREVVGFGGTSSYDSTLNGKVLDLAMREAVTNLVSGIES
                     GAWKPVTP"
     misc_feature    262402..263067
                     /locus_tag="CNE_2c02360"
                     /note="Uncharacterized protein involved in formation of
                     curli polymers [Cell envelope biogenesis, outer membrane];
                     Region: CsgG; COG1462"
                     /db_xref="CDD:224379"
     gene            263104..263478
                     /locus_tag="CNE_2c02370"
                     /db_xref="GeneID:10920726"
     CDS             263104..263478
                     /locus_tag="CNE_2c02370"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004680455.1"
                     /db_xref="GI:339321561"
                     /db_xref="GeneID:10920726"
                     /translation="MKTLFQPQRLAVPALVASALLTGCAAPAKPLYQWEGYQPQVYQY
                     FKGEPKQALIEVLERDLQKIMAAGNTPPPGYHAHLGMLYVDIGKDDEMVREFQTEKAL
                     FPESGAYVDFLLKNVKRKGEKK"
     misc_feature    263104..263457
                     /locus_tag="CNE_2c02370"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4259"
                     /db_xref="CDD:226710"
     gene            263475..264134
                     /locus_tag="CNE_2c02380"
                     /db_xref="GeneID:10920727"
     CDS             263475..264134
                     /locus_tag="CNE_2c02380"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004680456.1"
                     /db_xref="GI:339321562"
                     /db_xref="GeneID:10920727"
                     /translation="MSKLFHRVLMLLGVAMLAAGCAAPTKNVDYAAFKESHPRSIVVL
                     PPLNNSPDVKATYAMLSQATQPLAESGYYVLPVALVDETFRQNGLTIPGDIHAVAPAK
                     LREIFGADTALYITVTDYGPKFQVVSSTTVVAAEAKLLDLRTGKTLWTGQASAANNQS
                     GNAGGGLIGALIGTAIAHAISSVSDAAYGVAGRTSQQLLSAGTPGGILYGPRSPKYGT
                     D"
     misc_feature    263508..264131
                     /locus_tag="CNE_2c02380"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4380"
                     /db_xref="CDD:226815"
     gene            264374..265516
                     /gene="flhB1"
                     /locus_tag="CNE_2c02390"
                     /db_xref="GeneID:10920728"
     CDS             264374..265516
                     /gene="flhB1"
                     /locus_tag="CNE_2c02390"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="YP_004680457.1"
                     /db_xref="GI:339321563"
                     /db_xref="GeneID:10920728"
                     /translation="MSEESDLEKTEPASPRRLEKAREEGQVVRSRELATFVMLIAGVT
                     GLWTLGGHLGRSLNQVMQGALRFEPATAFDTSRMLSRFSMMVWDSLLAFLPLLFLFGV
                     AALAAPLLLGGWVFSGKSFAPQFSRLSPLAGLGRMFSAHSLVELLKAVAKSLLVGSVG
                     AWVLWRRLPEAIALMNAPVQEALLHMVDLVMNCCLVVSLSLLVVAAIDVPWQYWEYFK
                     KLRMTKEEVKQEFKESEGDPHIKGRIRQQQRAMARRRMMTEVPKADVVVTNPTHFAVA
                     LRYEEGRMGAPRVVAKGTGDIAARIRELAAEHRVPLMSAPPLARALHRHVELGQEIPA
                     GLYTAVAEVLAWVYQLKHWHYSQGPQPQAPADLPVPDELAVPEMRE"
     misc_feature    264374..265450
                     /gene="flhB1"
                     /locus_tag="CNE_2c02390"
                     /note="flagellar biosynthesis protein FlhB; Reviewed;
                     Region: flhB; PRK05702"
                     /db_xref="CDD:235569"
     gene            265513..267594
                     /gene="flhA1"
                     /locus_tag="CNE_2c02400"
                     /db_xref="GeneID:10920729"
     CDS             265513..267594
                     /gene="flhA1"
                     /locus_tag="CNE_2c02400"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="YP_004680458.1"
                     /db_xref="GI:339321564"
                     /db_xref="GeneID:10920729"
                     /translation="MNALSNLFNLPGLRSAGQLKAMTGPLLIIMILGMMILPLPAFVL
                     DLLFTFNIALAIMVLLVSMYTQKPLDFAAFPAVLLFTTLLRLSLNVASTRVVLLEGHT
                     GPDAAGKVVEAFGHFLVGGNFAVGIVVFAILVVINFMVITKGAGRIAEVGARFMLDSM
                     PGKQMSIDADLNAGLIDEAAAKKRRAEVAQESDFYGAMDGASKFVRGDAVAGLLIMFI
                     NVAAGMVVGMVQHDLDFGTAVHNYTLLTIGDGLVAQIPALVISTAAGVIVSRVSNEQD
                     VGEQLTGQLFANPRVLYLTAGIIGLMGIIPGMPHFAFLLLAGVLVWMGRYMSRRAATQ
                     EQVKQREERTPAVAQESTEASWDDVTLVDPLGMEVGYRLITLVDRAQDGELLGRIKSI
                     RKKVAQEIGFLVPVVHIRDNLELKPNAYRITLKGVEIGRGEAMPGQWMAINPGQVSGT
                     LPGAATRDPAFGLPAVWIDAGIKEQAQSYGYTVVDASTVVATHLNHLIHMHAAELLGR
                     QEVQALLDRIAKDSPKLTEDLVPKAISLTALQKILQNLLDEGVPIRDMRTILDVVAEH
                     APKISDPNELTAMVRVALGRAITQQLFPNNADLQVIGLDAGLERVLSQALTNGGGIEP
                     GLADALLQQTQGAVTRQEQMGMDPVLLVPSQLRPLMARFLRRTMPQLRVLSHAEVPDN
                     RNIRITAMIGA"
     misc_feature    265519..267591
                     /gene="flhA1"
                     /locus_tag="CNE_2c02400"
                     /note="flagellar biosynthesis protein FlhA; Validated;
                     Region: flhA; PRK06012"
                     /db_xref="CDD:235672"
     gene            267605..269935
                     /gene="flhF"
                     /locus_tag="CNE_2c02410"
                     /db_xref="GeneID:10920730"
     CDS             267605..269935
                     /gene="flhF"
                     /locus_tag="CNE_2c02410"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar GTP-binding protein FlhF"
                     /protein_id="YP_004680459.1"
                     /db_xref="GI:339321565"
                     /db_xref="GeneID:10920730"
                     /translation="MSVAKFVAANGREAMRQVREAMGPDAVVLSNRTIEGGVEIVAMR
                     DTDLGSVQATAQVYVPPAPVVEPAAISDLRGELQSMRAMLERQLAGINPAPSAVASAA
                     AHGVAASDPLRESLFEWMVGAGFSGQLARTLLARLPLGYDRPAAMGWIRTELASKLPV
                     LGDEDSLFAQGGVLALVGPTGVGKTTTTAKLAARFVLRHGADKLALLTTDSFRIGAHE
                     QLRIYGDILGVPVHAVKDAADLRFALAAMKDKHLVIIDTVGMSQRDRSLSEQIAMLAG
                     VPAPVQRVLLLNGASHGDTLNEVVHAYRHDAAPDGGGIDGCIISKLDEATHLGSVLDV
                     VIRHRLPVFYASTGQRVPEHLELANSTALVERAFLTPRRGSVFADADAARRRSAGTDD
                     EVPARGGADEVLRSLTDSADALSQCVAELNGAGLGLDLARSLWQQRGADAPALRAMSQ
                     QVREAVCRDVTRQCEQYVLASAATLQVAVPGRRTPQPMQHTLWFADRDGMPLAATVTP
                     TGRAGHPLGEAESDAASLRAAMSAARKVVNLIDAIPSAAMLARWQQAGERWVASARKT
                     ARVVSAGAAWKLDALADTLTFHAVGEDTVREREAVRWLASAEVRVPDSPVRGKGTPEG
                     GIDACLVVARLADRATGELLDTRYLLCDPALAQDAAQVARWALWTDAADARLRTLRHA
                     IDHFAQDAESGHAAGAALAALQLGLSVLRLEHAPTAAAPAFLARLAGRTARQGAPVPG
                     TVLNEGMGRMLALLDVLENYPGRGTAVSAEAMEVLQ"
     misc_feature    267605..269878
                     /gene="flhF"
                     /locus_tag="CNE_2c02410"
                     /note="flagellar biosynthesis regulator FlhF; Provisional;
                     Region: flhF; PRK14723"
                     /db_xref="CDD:237802"
     misc_feature    268115..268708
                     /gene="flhF"
                     /locus_tag="CNE_2c02410"
                     /note="SRP54-type protein, GTPase domain; Region: SRP54;
                     smart00962"
                     /db_xref="CDD:214940"
     gene            269947..270741
                     /gene="motR"
                     /locus_tag="CNE_2c02420"
                     /db_xref="GeneID:10920731"
     CDS             269947..270741
                     /gene="motR"
                     /locus_tag="CNE_2c02420"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar synthesis regulator MotR"
                     /protein_id="YP_004680460.1"
                     /db_xref="GI:339321566"
                     /db_xref="GeneID:10920731"
                     /translation="MDQAESLRRMLAPRTTRRIAVVASEGGAGATTVALGLSHALAMQ
                     GERVLLVDEDAAAARATRLSGARPAGTLADVSAGRLPLEAAAGTGPGGVLSVLPAGRP
                     VPGSALSAAAASGFRSVLVDAGVDADGALSPLAGGAHNVLIVMRPELASITAAYACIK
                     RLHHLYAWRQFHLIVNMAASEATVQAILRNLARTASQYLGVEALCAGWLPSDPLVARG
                     VQLGRCVVEAFPAAPATTALRRTAGSIGAWPLRADASAPVPAAAMA"
     misc_feature    269992..270702
                     /gene="motR"
                     /locus_tag="CNE_2c02420"
                     /note="Antiactivator of flagellar biosynthesis FleN, an
                     ATPase [Cell motility]; Region: flhG; COG0455"
                     /db_xref="CDD:223531"
     misc_feature    270001..270576
                     /gene="motR"
                     /locus_tag="CNE_2c02420"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            270838..271554
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /db_xref="GeneID:10920732"
     CDS             270838..271554
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase flagellum specific
                     sigma subunit"
                     /protein_id="YP_004680461.1"
                     /db_xref="GI:339321567"
                     /db_xref="GeneID:10920732"
                     /translation="MYTIQGKLEQADVVKAHAQLVRRIALQLAARLPASVQIDDLIQA
                     GMIGLLDAAKRYEDTHGARFETYASQRIRGAMLDEVRANDWQSRSLRQFTRRIERTQR
                     GLEQKLGRAPVDSEVAEAMEMALDEYQLLLNEVYGCQLLHYEDFERSGEEDFLDRHLG
                     GSDDGNPLTVLMESGMREALIRAIDRLPEREKLVLSLCYDQELNLREIGAVLDVTESR
                     VCQIRGQAITRLRNQLRGLL"
     misc_feature    270838..271545
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /note="flagellar biosynthesis sigma factor; Validated;
                     Region: fliA; PRK06986"
                     /db_xref="CDD:235901"
     misc_feature    270874..271095
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    271120..271347
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /note="Sigma-70 region 3; Region: Sigma70_r3; pfam04539"
                     /db_xref="CDD:146934"
     misc_feature    271366..271530
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(271399..271401,271429..271431,271447..271452,
                     271480..271482,271486..271491,271495..271503,
                     271507..271512,271516..271518)
                     /gene="fliA"
                     /locus_tag="CNE_2c02430"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            271563..271991
                     /gene="flhE"
                     /locus_tag="CNE_2c02440"
                     /db_xref="GeneID:10920733"
     CDS             271563..271991
                     /gene="flhE"
                     /locus_tag="CNE_2c02440"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhE"
                     /protein_id="YP_004680462.1"
                     /db_xref="GI:339321568"
                     /db_xref="GeneID:10920733"
                     /translation="MGRAARGACCLLAAVSACAWAAIEGGTRHAWTGSVNGPALYGRG
                     QRAVSPPILPIGVLPQSEGVITSVRWRYSFAKTPPLELQAYLCNAQRCVLLPQAEGKT
                     DAFFGDDATKGFVFAFRVPGQGSLVPVLQGRSNELVVGFR"
     misc_feature    271671..271988
                     /gene="flhE"
                     /locus_tag="CNE_2c02440"
                     /note="Flagellar protein FlhE; Region: FlhE; pfam06366"
                     /db_xref="CDD:191502"
     gene            complement(272019..272480)
                     /gene="flgN"
                     /locus_tag="CNE_2c02450"
                     /db_xref="GeneID:10920734"
     CDS             complement(272019..272480)
                     /gene="flgN"
                     /locus_tag="CNE_2c02450"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlgN"
                     /protein_id="YP_004680463.1"
                     /db_xref="GI:339321569"
                     /db_xref="GeneID:10920734"
                     /translation="MNQSLIQSLQRETEGIQAFGQLLAEERDALKRGDFQSLSGLLTR
                     KVELGQALSRQLKAREAQMGTLGLRAGPEGQLLGRQVDPAVADAWRQLIFAARTARDG
                     NALNGAVVNAHLDFTREAIQALRQHSGGDAGLYGKDGKAAAGAGGVSLAAG"
     misc_feature    complement(272091..272471)
                     /gene="flgN"
                     /locus_tag="CNE_2c02450"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     gene            complement(272486..272794)
                     /gene="flgM"
                     /locus_tag="CNE_2c02460"
                     /db_xref="GeneID:10920735"
     CDS             complement(272486..272794)
                     /gene="flgM"
                     /locus_tag="CNE_2c02460"
                     /codon_start=1
                     /transl_table=11
                     /product="negative regulator of flagellin synthesis"
                     /protein_id="YP_004680464.1"
                     /db_xref="GI:339321570"
                     /db_xref="GeneID:10920735"
                     /translation="MKINHTASSRPADAPAGDAAARPQAAPASAAAPSAGLSVSPLAA
                     QVRDISARLMQPTDDDIDTAKVEEIRQAIAEGRIRIDPGKIADGLLATLRELGQAEPR
                     "
     misc_feature    complement(272519..272794)
                     /gene="flgM"
                     /locus_tag="CNE_2c02460"
                     /note="flagellar biosynthesis anti-sigma factor FlgM;
                     Region: FlgM_jcvi; TIGR03824"
                     /db_xref="CDD:213867"
     gene            complement(272956..273771)
                     /gene="flgA"
                     /locus_tag="CNE_2c02470"
                     /db_xref="GeneID:10920736"
     CDS             complement(272956..273771)
                     /gene="flgA"
                     /locus_tag="CNE_2c02470"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P ring formation protein
                     FlgA"
                     /protein_id="YP_004680465.1"
                     /db_xref="GI:339321571"
                     /db_xref="GeneID:10920736"
                     /translation="MKQNRRNARSLAQDLLAACLLGPAAAGAAPAQVMSVAMQAPAAH
                     GQQQAAYAGNPAANPAANPAASPFAEDPARVAVERFLLQQTAGLPGKVSVQVAPPSGG
                     RAPDCLAPDPFLPAGTSTWGRVSVGVRCGGERPWVRYMQARVSVLTDYYVAARALGPG
                     EPVSQADIEVRQGDLGTLPRAVITDPAQLAGAVTANRIAAGSPIRADLLRKAIAVRQG
                     QTVTVAVEGDAFQITSEGKVLADAATGNTVQVRLRSGQVVNGLVRSGDTVVLQ"
     misc_feature    complement(273145..273327)
                     /gene="flgA"
                     /locus_tag="CNE_2c02470"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     gene            274016..274423
                     /gene="flgB"
                     /locus_tag="CNE_2c02480"
                     /db_xref="GeneID:10920737"
     CDS             274016..274423
                     /gene="flgB"
                     /locus_tag="CNE_2c02480"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgB"
                     /protein_id="YP_004680466.1"
                     /db_xref="GI:339321572"
                     /db_xref="GeneID:10920737"
                     /translation="MIDRLDAALRFQQEALSLRNQRQSVIASNIAHADTPGYKARDFD
                     FSSTLAQSVERGHRNEGMSLSTTSIRHLPAQAPGREEFDLAYRIPLQSSVDGNTVEMD
                     TERVAFADNAVHFESGLTVMNSKIKTMLAAIQQ"
     misc_feature    274016..274420
                     /gene="flgB"
                     /locus_tag="CNE_2c02480"
                     /note="flagellar basal body rod protein FlgB; Reviewed;
                     Region: flgB; PRK05680"
                     /db_xref="CDD:180196"
     misc_feature    274016..274417
                     /gene="flgB"
                     /locus_tag="CNE_2c02480"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     gene            274448..274855
                     /gene="flgC"
                     /locus_tag="CNE_2c02490"
                     /db_xref="GeneID:10920738"
     CDS             274448..274855
                     /gene="flgC"
                     /locus_tag="CNE_2c02490"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="YP_004680467.1"
                     /db_xref="GI:339321573"
                     /db_xref="GeneID:10920738"
                     /translation="MPAMNIFDVAGSAMAAQSQRMNVTASNLANADSVVSPDGQAYRA
                     KQVVFGMAPTPGQTDIGGVQVRGVSEDPSPPRMVHNPTHPMANAQGYVVMPNVNPVEE
                     MVNMISASRSYQANVEVLNTAKNMMLKTLTIGQ"
     misc_feature    274448..274852
                     /gene="flgC"
                     /locus_tag="CNE_2c02490"
                     /note="flagellar basal body rod protein FlgC; Reviewed;
                     Region: flgC; PRK05681"
                     /db_xref="CDD:235556"
     misc_feature    274451..274852
                     /gene="flgC"
                     /locus_tag="CNE_2c02490"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     misc_feature    <274709..274846
                     /gene="flgC"
                     /locus_tag="CNE_2c02490"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            274911..275582
                     /gene="flgD"
                     /locus_tag="CNE_2c02500"
                     /db_xref="GeneID:10920739"
     CDS             274911..275582
                     /gene="flgD"
                     /locus_tag="CNE_2c02500"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod modification protein
                     FlgD"
                     /protein_id="YP_004680468.1"
                     /db_xref="GI:339321574"
                     /db_xref="GeneID:10920739"
                     /translation="MTTTSAVGSNSNTQGINDALKSGSASASELQNNFLTMLVTQMNN
                     QDPLNPMDNAQLTSQLAQISTVSGMQTMNATLSQLLSQVSASRAMDSAALIGHTVMVP
                     GKQVSVAGGVPGKFGLDLPSTADAVTVDVLDKDGNVVRTIDMKGQTAGVHNVAWDGKN
                     NAGAAVADGDYTFKVTATANGTSVQPVALVYGKVQSISGDASGVLVDLGDGQTANVDD
                     VRRIL"
     misc_feature    274911..275579
                     /gene="flgD"
                     /locus_tag="CNE_2c02500"
                     /note="flagellar basal body rod modification protein;
                     Reviewed; Region: flgD; PRK06655"
                     /db_xref="CDD:235847"
     misc_feature    274914..275147
                     /gene="flgD"
                     /locus_tag="CNE_2c02500"
                     /note="Flagellar hook capping protein - N-terminal region;
                     Region: FlgD; pfam03963"
                     /db_xref="CDD:252280"
     misc_feature    275166..275579
                     /gene="flgD"
                     /locus_tag="CNE_2c02500"
                     /note="FlgD Tudor-like domain; Region: FLgD_tudor;
                     pfam13861"
                     /db_xref="CDD:258131"
     gene            275651..276892
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /db_xref="GeneID:10920740"
     CDS             275651..276892
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="YP_004680469.1"
                     /db_xref="GI:339321575"
                     /db_xref="GeneID:10920740"
                     /translation="MGFGQGVSGLNAAASNLDVIGNNIANANTVGYKQSAAQFADIYA
                     GTKIGLGVRVNSVVQSFNQGNIEASGRALDVAITNGNGFFRLTSPEGAVYYSRNGQFQ
                     RQEDGRITNMQGLQVTGYPAGVAGGAGVQPQPLVVSNAQMEPKATSNITAKFQLDSRS
                     KVPANPFPTAAVPPATTPAPDSSMFNYSTAINVYDSLGNKQQLMAYFAKSGGAPTVGG
                     GTDWKMYVTDVNGNPVGGAPLTLAFDNAGALKSPAANAVTLTQPAANGAQAMTMALDL
                     TGTTQFGADNDVKQLSQNGYTSGSLLGFSVNGDGTITGSYSNEQTKPLGQIVMAAFGN
                     VEGLKPEGDNVWSATGASGQALVGTAGGSMGTLRSNAVEASNVDLSGQLVNLIVAQRN
                     YQANAQTIKAQDTVMQTLVNL"
     misc_feature    275651..276889
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /note="flagellar hook protein FlgE; Validated; Region:
                     flgE; PRK05682"
                     /db_xref="CDD:235557"
     misc_feature    275663..275749
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    276185..276538
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /note="Flagellar basal body protein FlaE; Region: FlaE;
                     pfam07559"
                     /db_xref="CDD:254288"
     misc_feature    276656..276889
                     /gene="flgE"
                     /locus_tag="CNE_2c02510"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            276919..277662
                     /gene="flgF"
                     /locus_tag="CNE_2c02520"
                     /db_xref="GeneID:10920741"
     CDS             276919..277662
                     /gene="flgF"
                     /locus_tag="CNE_2c02520"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="YP_004680470.1"
                     /db_xref="GI:339321576"
                     /db_xref="GeneID:10920741"
                     /translation="MDRMIYTALSGAKQILDQQAAVSNNLANVSTPAFRAQVNLYRAV
                     PVVGPEAGTRAFTLASTPGADMRAGPLTYTGRTLDVALQGNGWLVVQAPDGTEAYTRA
                     GALQVAQDGQVQTISGLPVMGDGGPLAVPPGSQVTIGTDGTITARGPGEASAGLAPVG
                     RLRVVNPPNDAIARGDDGLFRLRPGAQPLEADPTVRVISGALEGSNVNPTEAMVEMIA
                     NARRFEMQMKMIQGADGNEQRANQLLSTN"
     misc_feature    276919..277653
                     /gene="flgF"
                     /locus_tag="CNE_2c02520"
                     /note="flagellar basal body rod protein FlgF; Reviewed;
                     Region: flgF; PRK12640"
                     /db_xref="CDD:183642"
     misc_feature    276931..277023
                     /gene="flgF"
                     /locus_tag="CNE_2c02520"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    277306..277590
                     /gene="flgF"
                     /locus_tag="CNE_2c02520"
                     /note="flagellar basal-body rod protein FlgF; Region:
                     flgF; TIGR02490"
                     /db_xref="CDD:233892"
     gene            277717..278502
                     /gene="flgG"
                     /locus_tag="CNE_2c02530"
                     /db_xref="GeneID:10920742"
     CDS             277717..278502
                     /gene="flgG"
                     /locus_tag="CNE_2c02530"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgG"
                     /protein_id="YP_004680471.1"
                     /db_xref="GI:339321577"
                     /db_xref="GeneID:10920742"
                     /translation="MIRSLWIAKTGLDAQQTQMDVISNNLANVSTNGFKRGRAVFEEL
                     MYQTIRQPGALSSDQTTLPSGMQLGTGVRPVATERIHTQGNPQQTGNAKDVAILGQGF
                     FQVALPDGTTAYTRDGSFQVDQNGQLVTSSGFVIQPAITIPANTLSMTIARDGTVSVT
                     QPGSSANVQVGQLQLATFMNPAGLESMGENLYVQTDASGAPNTTVPGLNGAGVVQQNY
                     VEASNVNVVEELVSMIQTQRAYEINSKAVQASDQMLQRLSQLG"
     misc_feature    277717..278496
                     /gene="flgG"
                     /locus_tag="CNE_2c02530"
                     /note="flagellar basal body rod protein FlgG; Reviewed;
                     Region: flgG; PRK12694"
                     /db_xref="CDD:183688"
     misc_feature    277729..277821
                     /gene="flgG"
                     /locus_tag="CNE_2c02530"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    278260..278496
                     /gene="flgG"
                     /locus_tag="CNE_2c02530"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            278514..279212
                     /gene="flgH"
                     /locus_tag="CNE_2c02540"
                     /db_xref="GeneID:10920743"
     CDS             278514..279212
                     /gene="flgH"
                     /locus_tag="CNE_2c02540"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar L-ring protein FlgH"
                     /protein_id="YP_004680472.1"
                     /db_xref="GI:339321578"
                     /db_xref="GeneID:10920743"
                     /translation="MATLLSRLGAHALVCLAGVAMLASGGCALMPREPLVQLPTTARA
                     EPRPMGPASGSIYQSSYAGNPLFEDRRPRYVGDILTILITENVNASKNSGTNASRTGN
                     TALAFDAVPRALSGLFNSSSNASINGANTMKASGGASAANTFNGTITVTVLEVLTNGN
                     LVVSGEKQMAINQGAEFIRFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQN
                     MGWLQRFFLNVSPF"
     misc_feature    278526..279209
                     /gene="flgH"
                     /locus_tag="CNE_2c02540"
                     /note="flagellar basal body L-ring protein; Reviewed;
                     Region: flgH; PRK12697"
                     /db_xref="CDD:237175"
     gene            279196..280365
                     /gene="flgI"
                     /locus_tag="CNE_2c02550"
                     /db_xref="GeneID:10920744"
     CDS             279196..280365
                     /gene="flgI"
                     /locus_tag="CNE_2c02550"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar P-ring protein FlgI"
                     /protein_id="YP_004680473.1"
                     /db_xref="GI:339321579"
                     /db_xref="GeneID:10920744"
                     /translation="MFLRSDRAMSAPMLARFLSRLLRLSVISLALGVAFGAFATVAKA
                     ERLKNLATFQGVRENPLVGYGLVVGLDNTGDQTMQTPFTTQSLTNMLSQLGITLPAGK
                     NMQLKNVAAVMVTASLPAFAQPGSQLDIVVSSMGNAKSLRGGTLLMTPLKGADGQVYA
                     IAQGNMLVGGAGASANGSKVQINQLAVGRIANGAIVERAVAPFQPDGGVLNLELKDTD
                     FGTAERVVEAINRSMGGGVAAALDGRVVQVRAPASAAARVGFLARIENIDVTPAKAAA
                     KVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPFSEGRTVVAPVSQI
                     DMKQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEVI"
     misc_feature    279262..280362
                     /gene="flgI"
                     /locus_tag="CNE_2c02550"
                     /note="flagellar basal body P-ring protein; Provisional;
                     Region: flgI; PRK05303"
                     /db_xref="CDD:235399"
     gene            280368..281411
                     /gene="flgJ"
                     /locus_tag="CNE_2c02560"
                     /db_xref="GeneID:10920745"
     CDS             280368..281411
                     /gene="flgJ"
                     /locus_tag="CNE_2c02560"
                     /EC_number="3.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan hydrolase FlgJ"
                     /protein_id="YP_004680474.1"
                     /db_xref="GI:339321580"
                     /db_xref="GeneID:10920745"
                     /translation="MNTARPPQAAELTQRFALDTQGFEALKRSARGGADANTLQAVAK
                     QFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYMSMMDQQLAQQMSSRGIGLADVMVRQ
                     LARATGTAMPAGMSAMSPAESGKAADAEMARLLDSRGAGAVPADAGEQADLPALGTIV
                     PGQNWNPTAGLRQYQPQWYADRGQGEDKLGRLPDDAPAHVSAFVARMAGPAEAAARAS
                     GVPARLIVGQAALESGWGQREITHADGSTTFNVFGIKAGASWKGRVAEITTTEYVDGQ
                     PQKVRAKFRAYGSYDEACADYARLLTNNPRYAGVVSAASAEEAAHGLQRAGYATDPAY
                     GHKLVKIMKKVAA"
     misc_feature    280368..281408
                     /gene="flgJ"
                     /locus_tag="CNE_2c02560"
                     /note="flagellar rod assembly protein/muramidase FlgJ;
                     Provisional; Region: flgJ; PRK12712"
                     /db_xref="CDD:139172"
     misc_feature    280401..280799
                     /gene="flgJ"
                     /locus_tag="CNE_2c02560"
                     /note="Rod binding protein [Cell envelope biogenesis,
                     outer membrane / Cell motility and secretion /
                     Posttranslational modification, protein turnover,
                     chaperones]; Region: COG3951"
                     /db_xref="CDD:226460"
     misc_feature    <280971..281402
                     /gene="flgJ"
                     /locus_tag="CNE_2c02560"
                     /note="Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Region:
                     Glucosaminidase; cl17361"
                     /db_xref="CDD:266650"
     gene            281897..282844
                     /locus_tag="CNE_2c02570"
                     /db_xref="GeneID:10920746"
     CDS             281897..282844
                     /locus_tag="CNE_2c02570"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS110 family"
                     /protein_id="YP_004680475.1"
                     /db_xref="GI:339321581"
                     /db_xref="GeneID:10920746"
                     /translation="MGAQDPKFGDQATLLNPRYVRSFVRTNKTDAADARAIWTAALQP
                     GMPSVPVKTEAQQALLGSHRIRSELVDTRTRRVNQLRGLLGEFGLHFTAGRHAGLAEI
                     RARREEIENAVPPVLWSALARQLDEIRREDEQILEIEREIANWLRSHPAGQTVEEIPG
                     IGPITASALVATMGSAQAFRSGRAFAASLGLVPRQSGSGGKVQLGGISKRGDPYLRRL
                     LIHGARIVLTRSRKRPAWAEALLARRPTPLGHQARHERLGRSQLLPSRPQSYHRTRPD
                     IGPQPIPNTSKHLTQTLASGRCSYKGSKPAGSGERHFHT"
     misc_feature    281915..282628
                     /locus_tag="CNE_2c02570"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    <281936..282133
                     /locus_tag="CNE_2c02570"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    282353..282610
                     /locus_tag="CNE_2c02570"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            282933..284858
                     /gene="flgK"
                     /locus_tag="CNE_2c02580"
                     /db_xref="GeneID:10920747"
     CDS             282933..284858
                     /gene="flgK"
                     /locus_tag="CNE_2c02580"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein 1"
                     /protein_id="YP_004680476.1"
                     /db_xref="GI:339321582"
                     /db_xref="GeneID:10920747"
                     /translation="MSLFSIGLSGLNTAQNALTTTGHNFANSATEGYSRQNTIVASAG
                     GQYTSQGFYGFGSNTTTVTRVYDEFLTGQLRGATSASASLAAYSDQIAQIDNLLADQK
                     GGLAPLMQKFFAAVQAVADTPADPAARQGMLSAGQALVGQVRSASNYFKQLQAGVNEQ
                     VGTAVTQVNAYTKQIANLNQEITRLKAASGGQPPNDLLDQRDQAVAELTKLVGAKVVV
                     QDSGTYNVFVGNGQPLVMGNDAYALKAVASAADPNRTVVAYTLPNGNVFESEPGAITG
                     GSLGGLLQFRTESLDAAQSAIGRLSLAIGQSFNAQHELGIDLNGAIGTDMFALGGATA
                     IPNANNTVKTTVATAKIANASALTTSDYKLQFDGTNYTLTRLSDNQQVVAPVPAGGAS
                     YPLQFSADGFTVEINAAMGTNDSFTIQPTRNAATGFDMAISDPARIAAASPAHVEAGA
                     LNKGSGTASLSNVAPGFTLPAANITAEFDGSLNKYVFKVGGTAMAPQPVGVANGSNTD
                     FTLNGLTFSFGGTPKAGDTFTLVSNAGAVKDNGNMLALAKLQNAKTIGGVSSFSEGYA
                     QLVNDVGTRAKSVKIASASQDSITTQIKTAQQSVSGVNMDEETVSMLRFQQLYQANAR
                     VIQTAGTLFDTIIGIGR"
     misc_feature    282933..284852
                     /gene="flgK"
                     /locus_tag="CNE_2c02580"
                     /note="flagellar hook-associated protein FlgK; Validated;
                     Region: flgK; PRK06945"
                     /db_xref="CDD:235895"
     misc_feature    <284733..284849
                     /gene="flgK"
                     /locus_tag="CNE_2c02580"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            284905..286134
                     /gene="flgL"
                     /locus_tag="CNE_2c02590"
                     /db_xref="GeneID:10920748"
     CDS             284905..286134
                     /gene="flgL"
                     /locus_tag="CNE_2c02590"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein 3"
                     /protein_id="YP_004680477.1"
                     /db_xref="GI:339321583"
                     /db_xref="GeneID:10920748"
                     /translation="MRVASSTLYQQGLASMNYQQGSLLHIQQQLGTGRSILTPSDDPV
                     GATRALGVSQAQAVNGQYATSRKQANIALAAEENALQSVTTVTQNIQTLLVQAGNGTM
                     SDADRGSLATALEGLYNQLAGLANSDDGNGQYLFGGTRSGSAPFTQSTGPGTYIGDNG
                     QQLLQVDVARQMPAGNTGREVFMSVTGGAGYVVKGNANNTGSATFGTVSTTNPSDPNY
                     GLSMEVKFATNASGQMEYTITDLSAGTTPAPVVKGPVAYTSPAHIDVAGVSFNVTGDP
                     KDGDTMTMDPASKAGTDMFANLQTVIDTLRQPTPNNSDRAHLGNVISTATRQFSNSLD
                     NVLTVRASVGSRMNELDALDDVGSNRDLTYAQTLSGLQDLDYAKAITEYYQRQTALQG
                     AQQSFMQIQGMNLFKYL"
     misc_feature    284905..286131
                     /gene="flgL"
                     /locus_tag="CNE_2c02590"
                     /note="flagellar hook-associated protein FlgL; Reviewed;
                     Region: flgL; PRK08870"
                     /db_xref="CDD:236345"
     misc_feature    284911..285321
                     /gene="flgL"
                     /locus_tag="CNE_2c02590"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     gene            286986..287171
                     /locus_tag="CNE_2c02600"
                     /db_xref="GeneID:10920749"
     CDS             286986..287171
                     /locus_tag="CNE_2c02600"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_004680478.1"
                     /db_xref="GI:339321584"
                     /db_xref="GeneID:10920749"
                     /translation="MRARAHGCTKAAVLTSEYPAFFARFGFTLTAVGEMPQEMQLSKE
                     FVRRFGARTHCMCRRLD"
     misc_feature    <286986..287135
                     /locus_tag="CNE_2c02600"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            288003..288125
                     /locus_tag="CNE_2c02610"
                     /db_xref="GeneID:10920750"
     CDS             288003..288125
                     /locus_tag="CNE_2c02610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680479.1"
                     /db_xref="GI:339321585"
                     /db_xref="GeneID:10920750"
                     /translation="MRLTSFFGEFVEASNGCRRLTAHRSARGERVDESGHLASV"
     gene            288498..288611
                     /locus_tag="CNE_2c02620"
                     /db_xref="GeneID:10920751"
     CDS             288498..288611
                     /locus_tag="CNE_2c02620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680480.1"
                     /db_xref="GI:339321586"
                     /db_xref="GeneID:10920751"
                     /translation="MHQHCLPAEAFQWWEVGVAIGNVPNQGKELIRSVAAV"
     misc_feature    <288501..288599
                     /locus_tag="CNE_2c02620"
                     /note="Uncharacterized ACR, COG2135; Region: DUF159;
                     cl03646"
                     /db_xref="CDD:261818"
     gene            288654..288821
                     /locus_tag="CNE_2c02630"
                     /db_xref="GeneID:10920752"
     CDS             288654..288821
                     /locus_tag="CNE_2c02630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680481.1"
                     /db_xref="GI:339321587"
                     /db_xref="GeneID:10920752"
                     /translation="MAFAVEDALYYLLVFFTFSFGKADGASGSETKEVGATVPGVAVA
                     LVLSVAWTWVA"
     gene            complement(288975..289214)
                     /locus_tag="CNE_2c02640"
                     /db_xref="GeneID:10920753"
     CDS             complement(288975..289214)
                     /locus_tag="CNE_2c02640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680482.1"
                     /db_xref="GI:339321588"
                     /db_xref="GeneID:10920753"
                     /translation="MDTPFHQFSDLFAQLGLPSSKADILAFIAKHSPLPQDINLWEAP
                     FWTPAQAALLRDEFDEDADWAQAVDQLNLALRTTA"
     misc_feature    complement(288990..289214)
                     /locus_tag="CNE_2c02640"
                     /note="Protein of unknown function (DUF2789); Region:
                     DUF2789; pfam10982"
                     /db_xref="CDD:204569"
     gene            complement(289562..290260)
                     /locus_tag="CNE_2c02650"
                     /db_xref="GeneID:10920754"
     CDS             complement(289562..290260)
                     /locus_tag="CNE_2c02650"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_004680483.1"
                     /db_xref="GI:339321589"
                     /db_xref="GeneID:10920754"
                     /translation="MSNAKLEVLTPHNSQLIIIDHQPQMAFGVQSMDRQTMKNNVVGL
                     AKAAKIFDVPTTITTVESESFSGYTYPEILDVFPGKETLERTSMNSWDDQKVRDALAA
                     DGRKKIVVAGLWTEVCNTTFALSAMLEGDYEIYMVADASGGTTKEAHDYAMQRMIQAG
                     VVPVTWQQVLLEWQRDWAHRDTYDAVMKLVKEHSGAYGMGVDYAYTMVHKAAQRTATT
                     HESIAPVHAPVIEN"
     misc_feature    complement(289736..290215)
                     /locus_tag="CNE_2c02650"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(289907..289909,290006..290008,
                     290201..290203))
                     /locus_tag="CNE_2c02650"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(290045..290047,290183..290185,
                     290192..290194))
                     /locus_tag="CNE_2c02650"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(289919..289924)
                     /locus_tag="CNE_2c02650"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            complement(290871..291110)
                     /locus_tag="CNE_2c02660"
                     /db_xref="GeneID:10920755"
     CDS             complement(290871..291110)
                     /locus_tag="CNE_2c02660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680484.1"
                     /db_xref="GI:339321590"
                     /db_xref="GeneID:10920755"
                     /translation="MNGNICLKTAQLQAAAHANEQDATLWRWFSDQMEDQMMSCERKR
                     GDWIICVAGRELARDPSFDLAVRAAHFLCRALKAL"
     gene            291558..292412
                     /locus_tag="CNE_2c02670"
                     /db_xref="GeneID:10920756"
     CDS             291558..292412
                     /locus_tag="CNE_2c02670"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004680485.1"
                     /db_xref="GI:339321591"
                     /db_xref="GeneID:10920756"
                     /translation="MSEALRYDQALAAGDLNFYRKSSVIERMSQVVTPASARGFLVGV
                     SLMEGHRRRIFRPNQANMHAFEAGSIYLRNFQDDYKADMYGTFDFVLIELPRPFMERT
                     ALELGCPAGLELRHAAAQTDAVLAHLAQALLPALARPEGASRLFIDQLGHVIGTYLVE
                     HYGGVNRGRIPSIGRLSPRILARAQEFLAARLDDGNVSIAEVADACQLSRSHFSRAFR
                     QSTGKTPHEWLLERRLERAAALLRTTDLPIAGIAASCGFADQSHLTRSFSKKLGLTPG
                     DWRSGRQD"
     misc_feature    292143..292394
                     /locus_tag="CNE_2c02670"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    292143..292247
                     /locus_tag="CNE_2c02670"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    292284..292394
                     /locus_tag="CNE_2c02670"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            292622..293332
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /db_xref="GeneID:10920757"
     CDS             292622..293332
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodW"
                     /protein_id="YP_004680486.1"
                     /db_xref="GI:339321592"
                     /db_xref="GeneID:10920757"
                     /translation="MRAESAPQDDAVVLVVDDDLQVRNALGSLFRSVGIQAVLLGSAA
                     ELFAFGFPDAPCCLVLDVRLKGQSGLDVQARMAELGIHIPIIFMTGYGDIPMTVAAMK
                     AGAEHFLSKPFREQELLDAVTEALQKEGSRRERLCRLAAVRDCFRSLTPRESEVMAHA
                     ASGLTNKEIAAAMCISVVTVKVHRCQAMRKMRARSFADLVLLAQTLGLVLLPSESEAD
                     EQPAIRLQPRQLGTATIA"
     misc_feature    292688..293245
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="Response regulator [Signal transduction
                     mechanisms]; Region: TtrR; COG4566"
                     /db_xref="CDD:226932"
     misc_feature    292688..292999
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(292802..292804,292826..292828,292886..292888,
                     292943..292945,292952..292957)
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    292802..292804
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(292811..292816,292820..292828)
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    292952..292960
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    293066..293230
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(293069..293077,293114..293122,293144..293149,
                     293153..293158,293162..293176,293207..293209)
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(293102..293104,293108..293110,293114..293116,
                     293207..293215,293222..293224)
                     /gene="nodW1"
                     /locus_tag="CNE_2c02680"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(293405..293740)
                     /locus_tag="CNE_2c02690"
                     /db_xref="GeneID:10920758"
     CDS             complement(293405..293740)
                     /locus_tag="CNE_2c02690"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator receiver"
                     /protein_id="YP_004680487.1"
                     /db_xref="GI:339321593"
                     /db_xref="GeneID:10920758"
                     /translation="MGGLLRSLDFGVQLFGGGQELLRCTSLPCMSCVITDAQMPGMDG
                     FALIEALRARNLDMPVIFMTAFAHEGFDQRAKAMGATCVLYKPFQDTDMIRCIEKAIR
                     PRKTDSPPS"
     misc_feature    complement(293438..293731)
                     /locus_tag="CNE_2c02690"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(293480..293485,293492..293494,
                     293549..293551,293609..293611,293633..293635))
                     /locus_tag="CNE_2c02690"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(293633..293635)
                     /locus_tag="CNE_2c02690"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(293609..293617,293621..293626))
                     /locus_tag="CNE_2c02690"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(293477..293485)
                     /locus_tag="CNE_2c02690"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(294553..295281)
                     /locus_tag="CNE_2c02700"
                     /db_xref="GeneID:10920759"
     CDS             complement(294553..295281)
                     /locus_tag="CNE_2c02700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680488.1"
                     /db_xref="GI:339321594"
                     /db_xref="GeneID:10920759"
                     /translation="MTPTQLPDAGRRADLSGPAFGCILAFVAGYVDVVGFISLFGLFT
                     AHVTGNFVMIGVDIAGDSPGLLAKLLALPTFALAVAAARLTESRIVRDKQSAPSLLLF
                     AEALALVLFIVAGFHASPISDPSTPAAVGAGMLAVVAMGIQNSLSRTSLSDLGPTTIM
                     TGNTTQIIIDLVDLPSASEADGKAIRGRLKKMVPALAGFASGAALGALGYSMLSLWCV
                     MLPAVLLTALSFLTWRNGANSLQK"
     misc_feature    complement(294583..295227)
                     /locus_tag="CNE_2c02700"
                     /note="Protein of unknown function (DUF1275); Region:
                     DUF1275; pfam06912"
                     /db_xref="CDD:253974"
     gene            complement(295315..296463)
                     /locus_tag="CNE_2c02710"
                     /db_xref="GeneID:10920760"
     CDS             complement(295315..296463)
                     /locus_tag="CNE_2c02710"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin"
                     /protein_id="YP_004680489.1"
                     /db_xref="GI:339321595"
                     /db_xref="GeneID:10920760"
                     /translation="MSRSRKQPEALASRTNAIAPRRIHVALAASLSAAAAPAVADNNV
                     AIYGRLNTAIEYVTVTTATDGTRLGNTARLTNNRSVFGMRGEEQLANGIKAIWQIESA
                     LSVDNGAGQIAARDTRLGLQSPYGTLFMGNWDTPYTSATKSYDPYYATTAGYMALIGN
                     GAASTSDNVQNTSSFDRRQKNSLHYQSPTWHGLSGAIAWGLPEEKTTVPRNPALYSFA
                     TAYGHGNLNLTLAYEIHQHYQTSGRNDDAIKAGVSYQFPSTRISALYERLHYRTATGD
                     LTRNGYYVSLIQEFGPGSIRAGFAFVGDGTGTAMETIGSVRSGSDTGAFQVTVGYDYP
                     LSKRTALYAYYSRINNRSNANYDFAINNLGIKAGADPQTFAIAMRHSF"
     misc_feature    complement(295318..296340)
                     /locus_tag="CNE_2c02710"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(295318..295320,295324..295326,
                     295330..295332,295447..295449,295456..295461,
                     295921..295926,295930..295932,296068..296076,
                     296101..296115,296119..296124,296146..296157,
                     296161..296163,296167..296175,296179..296181,
                     296197..296211,296302..296310,296314..296316,
                     296332..296334,296338..296340))
                     /locus_tag="CNE_2c02710"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(295930..295932,296029..296031,
                     296119..296121,296224..296226,296317..296319))
                     /locus_tag="CNE_2c02710"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(296468..296761)
                     /locus_tag="CNE_2c02720"
                     /db_xref="GeneID:10920761"
     CDS             complement(296468..296761)
                     /locus_tag="CNE_2c02720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680490.1"
                     /db_xref="GI:339321596"
                     /db_xref="GeneID:10920761"
                     /translation="MKLYLISLGAGILVGIIYALMQVRSPAPPAIALIGLLGMLIGEQ
                     VVPPVKRMLAGEPVTIAWFRGECVPKITGTPPNADTAVEPSASLPARSKEGNQ"
     misc_feature    complement(296522..296758)
                     /locus_tag="CNE_2c02720"
                     /note="Protein of unknown function (DUF1427); Region:
                     DUF1427; pfam07235"
                     /db_xref="CDD:254117"
     gene            complement(296799..298412)
                     /locus_tag="CNE_2c02730"
                     /db_xref="GeneID:10920762"
     CDS             complement(296799..298412)
                     /locus_tag="CNE_2c02730"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004680491.1"
                     /db_xref="GI:339321597"
                     /db_xref="GeneID:10920762"
                     /translation="MTQSAISAAKPASGGTFAPLAQPTFAVLWVATILGNIGSFMRDV
                     ASAWLATDLSTSPAAVATIQAAATLPVFLLAIPAGVLSDILDRRRFLIVIQIGLAMVS
                     GTLMLLAWRQALTIEVLIALAFVGGVGAAMMGPTWQSIVPELVPPSTLRQAVALNSLG
                     VNVARAIGPATGGLLLAAFGAAATYSADLLSYVFVIAALIWWKRPEKPSDPLREHFFS
                     AFRAGLRFTRAHSKLHVVLARAAVHFAFGSGVWALLPLVARQLLHGGAGLYGVLLGAV
                     GAGAILGALTMSRLQQRLDADGMVLLSAIVTAVVMAALSSAPPIWLALPLLLLLGAAW
                     IMALTTLGGAAQAILPNWVRGRALAVYQMVFNGALAGGSLVWGFVAQALGTPHALLIA
                     AAGLVVTALILHRMRLPGGDEDLGPARHWPEPEMAGEIAQDRGPVMILIEYCIPPANR
                     DAFLHAVHKLSEERLRDGAFSWGVMEDPANPELLTEWFLVESWAEHLRQHQRVPHADA
                     DVQRDVASFHVGAEPPHVRHLLGLGLPPA"
     misc_feature    complement(296823..298370)
                     /locus_tag="CNE_2c02730"
                     /note="Transmembrane secretion effector; Region: MFS_3;
                     pfam05977"
                     /db_xref="CDD:253487"
     misc_feature    complement(297192..298340)
                     /locus_tag="CNE_2c02730"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(297306..297308,297315..297320,
                     297327..297332,297339..297344,297375..297377,
                     297384..297389,297399..297401,297408..297413,
                     297420..297422,297561..297563,297573..297575,
                     297582..297584,297594..297596,297606..297608,
                     297648..297650,297657..297662,297669..297671,
                     297675..297677,297684..297686,297918..297920,
                     297936..297941,297948..297953,297987..297989,
                     297996..298001,298008..298013,298020..298025,
                     298176..298181,298185..298190,298200..298202,
                     298209..298214,298221..298223,298272..298277,
                     298281..298289,298296..298298))
                     /locus_tag="CNE_2c02730"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(298409..298843)
                     /locus_tag="CNE_2c02740"
                     /db_xref="GeneID:10920763"
     CDS             complement(298409..298843)
                     /locus_tag="CNE_2c02740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680492.1"
                     /db_xref="GI:339321598"
                     /db_xref="GeneID:10920763"
                     /translation="MTISTPPLATAGNNTHRLPRWLRWIALLLLCAAYLQGGLVKLFD
                     FSSAVTEMQHFGLSPAVPLAAATIALELGASAMILTGFWRWLGALALAAFTLMATFLA
                     NRFWSAPPEAQFMMANAFFEHLGLVGGFLLVAWDDLRTRRQP"
     misc_feature    complement(298439..>298732)
                     /locus_tag="CNE_2c02740"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(298872..300818)
                     /gene="ytcJ1"
                     /locus_tag="CNE_2c02750"
                     /db_xref="GeneID:10920764"
     CDS             complement(298872..300818)
                     /gene="ytcJ1"
                     /locus_tag="CNE_2c02750"
                     /EC_number="3.5.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004680493.1"
                     /db_xref="GI:339321599"
                     /db_xref="GeneID:10920764"
                     /translation="MSITRRHFIASAAALGAAASSELFAMSPNPTPDLILVNGKFATL
                     DRANPQADAVAIQDGRFVGVGTRQDIMKLAGTQTRVIDLNGRRAIPGLIDSHMHIIRG
                     GLNYNMELRWDGVRSLADAMRMLKDQVARTPAPQWVRVVGGFTEHQFAEKRLPTIDEL
                     NAVAPDTPVFILHLYDRAILNGAALRAVGYTKDTPNPPGGEIVRDARGNPTGLLLAKP
                     NATILYATLAKGPKLPPEYQKNSTRHFMREVNRLGVTGVIDAGGGYQNYPEDYSIIEE
                     LHKEGHLTVRLAYNLFTQKPKEELSDFKTWTSTVKPGQGDDLYRHNGAGEMLVYTAAD
                     FEDFRVERPDMAPSMEADLEPVIRLLAEKRWPWRLHATYDQTITRALDVYEKVAKDIP
                     FNGLNWFFDHAETISDRNIDRIAALGGGIAVQHRMAYQGEYFVERYGARAAEATPPVK
                     KMLERGVKVGAGTDATRVASYNPWVSLYWLTTGKTVGGMSMYPQANLLDRETALRLWT
                     EANTWFSSEVGKKGQIKVGQLADLAVLSADYYSVPGDDIQDITSVLTVLGGKVVYGDS
                     EFGKHSPDIPPAMPDWSPARHGSQYQPRPQAQARALALNTACGCASSCGVHGHAHANA
                     WTSSVPTSDESTFWGALGCSCWAF"
     misc_feature    complement(299127..300731)
                     /gene="ytcJ1"
                     /locus_tag="CNE_2c02750"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    complement(299217..300662)
                     /gene="ytcJ1"
                     /locus_tag="CNE_2c02750"
                     /note="YtcJ_like metal dependent amidohydrolases. YtcJ is
                     a Bacillus subtilis ORF of unknown function. The
                     Arabidopsis homolog LAF3 has been identified as a factor
                     required for photochrome A signalling; Region: YtcJ_like;
                     cd01300"
                     /db_xref="CDD:238625"
     misc_feature    complement(order(299427..299429,299613..299615,
                     299709..299711,300525..300527,300531..300533))
                     /gene="ytcJ1"
                     /locus_tag="CNE_2c02750"
                     /note="active site"
                     /db_xref="CDD:238625"
     gene            complement(300825..301814)
                     /gene="thcF"
                     /locus_tag="CNE_2c02760"
                     /db_xref="GeneID:10920765"
     CDS             complement(300825..301814)
                     /gene="thcF"
                     /locus_tag="CNE_2c02760"
                     /EC_number="1.11.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-heme haloperoxidase ThcF"
                     /protein_id="YP_004680494.1"
                     /db_xref="GI:339321600"
                     /db_xref="GeneID:10920765"
                     /translation="MQIEHTQEQGHNIDASRRQLLVGSTVGAAAASVASLAALTPTAA
                     EAAPASSRATNQGHYVTTKDGTRIFYKDWGTGSPVVFSHGWPLNADAWDAQMLFLVQK
                     GFRVIAHDRRGHGRSDQPAQGNNMDTYADDLAALLDALDIKGATLVGHSTGGGEVAHY
                     IGRHGTKRVAKAVLIGAVPPIMLKTAANPNGLPMEVFDGIRKGVAENRSQFYKDLTTP
                     FFGFNRPGAKVSQGTIDAFWAQGMTGGLLGQYACIKEFSEVDYTGDLKKITVPTLILH
                     GDDDQIVPIDNSARLSAKIVKNATLKVYPGASHGMCVINADQVNADLLAFLNA"
     misc_feature    complement(300828..301646)
                     /gene="thcF"
                     /locus_tag="CNE_2c02760"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<301461..301622)
                     /gene="thcF"
                     /locus_tag="CNE_2c02760"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(300834..>301019)
                     /gene="thcF"
                     /locus_tag="CNE_2c02760"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(301931..302617)
                     /locus_tag="CNE_2c02770"
                     /db_xref="GeneID:10920766"
     CDS             complement(301931..302617)
                     /locus_tag="CNE_2c02770"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004680495.1"
                     /db_xref="GI:339321601"
                     /db_xref="GeneID:10920766"
                     /translation="MSNPKLEVLTPQNSQLIFIDHQPQMAFGVQSMDRQAMKNNVVGL
                     AKAAKIFNIPTTITTVESESFSGFTYPELLDVFPDQKTLERTSMNSWDDQKVRDALKA
                     NGRNKVIVAGLWTEVCNTTFALCAMLEGNYEIYMVADASGGTSKEAHDYAMQRMVQAG
                     AVPVTWQQVLLEWQRDWAHRDTYDAVMKLVKEHSGAYGMGVDYAYTMVHKAAQRTATG
                     HESIAPVPAR"
     misc_feature    complement(302093..302572)
                     /locus_tag="CNE_2c02770"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(302264..302266,302363..302365,
                     302558..302560))
                     /locus_tag="CNE_2c02770"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(302402..302404,302540..302542,
                     302549..302551))
                     /locus_tag="CNE_2c02770"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(302276..302281)
                     /locus_tag="CNE_2c02770"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            302657..302965
                     /locus_tag="CNE_2c02780"
                     /db_xref="GeneID:10920767"
     CDS             302657..302965
                     /locus_tag="CNE_2c02780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680496.1"
                     /db_xref="GI:339321602"
                     /db_xref="GeneID:10920767"
                     /translation="MASPPGQSRVGAAWHKGRDRRLCPERNLRGRIVHAVGRRYCRFV
                     LAVRCLGFIAKPPGCATENREWLRQPLRRRKALGLRAGSMCVSLQTGRPGQPPTVTLN
                     "
     gene            303094..303756
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /db_xref="GeneID:10920768"
     CDS             303094..303756
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodW"
                     /protein_id="YP_004680497.1"
                     /db_xref="GI:339321603"
                     /db_xref="GeneID:10920768"
                     /translation="MTINSFVTADTSGASDEAMVLIVDDDAMLRGALENLFRSVGMRV
                     ALFASAAELLAFAFPDAPTCLLLDVRLRGQSGLDLQTRLSQMGIQVPIIFMTGYGDIP
                     MTVAAMKAGAEDFLAKPFREQDLLDAVAAALQKDQHRRHGMRKLDELRASYQSLTPRE
                     AEVMRMVVAGLLNKQIASELSISEVTVKIHRGQAMRKMKARTFAELVLMAQQLGICEA
                     PH"
     misc_feature    303133..303735
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="Response regulator [Signal transduction
                     mechanisms]; Region: TtrR; COG4566"
                     /db_xref="CDD:226932"
     misc_feature    303154..303492
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(303163..303168,303295..303297,303319..303321,
                     303379..303381,303436..303438,303445..303450)
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    303295..303297
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(303304..303309,303313..303321)
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    303445..303453
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    303559..303729
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(303562..303570,303607..303615,303637..303642,
                     303646..303651,303655..303669,303700..303702)
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(303595..303597,303601..303603,303607..303609,
                     303700..303708,303715..303717,303724..303729)
                     /gene="nodW2"
                     /locus_tag="CNE_2c02790"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(303778..309285)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /db_xref="GeneID:10920769"
     CDS             complement(303778..309285)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodV"
                     /protein_id="YP_004680498.1"
                     /db_xref="GI:339321604"
                     /db_xref="GeneID:10920769"
                     /translation="MNSLFSFGTETGVGFQVAWEDGDRVVGRGWLLGPEGEPKAVLAV
                     WPAAEHPPPSTLARLAHEYGLKGELDGSWAVRPLALVGEHGRTVLLLEDPGGEPLAGL
                     LGAPMEGGRFLRQAISIAAALDQLHQRGLIHKDLKPAHILVNDALGEARLTGFGIATR
                     LSRERQGLAPPEEIAGTLAYMAPEQTGRMNRPIDARSDLYSLGVTLYQMLTGVLPFAT
                     DDPMDLLHSHLARQPVPPAERIPSIPALLSAIVMKLLAKTAEERYQTAAGLEADLRRS
                     LTAWESLGRVDTFPLGEHDLPDRPLIPERLYGREREIETLLAAFDRVVTQGTPEIVLV
                     SGYAGIGKTSVVFALRSALALRNGLFASGKFDQYKRDIPYATLAQAFQNLIRPLLGKS
                     EADLAPWRATLAQALGPNGGLMVPLIPELGLILGPQAPVPELPPRDEQHRFQMVFQRL
                     LAVFAQPAHPLALFLDDLQWLDAATLDLLEYLATQPEVRHVLLIGAYRNDDVKPGHPL
                     LLRLSAIRQAGGRVNDIALSPLGFEDVSRLIVDALHCAPGDAAPLARLVQEKTGGNPF
                     FAIQFLTALTEEGLLVFDHRGARWSWDLEQIRSKGFTDNVVDLMLAKLRRLPAATRSA
                     LKQLACLGNDAAIATLAMVQDASEAVLDAALWPAVRAGLVLHLGNTYRFQHDRIQEAA
                     YALIPEDARPAAHLAIGRRLAAGTPPEAIAERVFEIVGQLNRGADLITAAEEREQVAE
                     LNLLAGQRAKASTAYASALTYLTAGEALMQGDAWKRRPKFAFALEFHLAECEFLTGAP
                     AAADARLAELACRAASLPDLASVTQLRLELFLALGQRERAVEVGLDYLYRAGVQCSAH
                     PTDEEVLQEYDRMWRQLGDRPIEALLDLPMMTNAVACETMDVLTALMLPAWYTDVNLG
                     SLIIGRMANLSLEHGNSDASCLAYTWLGMLLGPRSGDYKAAFRFGQLGLNLVEQRGLD
                     RFRARVYQAFGGHVMQWTQPIRAARSLVRRAFDVASKLGDLTYASFARNNLITQLLAC
                     GDPLAEVQNEAEATIGFARRASFGLAVDRVTPQLQLARTLRGLTPVFGVFDDDDFNEE
                     QFERYLDEAPGPALATCWYWIRKLQARFLADDHAAAITAADRAESLLWTSPSFFEQAE
                     YHLYAALARAACCGTAAAPERTRHLEALAAHHRQLLVWSEHCPENFENRAALVGAEIA
                     RLDGREVDAMRLYEQAIRSAQDNDFIHNQALANELAARFYAARGFEKVARVYLQDARH
                     GYLRWGAGGKVRQLDALYPHLWGEERAPAPTTTIGAPVEHLDLATVIAVSQAVSGEIV
                     LDKLLDTLMRTAIEQAGAVRGLLILPRGAEQRIAAEATTSGDIVTVQLRDESVTATAL
                     PVSMLHYVLRTRENIILDNAATQNPFSADPYILQHHARSILCLPLLTQAKLIGVLYLE
                     NNLSPRVFAPSRTAVLKMLASQAAIALEITCLYRDLAQREAKIQRLVEANIIGICIWH
                     LDGRILEANDAFLRMLGYDREDLASAPLRWTDLTPPDWRERDARLLQDLRISGTLPPF
                     EKEFFRKDGSRVLVLLGCATFEEGGDQGVSYILDLTERKRAEEALHQAQAELAHVTRV
                     TTLNALTASIAHEVNQPLAAIVTNANAALRWLARQPPDLAEVRETLGRIVQDGHRAGA
                     VIGGMRALLKKTAAVTARLDMNTLIEDTIALIQGEVGRHQVLPRTELAPDLPPVVGDR
                     VQLQQVLLNLMMNSIEAMKEVAERPRELLIRSRLDASGAVLVAVQDAGIGLEPQDLER
                     VFQTFFTTKAEGLGMGLAICRLIVEAHGGRLWASPNVPCGAVFQFTLPPQD"
     misc_feature    complement(308200..309144)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Serine/threonine protein kinase [General function
                     prediction only / Signal transduction mechanisms /
                     Transcription / DNA replication, recombination, and
                     repair]; Region: SPS1; COG0515"
                     /db_xref="CDD:223589"
     misc_feature    complement(308659..>308955)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(308749..308760,308815..308817,
                     308869..308871,308875..308877,308881..308883))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(308749..308760,308809..308829))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(308434..>308793)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    complement(307804..308373)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(305995..308370)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG3899"
                     /db_xref="CDD:226415"
     misc_feature    complement(304858..305376)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(304495..304863)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(304531..304821)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(304603..304605,304618..304620,
                     304696..304707,304750..304752,304768..304770,
                     304780..304782))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(304576..304578,304582..304584,
                     304666..304671,304678..304680,304702..304704,
                     304714..304716))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(304252..304452)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(304267..304269,304279..304281,
                     304288..304290,304300..304302,304309..304311,
                     304321..304323,304372..304374,304393..304395,
                     304405..304407,304414..304416,304426..304428,
                     304438..304440))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(304420..304422)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(303793..304101)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(303805..303807,303811..303816,
                     303829..303831,303835..303837,303883..303894,
                     303955..303960,303964..303966,303970..303972,
                     303976..303978,304060..304062,304069..304071,
                     304081..304083))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(304069..304071)
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(303886..303888,303892..303894,
                     303958..303960,303964..303966))
                     /gene="nodV1"
                     /locus_tag="CNE_2c02800"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(309754..310866)
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /db_xref="GeneID:10920770"
     CDS             complement(309754..310866)
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase NemA"
                     /protein_id="YP_004680499.1"
                     /db_xref="GI:339321605"
                     /db_xref="GeneID:10920770"
                     /translation="MTKHLMTPVHIGNHTLSHRVAMAPLTRSRAGQPGNVPTAMNVEY
                     YRQRASAALIVTEATQISQQGQGYAWTPGIHSGEQVQGWRAISDAVHEGGGTIFLQLW
                     HVGRVSHPVFQPDGALPVAPSALPVPGKTFILDESGNGVWGDVPVPQPLTTSGIRDIV
                     EDYRRSARNAIRAGMDGVEIHAGNGYLLDQFINSNSNARTDAYGGSIENRSRLLLEVV
                     DAVIAEIGASRVAVRLTPMGRFMGMGDDTPEATFGHIVRALSERRMAYLHLVEPAMVG
                     TDKDDDTDPRWDAIIRQLRTEYRGVLMLAGGYDRDSAEQALADGRADIIAFGRPFIAN
                     PDLPARFRNGLPLNTPDTASFFGGGASGYIDYPSAT"
     misc_feature    complement(309814..310857)
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    complement(order(309877..309885,309889..309891,
                     309949..309951,310168..310170,310567..310569,
                     310693..310695,310789..310791,310795..310797))
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    complement(order(309880..309885,309889..309891,
                     309949..309951,310147..310149,310168..310170,
                     310309..310311,310315..310317,310324..310326,
                     310540..310542,310561..310563,310567..310569,
                     310693..310695,310789..310791,310795..310797))
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    complement(order(309880..309882,310309..310311,
                     310315..310317,310324..310326,310561..310563,
                     310789..310791))
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    complement(310309..310311)
                     /gene="nemA1"
                     /locus_tag="CNE_2c02810"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
     gene            complement(311156..312079)
                     /locus_tag="CNE_2c02820"
                     /db_xref="GeneID:10920771"
     CDS             complement(311156..312079)
                     /locus_tag="CNE_2c02820"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680500.1"
                     /db_xref="GI:339321606"
                     /db_xref="GeneID:10920771"
                     /translation="MDKLLALRVFVETVDAKGFSSAARRLSLATSSVTRMMDSLEEDL
                     GAVLLNRSTRQVTVSAAGAAYYQRARKILDAVAEADAQIADRGDTPVGQLRVSLPVAF
                     GRRCIAPFLGGLLARYPKLELEVTLTDEIVDLLSERIDLSIRLGSAASLDDVVARQIG
                     TFRRKVVASPAYLLRHSLPAAPLDLAGHECLRFSYGVGQQVWTFVRDGEEVQVPVRGN
                     FRSNNSEVLRELVMSETGIALLPDWLVAEDIQRGNLTSLFDDWSVNPNRATSAISALF
                     LPNQRGSRRIGAFLDFLGEIPGPTYRGDTAR"
     misc_feature    complement(311195..312070)
                     /locus_tag="CNE_2c02820"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(311894..312064)
                     /locus_tag="CNE_2c02820"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(311201..311806)
                     /locus_tag="CNE_2c02820"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(311264..311266,311357..311359,
                     311408..311410,311594..311596,311600..311602,
                     311645..311647,311762..311764,311774..311776))
                     /locus_tag="CNE_2c02820"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(311381..311383,311390..311395,
                     311414..311428,311513..311515,311699..311719,
                     311723..311725,311735..311737,311744..311749,
                     311753..311758,311768..311773))
                     /locus_tag="CNE_2c02820"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(312081..312746)
                     /locus_tag="CNE_2c02830"
                     /db_xref="GeneID:10920772"
     CDS             complement(312081..312746)
                     /locus_tag="CNE_2c02830"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004680501.1"
                     /db_xref="GI:339321607"
                     /db_xref="GeneID:10920772"
                     /translation="MERGATTAKHGIPAKPGKRLLPEEREQQIVQKAIEHFTRNGFSG
                     STRELAKQIGVTQPLLYRYFESKDALIERVYNEVFQWRPDWERQIADRSTPLAQRLYA
                     FYLDYASVILREEWIRIFIFAGLTREGINNKYLSKLRSKVFLPVLAEVRAEYGIPEPR
                     SAAELDAEVEMIWSLHAAIFYLGVRKWVYGLKVPADLGGVVRQKVDMFLQGAPAVMRS
                     LRL"
     misc_feature    complement(312087..312683)
                     /locus_tag="CNE_2c02830"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(312525..312662)
                     /locus_tag="CNE_2c02830"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(312912..314543)
                     /gene="actP1"
                     /locus_tag="CNE_2c02840"
                     /db_xref="GeneID:10920773"
     CDS             complement(312912..314543)
                     /gene="actP1"
                     /locus_tag="CNE_2c02840"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="YP_004680502.1"
                     /db_xref="GI:339321608"
                     /db_xref="GeneID:10920773"
                     /translation="MKRLSLFIALFSATLPAIAATPTVGQGLNVIAIVMFLVFVASTL
                     LITRWAARNTHSVADHYAAGGKITAMQNGWAIAGDYMSAASLLGISALVFTSGYDGLI
                     YSIGFLASWPIILFLIAEPLRNLGRFTLADVVSYRLQQRPIRAFSASSSIVIVLLYLV
                     SQMVGAGKLVELLFGFNYTAAVVLVGVLMVIYVFFGGMLATTWIQIIKAVLLLAGAGF
                     MAFMVLGRFGFSLNTLFAEAIAAHGKHTAIMSPGGLVSDPVSAVSLGLALIFGTAGLP
                     HILMRFFTVADVKAARKSILYATGIVGSGYALIIIIGFGTIALVANDPLYHNASGAVI
                     GGVNMVAVHLAHAVGGNVFLGFICAVAFSTILAVVAGLTLAGSSAISHDLYAKVLRQG
                     TATDKDEMRVSRMTTLVLGVLSILLGILFEKQTIAFIVSLTFSIAASSNFPVLLLSIY
                     WRGLTTRGAVVGGSLGLLTAVLLTVLSPTVWVQVLGHAKAIYPYEYPALFSMLVAFAG
                     IYVFSVTDKSARGARERGAFRNQLVDCELGLIKRQ"
     misc_feature    complement(313002..314447)
                     /gene="actP1"
                     /locus_tag="CNE_2c02840"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u4; cd11480"
                     /db_xref="CDD:212050"
     misc_feature    complement(order(313440..313445,313452..313454,
                     314301..314303,314310..314312))
                     /gene="actP1"
                     /locus_tag="CNE_2c02840"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212050"
     gene            complement(314540..314902)
                     /locus_tag="CNE_2c02850"
                     /db_xref="GeneID:10920774"
     CDS             complement(314540..314902)
                     /locus_tag="CNE_2c02850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680503.1"
                     /db_xref="GI:339321609"
                     /db_xref="GeneID:10920774"
                     /translation="MEHLAATYPPSGDEATSTPLPPPNPVLSNPAFQALVRARRSFAY
                     TLTTLMLAVYFGYILTLAFNPALLGRPLTPGQPMSIGIPIGFGMFAITFFLVALYVHR
                     ANTVHDAMIHAIREGAAK"
     misc_feature    complement(314552..314827)
                     /locus_tag="CNE_2c02850"
                     /note="Protein of unknown function, DUF485; Region:
                     DUF485; pfam04341"
                     /db_xref="CDD:202977"
     gene            complement(315000..316223)
                     /locus_tag="CNE_2c02860"
                     /db_xref="GeneID:10920775"
     CDS             complement(315000..316223)
                     /locus_tag="CNE_2c02860"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase FAD-binding protein"
                     /protein_id="YP_004680504.1"
                     /db_xref="GI:339321610"
                     /db_xref="GeneID:10920775"
                     /translation="MTVFSRQPKAIVVGGSLGGLFAANLLSRDGWDVEVFERVPEALA
                     GRGAGIVTHPELFEALAAAGVQVDDSIGVRVQSRLTLSQDGSVLSQREMPQMLTAWGK
                     MYQVLRAAFHLGCYRPGGSVVSVESEPGRAVVTLDDGSTHSADLVIAADGFRSALRER
                     LLPDVQLQYAGYIAWRGLVDEMALSESTRDALFEKFGFCLPPHEQILGYPVAGQDNST
                     QPGERRYNFVWYRATSEDIDLPNLLTDASGKRWSGGIPPTLIRPDVLADMEEAALTLL
                     APQFGEVVTKAAQPLFQPIFDLEVPRMAFDRVALLGDAAFVARPHCGMGVTKAAGDAM
                     ALVKALRAHDTVPAALEGYSAERVQVGAAIVQHARHLGAYMQAQLKDETDRQMAERYR
                     TPEAVMRETAVSTRF"
     misc_feature    complement(315069..316220)
                     /locus_tag="CNE_2c02860"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07236"
                     /db_xref="CDD:235980"
     misc_feature    complement(315033..316193)
                     /locus_tag="CNE_2c02860"
                     /note="putative monooxygenase; Reviewed; Region: PRK07045"
                     /db_xref="CDD:136171"
     gene            complement(316226..316714)
                     /locus_tag="CNE_2c02870"
                     /db_xref="GeneID:10920776"
     CDS             complement(316226..316714)
                     /locus_tag="CNE_2c02870"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004680505.1"
                     /db_xref="GI:339321611"
                     /db_xref="GeneID:10920776"
                     /translation="MAIMKLAHYSIRTTDLDRSCAFYQRILGFRQGYRPPFDFPGAWL
                     YLGDDESEFGVVHIIGVDPDNLFGLSAYLGDRLLPVSGTGTVDHIAFLATGVQEMWAK
                     LKAEGVAWRDRTVPSLGLHQVFIEDPSGVTIELNYPAAEVAGLDIPGGSATAHSMAVT
                     GE"
     misc_feature    complement(316310..316699)
                     /locus_tag="CNE_2c02870"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_9; cd07245"
                     /db_xref="CDD:176669"
     misc_feature    complement(order(316310..316315,316409..316411,
                     316418..316423,316433..316456,316550..316552,
                     316574..316579,316586..316588,316628..316630,
                     316634..316639,316679..316681,316685..316699))
                     /locus_tag="CNE_2c02870"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176669"
     misc_feature    complement(order(316313..316315,316451..316453,
                     316691..316693))
                     /locus_tag="CNE_2c02870"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176669"
     gene            317121..318236
                     /locus_tag="CNE_2c02880"
                     /db_xref="GeneID:10920777"
     CDS             317121..318236
                     /locus_tag="CNE_2c02880"
                     /EC_number="4.1.1.45"
                     /codon_start=1
                     /transl_table=11
                     /product="aminocarboxymuconate-semialdehyde decarboxylase"
                     /protein_id="YP_004680506.1"
                     /db_xref="GI:339321612"
                     /db_xref="GeneID:10920777"
                     /translation="MDCPCCVSPKRRRLLGSVSAIAAGMMAGLPALAAQPSTAAAGTG
                     KPLSIDIHAHYYSESFLGLLGGEGKQFGGHFFRNDDSFTFQTPAGGLGPLPMKFIDVE
                     QRVRDMDNSGVDVQAISLSVPMVYWADRTLNAKLARAWNTAASDVHRKHPTRFVVLAT
                     LPMLNANDAIDELEFAAGLPGVRGIYMGTNINNRDLDDPLFSPIFKRIEQLNLPIFLH
                     PQQTVGGARLADFYLSNLLGNPFDTAIAASHLILGGVLDKYPALHFSLPHAGGALPIL
                     VGRIDAGWSMRSETKRVAQKPSSYLRRFSYDTISHSGPTLDFLIRNIGADRLVLGSDY
                     CFDMGYEQPVRFLDRLALPDDQKRMVVGGNAARLLNL"
     misc_feature    317400..318233
                     /locus_tag="CNE_2c02880"
                     /note="Amidohydrolase; Region: Amidohydro_2; pfam04909"
                     /db_xref="CDD:252869"
     gene            complement(318335..319447)
                     /locus_tag="CNE_2c02890"
                     /db_xref="GeneID:10920778"
     CDS             complement(318335..319447)
                     /locus_tag="CNE_2c02890"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004680507.1"
                     /db_xref="GI:339321613"
                     /db_xref="GeneID:10920778"
                     /translation="MPRDHLIGDLYEAAVREDGFLEVFQTVAESLGANVFHMFSWDAL
                     RNAPRLSIYTPDRDWDAIVESYDQYYGALDPRRSFVEAAALGEFVCCQDRLTEQDVAR
                     SEFFQDYQLPSGLRYLQGVRLARAGSDDILLGLLRAKDRPPYTLEERAAAAGLVGHLQ
                     RSINLWQDARTLHRDAALGNELMEQLGLAVFTLDRRFRLVFANQAAEAMLRASACLKL
                     EHERLAATTAAENDGLQAAMARVGKTRKGESLALRAASGATPEIFLNIARVPGRDTRA
                     AFGDATLLVTARRRGTAPLVTARQLQGAFRLSAAEAAVAEALICGKTPDEYAASARVS
                     LATVRTQLRAIFDKTNTRSQAEAVGAMLWVLSQAGG"
     misc_feature    complement(318374..>318487)
                     /locus_tag="CNE_2c02890"
                     /note="DNA-binding HTH domain-containing proteins
                     [Transcription]; Region: CsgD; COG2771"
                     /db_xref="CDD:225360"
     gene            319715..321313
                     /locus_tag="CNE_2c02900"
                     /db_xref="GeneID:10920779"
     CDS             319715..321313
                     /locus_tag="CNE_2c02900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680508.1"
                     /db_xref="GI:339321614"
                     /db_xref="GeneID:10920779"
                     /translation="MKIRLLISAIAAAALTACGGGSSDTQSSAPSTPSTPGTPATTIA
                     GTAAVGSALPNATVQAKCANGSGTATTAADGTFTISIPDATRPCVLSVTTPDGTILHS
                     VVEAGTGTTAAANITPLTELITASIAGGSTQDFFNSFDAQAQAKLTTDGVATAVESVK
                     LILSGTVDLAGVDPLKGTLVAAHGDTPGNALDQKLDTLGAALESSQTSLSQLSAAVAS
                     NSGSAAGVQTILQPASATCATFRSGKYQKVGLTANSVQRFTIDAVKLTQTNDTTGAVE
                     QFQANDTQACRFGNTDARLLVSKSGIGLERRNGPSSLVIPDQTIPLSEITGDWIAMGF
                     ERPEGGGTLAPGLIKFTVDSTGKFASGADCGLSGCSPWPAEDLPVVSVNADGGFNVTD
                     STGTARAFAFKGVDGGVAVVIVHKGGFMIAKRPTPRGLPAVGAVNAYWDAVININGGT
                     EISEYSNTVTSVDTAANTYTRQRNDGRVDLWHNNMPSDGLRYRPAAPNAAEVIGMNVA
                     NTGLTVAISVNPANSFYDISVDRP"
     misc_feature    319844..>319963
                     /locus_tag="CNE_2c02900"
                     /note="Pollen proteins Ole e I like; Region:
                     Pollen_Ole_e_I; pfam01190"
                     /db_xref="CDD:250430"
     gene            complement(321461..321955)
                     /locus_tag="CNE_2c02910"
                     /db_xref="GeneID:10920780"
     CDS             complement(321461..321955)
                     /locus_tag="CNE_2c02910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680509.1"
                     /db_xref="GI:339321615"
                     /db_xref="GeneID:10920780"
                     /translation="MSWTNRGAAAWEQVLGRSREAHAVVIDDMPVYRHGVMRLLGEMP
                     GIGRVELVETDALAARNARLPAPPLLVFGMPPDLADGWHLLRLASLVLKPRRLLLVSD
                     NMWLRLPPGLDGRFARSLSRSASLATVERDVRALLELPSAAEAPPGQDAGSVAFQRPF
                     HVLA"
     gene            322321..322728
                     /gene="glmU"
                     /locus_tag="CNE_2c02920"
                     /db_xref="GeneID:10920781"
     CDS             322321..322728
                     /gene="glmU"
                     /locus_tag="CNE_2c02920"
                     /EC_number="2.3.1.157"
                     /EC_number="2.7.7.23"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein GlmU"
                     /protein_id="YP_004680510.1"
                     /db_xref="GI:339321616"
                     /db_xref="GeneID:10920781"
                     /translation="MQAHPLRLSPGDDLRAALEDVLSQLKLHAAFVIQGIGSLSVAQL
                     RFAGAEGPTELRGNLEVLTLAGSLSSDGAHLHMSVADSRGRVFGGHVARGCTVRTTAE
                     ILLALLPEHRFAREYDQNSGFMELVVRTEQPME"
     misc_feature    322330..322644
                     /gene="glmU"
                     /locus_tag="CNE_2c02920"
                     /note="Domain of unknown function found in archaea,
                     bacteria, and plants; Region: DUF296; cd11378"
                     /db_xref="CDD:211390"
     misc_feature    order(322333..322335,322339..322341,322348..322350,
                     322426..322431,322477..322479,322498..322509,
                     322513..322515,322519..322521,322540..322542,
                     322546..322548,322552..322554,322561..322563,
                     322570..322572,322576..322584,322624..322626,
                     322630..322632,322636..322638,322642..322644)
                     /gene="glmU"
                     /locus_tag="CNE_2c02920"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:211390"
     misc_feature    order(322540..322542,322546..322548,322588..322590)
                     /gene="glmU"
                     /locus_tag="CNE_2c02920"
                     /note="putative Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211390"
     gene            complement(322839..323501)
                     /locus_tag="CNE_2c02930"
                     /db_xref="GeneID:10920782"
     CDS             complement(322839..323501)
                     /locus_tag="CNE_2c02930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680511.1"
                     /db_xref="GI:339321617"
                     /db_xref="GeneID:10920782"
                     /translation="MGSGDLVTTADIAPLTSRCAGQLASERRTINITLHSPLTASRVA
                     VRQQLRDSHAPIRCLSSRRQPDERPDARTQALLEAAGFSEVKTLLSSGNVVFDARSWS
                     LASLERRAEKAIQSELGHSFDTFVRPARYLQDLIDSDPFAELSLAPSAKRIGTFLRSP
                     VPPDVKLPIERDGASIVKARATEVFSAYVPDPKKGPVFMRLLERSFGKDITTRTLYTV
                     IK"
     misc_feature    complement(322947..323279)
                     /locus_tag="CNE_2c02930"
                     /note="Protein of unknown function (DUF1697); Region:
                     DUF1697; cl01557"
                     /db_xref="CDD:260997"
     gene            323830..324480
                     /locus_tag="CNE_2c02940"
                     /db_xref="GeneID:10920783"
     CDS             323830..324480
                     /locus_tag="CNE_2c02940"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family two component transcriptional
                     regulator"
                     /protein_id="YP_004680512.1"
                     /db_xref="GI:339321618"
                     /db_xref="GeneID:10920783"
                     /translation="MPPRTISAVIADDHPVIQLAVKTTLSEIPNVQVSAMCASGRELF
                     AALEAHRPDLIVTDFTMGRSEESDDGLRLIRRLKQSSPDTPIVVFTMLTNGGLLTRIQ
                     ETGIAGIVGKNEDPGILRQICIDAISGQGLRLSPGVSARMSSAGALAGASASALSPKE
                     IEVVRMFAAGSTVTAIAGYLHRTLATVATQKRSAMRKLNITSNADLVAYARDNGLT"
     misc_feature    323845..324474
                     /locus_tag="CNE_2c02940"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    323857..324192
                     /locus_tag="CNE_2c02940"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(323863..323868,324001..324003,324037..324039,
                     324097..324099,324154..324156,324163..324168)
                     /locus_tag="CNE_2c02940"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    324001..324003
                     /locus_tag="CNE_2c02940"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(324010..324015,324019..324021,324034..324039)
                     /locus_tag="CNE_2c02940"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    324163..324171
                     /locus_tag="CNE_2c02940"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    324301..324465
                     /locus_tag="CNE_2c02940"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(324301..324306,324343..324351,324373..324378,
                     324382..324387,324391..324405,324436..324438)
                     /locus_tag="CNE_2c02940"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(324331..324333,324337..324339,324343..324345,
                     324436..324444,324451..324453,324460..324465)
                     /locus_tag="CNE_2c02940"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            324477..327398
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /db_xref="GeneID:10920784"
     CDS             324477..327398
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein RcsC"
                     /protein_id="YP_004680513.1"
                     /db_xref="GI:339321619"
                     /db_xref="GeneID:10920784"
                     /translation="MMQGTFEPSPDLRAVERNLQRERRVFSLVIVLLGLLAVAIASTG
                     VFVQLNGSLRAQEQVARLYEQGVVDAVLERRSTLAASNLILELRANGTLALSPGSQGG
                     LCTQVFPSAPADDVLQQSCDQSVGTLIAASQRPSIEMISIASGATYRYESPDASGSAA
                     RSIPPPMPPALITRTILDRFRSRDIDVLQAAREKRVEWLGVPASAAGTDPEMVGASLV
                     AKGDTLYAVVLTRIPLHELLRPAGPNLSIPEPIVFDSLGTPLVAAGARANAQHLNARL
                     EARPDGLFHWVPDYGWAVRRPPLVADFGHLIFALPIGHQIRGMTEELIVIGAITAVLI
                     ALLFAMYRYWNYRFLTGTYAEAARAQRLLHEARLATEAAARARVAFFASMSHEIRTPL
                     ASLLGNMELVAMGPLGPEQRMRVGAMQVSAEGLLQIVNDVLDFSKIDVGALSIEVQPV
                     SVTELLGRIAIAHAPLAAQRGLSFLAVYSSRIPSQLDLDPVRLTQIVNNLLGNAFKFT
                     QAGKIVLRAQWLEGNLEIVIADTGIGIPDEYRDRLFQPFSQVADNRIAQARGTGLGLS
                     ICMRLVERMGGRIMLDSTLGVGTRVTVRLPLGVSDAVPPPVRPGLPPNRTLVLSREPE
                     CIEGLLNHFDWGACQPSARSNLDEPVDADSYDCLLVTEAFDPGHVMAWWPKPASVVWL
                     KQLGPLVATTRPDGGREVSSYSLAGIHAAALAVITGAQPPKRSEEGLVGRPTSPLVGH
                     AVLIAEDNLLNRNLLRDQLRALGARVIVAGNGIEAMAALRGNRMNAVLTDIDMPVMNG
                     FDLLREMRHAGIDIPVYAVSASARPEDVAEGRARGFTGYLTKPVSLAALASVLARGDD
                     GVGHEDVEQTTASPGDDALPELPRIPAGYVEAFLAQTGADLDKYDAIRAGRDMTGLAQ
                     LLHRIAGGLAVVGPSELAELCEDLRDYAADADGWDDEIELQSAYIAQSLRQLCQCLSA
                     G"
     misc_feature    325623..325787
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(325626..325628,325638..325640,325647..325649,
                     325659..325661,325668..325670,325716..325718,
                     325728..325730,325737..325739,325749..325751,
                     325758..325760,325770..325772)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    325632..325634
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    325953..326261
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(325971..325973,325983..325985,325992..325994,
                     326058..326060,326064..326066,326070..326072,
                     326076..326081,326160..326171,326217..326219,
                     326223..326225,326238..326243,326247..326249)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    325983..325985
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(326070..326072,326076..326078,326160..326162,
                     326166..326168)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    326703..327035
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(326712..326717,326844..326846,326868..326870,
                     326928..326930,326985..326987,326994..326999)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    326844..326846
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(326853..326858,326862..326870)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    326994..327002
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    <327132..>327335
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="FOG: HPt domain [Signal transduction mechanisms];
                     Region: ArcB; COG2198"
                     /db_xref="CDD:225108"
     misc_feature    order(327225..327227,327234..327239,327282..327284,
                     327291..327293)
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    327225..327227
                     /gene="rcsC1"
                     /locus_tag="CNE_2c02950"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            327707..328213
                     /locus_tag="CNE_2c02960"
                     /db_xref="GeneID:10920785"
     CDS             327707..328213
                     /locus_tag="CNE_2c02960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680514.1"
                     /db_xref="GI:339321620"
                     /db_xref="GeneID:10920785"
                     /translation="MSNRPDFALAACTAFVLMSGAVSGTAATARAQTMLQKPYAYPAR
                     GQSAYQQTNDDGACYGWARQQTGINPYRVASTPVPVIVPGGERIRGAAGGAAAGAVAG
                     AIGGDAGKGAAAGAAVGTIAGGVAHRQQRRQAVAASAQAQASNDWAMTSYWQAWRACM
                     TGRGYSVQ"
     gene            complement(328308..328754)
                     /locus_tag="CNE_2c02970"
                     /db_xref="GeneID:10920786"
     CDS             complement(328308..328754)
                     /locus_tag="CNE_2c02970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680515.1"
                     /db_xref="GI:339321621"
                     /db_xref="GeneID:10920786"
                     /translation="MNAVSPIVAGLVAVAAASALSGCAIPTAETLSPFQEPWPWTKLV
                     AVNRTDHDVLAVRAGHCETGPSLRQSQSAPSFCFLGKKPERPIAITWNDAGAGAQHTS
                     TVPLPPLWPEDPRPEDLTGGYLCVLLRNDARVSLTVTASAQACAVL"
     gene            328978..329352
                     /locus_tag="CNE_2c02980"
                     /db_xref="GeneID:10920787"
     CDS             328978..329352
                     /locus_tag="CNE_2c02980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680516.1"
                     /db_xref="GI:339321622"
                     /db_xref="GeneID:10920787"
                     /translation="MHVVGIRIQSKEPADMINNCRPAVRAFGIALLIAGAGQAYAQLP
                     RGLESKGLRDQPDACAQAGLASKPAVCRAAGEPASSKYNLLYADAASADEGEDESPSH
                     RHAGHARDDAYRGGPRNEATGS"
     gene            329406..329900
                     /locus_tag="CNE_2c02990"
                     /db_xref="GeneID:10920788"
     CDS             329406..329900
                     /locus_tag="CNE_2c02990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680517.1"
                     /db_xref="GI:339321623"
                     /db_xref="GeneID:10920788"
                     /translation="MKLRPYLLAGIGLLASSEPAFASVLSGKALETAANAISWVVLFF
                     VPVAGVYLFWMLHIWPEKIAHRKRHPQKEAIHSLCLLSLFFGGLLWPLAWLWAHTKPV
                     FYRAAYGTDKAPEDDDAPGHDKVPSTQVAGHGVSYGPRNIVTLRASTAMDIASGKHAG
                     KEQI"
     misc_feature    329514..329696
                     /locus_tag="CNE_2c02990"
                     /note="Protein of unknown function (DUF3302); Region:
                     DUF3302; pfam11742"
                     /db_xref="CDD:152178"
     gene            329901..331079
                     /locus_tag="CNE_2c03000"
                     /db_xref="GeneID:10920789"
     CDS             329901..331079
                     /locus_tag="CNE_2c03000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680518.1"
                     /db_xref="GI:339321624"
                     /db_xref="GeneID:10920789"
                     /translation="MDALLLGVYALAVWLIFFKFRWLPWNTTSMVIVFTIPVVAMTML
                     VLTLNVVAPSSHDVRVVGKVLQVVPQVRGRIVELPAEGNRRYKKGDVLLRIDPTPYQA
                     SVRQLEGRLMADDAALAEAEASARQLSESVRGAAGRVSTVQARLSLARQRAKEHDALL
                     AAGAGSKFDREDALTRQRELEGELVSAQATEDEARQKLSARSQGEFAAIATARAKRAE
                     TEVMLENARWELEQTVYRAPSDGKVVNLQVRVGTMLVPFPFSPAFSFVEDSQEVVAFY
                     NQNELYNVKEGDRAEIYLPTNPGEIIKAKVNSIVWAQSQGQIAQGGMIPNTGATEVVP
                     NRFAVKLDLRDQSSGLMLPVGAVGAGAIYTEHMEMFHIIRMVFLRVSSKLNYLVFKLH
                     "
     misc_feature    329991..330986
                     /locus_tag="CNE_2c03000"
                     /note="multidrug resistance protein MdtN; Provisional;
                     Region: PRK10476"
                     /db_xref="CDD:182488"
     misc_feature    330090..330236
                     /locus_tag="CNE_2c03000"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    330606..330875
                     /locus_tag="CNE_2c03000"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            331124..332509
                     /gene="nodT1"
                     /locus_tag="CNE_2c03010"
                     /db_xref="GeneID:10920790"
     CDS             331124..332509
                     /gene="nodT1"
                     /locus_tag="CNE_2c03010"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux system, outer membrane lipoprotein,
                     NodT"
                     /protein_id="YP_004680519.1"
                     /db_xref="GI:339321625"
                     /db_xref="GeneID:10920790"
                     /translation="MSSFQLKKTLLLALPVAMLCGCALQTPPEGAALRRQAVPALEGQ
                     ATWANAATAGAAANGWLATFDDAELQRLVREAIAYNGDLRLAAVRVHQAQALVAIQRS
                     GMLPSAGVKGRAGNSETQILSIGASWEIDLWGRIRAQSRAAESQYAATRDDYLWAQRV
                     VAATTARAWFTLIQNATLEDRLRQIAAIQDELVRITGQRVEIGIAPETELLEARNALR
                     AQRDAIGKAELARSQAAQALELLLGRYPAGEIATGPELPAMPPAPAAGLPANLVERRP
                     DLTASAHRVAAAFDMRQSAEAARLPGISISAAITGIRSDVFLLNQAGSPIKGLSGSFF
                     APIFTGGELKARADYYSAEEKAALIAYGNTALQALSEVEAGLQAESGYDERTRQLRER
                     VDESRGLVLREEARAGIGASDTRSVLKQRQALVAAEMDLINVQANHLNQRIALLLALG
                     GDWKDEAGAGA"
     misc_feature    331169..332506
                     /gene="nodT1"
                     /locus_tag="CNE_2c03010"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    331328..331852
                     /gene="nodT1"
                     /locus_tag="CNE_2c03010"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    331937..332473
                     /gene="nodT1"
                     /locus_tag="CNE_2c03010"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            complement(332891..333589)
                     /locus_tag="CNE_2c03020"
                     /db_xref="GeneID:10920791"
     CDS             complement(332891..333589)
                     /locus_tag="CNE_2c03020"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase or acyltransferase"
                     /protein_id="YP_004680520.1"
                     /db_xref="GI:339321626"
                     /db_xref="GeneID:10920791"
                     /translation="MSNKPTVVLVHGFWGGAAHWRNVIIELARKGYTSLRAVELPLTS
                     LADDAERTRKMIAQQAGPVLLVGHSYGGAVITQVGDQPNVIGLVYIAAFAPDAGESPG
                     AITQQHLPAAAPNLVPDSDGYLWLNPDKFHESFCRDLSPDEALVMAVTQKAPLASTFG
                     DTITAPAWKKKPSWYQVSSEDRMIAPENQQKMAARLNARKVVTLAASHASLASKAADV
                     AALIDEAASEAIKA"
     misc_feature    complement(332909..333580)
                     /locus_tag="CNE_2c03020"
                     /note="Probable pheophorbidase; Region: PLN02965; cl17657"
                     /db_xref="CDD:248211"
     misc_feature    complement(332927..333571)
                     /locus_tag="CNE_2c03020"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(333811..334782)
                     /locus_tag="CNE_2c03030"
                     /db_xref="GeneID:10920792"
     CDS             complement(333811..334782)
                     /locus_tag="CNE_2c03030"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_004680521.1"
                     /db_xref="GI:339321627"
                     /db_xref="GeneID:10920792"
                     /translation="MSKVALFGAAGAIGQSVAAALRSKGRPYRVVGRSAGSLRTAFGT
                     DPLAEVVTWNPDSPESVQAAASGIETLIYMVGVNYWQFQLHPELMRKTLDGAVAAGVK
                     YFILIGTVYPYGRVQTGNPVREDHPREPHTFKGRMRKAQEDLLMQADASGRIRATVLR
                     LPDFYGPGVQASLLHRAAQAAVNGGTADMIGLLDQPHEFVYVPDVGPVVARLIDTPAA
                     FGKIWHLAGAGVTTQRELVSEMERQTGRTLKLRVAGKTMLRLLGLFNPFMRELVEMHY
                     LMTDPLVMDDSALQRLVGPIRKTPYVEGIRQTLAAVRETQPTAIAAA"
     misc_feature    complement(333832..334776)
                     /locus_tag="CNE_2c03030"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(333856..334776)
                     /locus_tag="CNE_2c03030"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(334291..334302,334381..334383,
                     334393..334395,334456..334464,334555..334563,
                     334681..334689,334744..334746,334750..334755,
                     334759..334761))
                     /locus_tag="CNE_2c03030"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(334381..334383,334393..334395,
                     334456..334458,334528..334530))
                     /locus_tag="CNE_2c03030"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            334897..335793
                     /locus_tag="CNE_2c03040"
                     /db_xref="GeneID:10920793"
     CDS             334897..335793
                     /locus_tag="CNE_2c03040"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680522.1"
                     /db_xref="GI:339321628"
                     /db_xref="GeneID:10920793"
                     /translation="MPKREPDWEWYRAFLHVLETGSLSAAGRAMGLTQPTVGRHIDSL
                     EAALGLKLFTRSFDGFAPTDAAHELKPYAAGIAATAAAMRRVASGHGAGVRGTVRLSA
                     SEVIGVEVLPPILAALHNEHPELEIELVLSNQADDLLRRDADIAVRMFRPEQAALVAT
                     RVGGIELGLHAHESYLASHGVPKSLADLSRFAAIGFDQENAFIRRLQARFKAFSRDAL
                     AFRADSDLAQLGAIRAGFGIGVCQSALAARDPRLVRVLPSQFSMTMDTWVAMHEDLRE
                     SARCAVTFAALAAGLRAYAEGA"
     misc_feature    334912..335784
                     /locus_tag="CNE_2c03040"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    334918..335097
                     /locus_tag="CNE_2c03040"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    335182..335667
                     /locus_tag="CNE_2c03040"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(335230..335235,335239..335244,335251..335253,
                     335263..335265,335269..335289,335521..335523,
                     335554..335568,335584..335589,335593..335598)
                     /locus_tag="CNE_2c03040"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(335808..336827)
                     /gene="fbaB"
                     /locus_tag="CNE_2c03050"
                     /db_xref="GeneID:10920794"
     CDS             complement(335808..336827)
                     /gene="fbaB"
                     /locus_tag="CNE_2c03050"
                     /EC_number="4.1.2.13"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase FbaB"
                     /protein_id="YP_004680523.1"
                     /db_xref="GI:339321629"
                     /db_xref="GeneID:10920794"
                     /translation="MDRKSELQATVDALAQAGRGLLAADESGPTIAKRFERIGVESSE
                     ENRRAWRNLLLSTPGLGEFISGVILYEETLGQRADDGTPLPELAARQGIVPGIKVDKG
                     KIALALAPGDEVTEGLDGLAKRLAGYRQQGARFAKWRAVYNVSDKLPGWAAVQANAEA
                     LARYAAICQEAGVVPIVEPEVLMDGAHSMARCAEVTEAVLHAVFHALHRHAVVLEHML
                     LKPSMVLPGKDAGHAPPAEVAMQTVQVLKRTVPAAVPGIFFLSGGQTPTEATVNLDAM
                     NRLAPLPWRLSFSYGRALQEPPLLAWRGDAANAAQAQRALLQRSRLNAMACLGQYDAA
                     QENAG"
     misc_feature    complement(335835..336818)
                     /gene="fbaB"
                     /locus_tag="CNE_2c03050"
                     /note="Class I aldolases; Region: Aldolase_Class_I;
                     cl17187"
                     /db_xref="CDD:266539"
     misc_feature    complement(336168..336170)
                     /gene="fbaB"
                     /locus_tag="CNE_2c03050"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188634"
     gene            complement(336913..337248)
                     /locus_tag="CNE_2c03060"
                     /db_xref="GeneID:10920795"
     CDS             complement(336913..337248)
                     /locus_tag="CNE_2c03060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680524.1"
                     /db_xref="GI:339321630"
                     /db_xref="GeneID:10920795"
                     /translation="MAATKSTRRPAKGRAKAGTSKGRRWSQQVTEHSDALDLEPHLFA
                     SDNPEEIAASLKRSAVSSRRRKGTAFQSAMSMLNFYINRAGRHLPKARRATLEKAKGK
                     LREAFGRPP"
     misc_feature    complement(336922..337179)
                     /locus_tag="CNE_2c03060"
                     /note="Protein of unknown function (DUF3175); Region:
                     DUF3175; pfam11373"
                     /db_xref="CDD:151813"
     gene            337473..339332
                     /gene="ilvD2"
                     /locus_tag="CNE_2c03070"
                     /db_xref="GeneID:10920796"
     CDS             337473..339332
                     /gene="ilvD2"
                     /locus_tag="CNE_2c03070"
                     /EC_number="4.2.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_004680525.1"
                     /db_xref="GI:339321631"
                     /db_xref="GeneID:10920796"
                     /translation="MPTYRSKTSTAGRNMAGARSLWRATGMKDEDFSKPIVAVVNSFT
                     QFVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTRLANPVT
                     KAMEFKKLDLVDAMVIAADSAYSDADVAEVERSACPTCGSCSGMFTANSMNCLTEALG
                     LSLPGNGTVVATHADREQLFKRAGSRIVELARQYYEQEDARVLPRSVGFKAFENAMTL
                     DIAMGGSTNTILHLLAIASEAGIDFSMTDIDRLSRVVPQLCKVAPNTNKYHIEDVHRA
                     GGIMAILGELERAGKLHTDVPTVHAPTLKDALEQWDISRTQDEAVRNFYLAGPAGIPT
                     QVAFSQNTRWPSLDLDRAEGCIRSYEHAFSKEGGLAVLRGNIALDGCVVKTAGVDESI
                     LVFEGTAHVTESQDEAVENILNDKVKAGDVVIVRYEGPKGGPGMQEMLYPTSYIKSKG
                     LGKACALLTDGRFSGGTSGLSIGHCSPEAAAGGAIGLVRDGDKIRIDIPNRTINVLLP
                     DEELASRREAQNAKGWKPAKQRPRKVSAALKAYAKLVMSADKGAVRDLSLLDD"
     misc_feature    337476..339329
                     /gene="ilvD2"
                     /locus_tag="CNE_2c03070"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            complement(339494..340282)
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /db_xref="GeneID:10920797"
     CDS             complement(339494..340282)
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /codon_start=1
                     /transl_table=11
                     /product="PhnT family ABC transporter permease"
                     /protein_id="YP_004680526.1"
                     /db_xref="GI:339321632"
                     /db_xref="GeneID:10920797"
                     /translation="MAHKVKAAQFCMRCLLTLIALAAAVSGSFAYLSLDLSQLLSADA
                     AAEMGRFLLTFFPPELSSAFLARTAGGMLETLAVSAVGTLCAAVLGFGLALPASGLYG
                     DALRTLSRLLLNVLRSIPELVWAALTVLAVGLGPFAGTLALALHTAGVLGRLFAEALE
                     NAPRAPARALTEGGTPAVLVFMYGTLPCVWPQFLAYILYRWETNIRVAAILGFVGAGG
                     LGQMLYFELSLFHLPQACTVIIAMLALAAVVDTASAIMRAGWHS"
     misc_feature    complement(339509..340159)
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="phosphonate ABC transporter, permease protein PhnE;
                     Region: PhnE; TIGR01097"
                     /db_xref="CDD:233270"
     misc_feature    complement(339536..340069)
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(339536..339541,339548..339553,
                     339557..339562,339569..339574,339602..339607,
                     339644..339649,339656..339667,339686..339688,
                     339695..339700,339740..339742,339791..339793,
                     339800..339805,339815..339817,339821..339826,
                     339833..339835,339839..339841,339845..339850,
                     339896..339898,339902..339907,339914..339943,
                     339947..339958,339986..339988,340004..340009,
                     340016..340021))
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(339650..339667,339896..339940))
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(339572..339574,339602..339604,
                     339611..339613,339647..339649,339863..339865,
                     339896..339898))
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(339719..339721,339731..339736,
                     339752..339790))
                     /gene="phnE1"
                     /locus_tag="CNE_2c03080"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(340286..341107)
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /db_xref="GeneID:10920798"
     CDS             complement(340286..341107)
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter PhnE"
                     /protein_id="YP_004680527.1"
                     /db_xref="GI:339321633"
                     /db_xref="GeneID:10920798"
                     /translation="MTTHPRDPQALQRASGLVLALLLLWPLLRLSRFSPSALFDTENL
                     KVMGAFVRNFLPPEVSPGFLGLVVNATLETLAIATAGIALAFVIATPLAVAMTGSLSV
                     SRIGPGRGRKPRMAVRAGVRTLVLLLRGVPELVWALVFVRALGLGATAGVLALAITYG
                     GMLAKVYAEILESSDKRAVDALFGSGSGRLAALFYGLLPHAAQELVSYTVYRWECAIR
                     ASVVMGFVGAGGLGQLMDQAVKLLNGGEAATILLVFLLLVLLADALSARLRKLID"
     misc_feature    complement(340406..340888)
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(340433..340438,340445..340456,
                     340475..340477,340484..340489,340529..340531,
                     340580..340582,340589..340594,340604..340606,
                     340610..340615,340622..340624,340628..340630,
                     340634..340639,340685..340687,340691..340696,
                     340703..340732,340736..340747,340778..340780,
                     340832..340837,340844..340849))
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(340439..340456,340685..340729))
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(340436..340438,340652..340654,
                     340685..340687))
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(340508..340510,340520..340525,
                     340541..340579))
                     /gene="phnE2"
                     /locus_tag="CNE_2c03090"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(341104..341946)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /db_xref="GeneID:10920799"
     CDS             complement(341104..341946)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /EC_number="3.6.3.28"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonates import ATP-binding protein PhnC 1"
                     /protein_id="YP_004680528.1"
                     /db_xref="GI:339321634"
                     /db_xref="GeneID:10920799"
                     /translation="MSFRLDAASVSYANGQRALSQITLAASRGEPIAVIGPSGAGKTS
                     LLRLLATSLRPSEGRVEVLEQSPWAVSAARLRQLRCRIGMVHQAPPMPPRQRVITAIL
                     AGRLGVWPGWKSLLSLVYPADIDGAGEQLARLELADRLFDRCDQLSGGQLQRVGVARV
                     LYQRPELILADEPVSAMDPVLANLTLGELRREADTRAVPLVASLHAVDLALRWFPRIV
                     GLKAGEIAFDLPAERVTDTLLRELYASESASPPVQGSQALMSIAAGASAAIDGDTPSR
                     PACR"
     misc_feature    complement(341200..341946)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="ABC-type phosphate/phosphonate transport system,
                     ATPase component [Inorganic ion transport and metabolism];
                     Region: COG3638"
                     /db_xref="CDD:226164"
     misc_feature    complement(341218..341940)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(341818..341841)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(341332..341334,341431..341436,
                     341686..341688,341815..341823,341827..341832))
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(341686..341697)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(341479..341508)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(341431..341448)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(341413..341424)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(341326..341346)
                     /gene="phnC1"
                     /locus_tag="CNE_2c03100"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(341957..342808)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /db_xref="GeneID:10920800"
     CDS             complement(341957..342808)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /codon_start=1
                     /transl_table=11
                     /product="PhnT family ABC transporter permease"
                     /protein_id="YP_004680529.1"
                     /db_xref="GI:339321635"
                     /db_xref="GeneID:10920800"
                     /translation="MLPLLKRLAALTLLGFAGLAGAQAVLKVSAIPDESPTELQRKFA
                     PLGNYLEKETGMKVKFVPVTDYAAVVESLATGKIDMAWLGGFTYVQSKIRTKGATIPI
                     VQRQEDAAFTSKFITANSAIKSLADLKGHTFVFGAPSSTSGHLMPRHFLLQAGIDPDK
                     DFKTVAYSGAHDATVAFVQAGRADAGVLNASVWDKLVEQHKVDPAKVRVFAVTPPYYD
                     YNWTVRGGLDPALRKKLTEAFLRLDPANPEQREIMALQRTARYIPTRPENYAGIEAAA
                     RAAGLIQ"
     misc_feature    complement(<342557..342808)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     misc_feature    complement(341990..342802)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="ABC-type phosphate/phosphonate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: PhnD; COG3221"
                     /db_xref="CDD:225762"
     misc_feature    complement(342050..342673)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(342242..342244,342383..342385,
                     342494..342496,342611..342613))
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(342263..342265,342281..342283,
                     342293..342295))
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(342143..342160)
                     /gene="phnD1"
                     /locus_tag="CNE_2c03110"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(342792..343865)
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /db_xref="GeneID:10920801"
     CDS             complement(342792..343865)
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /EC_number="2.7.9.3"
                     /codon_start=1
                     /transl_table=11
                     /product="selenide, water dikinase SelD"
                     /protein_id="YP_004680530.1"
                     /db_xref="GI:339321636"
                     /db_xref="GeneID:10920801"
                     /translation="MTRSPAVDQPNNAKIKLTAFSHGGGCGCKIAPGVLSEILRNSVG
                     FPAPAALLVGKETSDDAAVYQLNDSQALIATTDFFMPVVDDPYDFGRIAATNAISDVY
                     AMGGTPIMALALVGMPIEKLPPEVIGKILEGGESICAQAGIPVAGGHTIDSLEPIYGL
                     VVLGLVHPNRVKKNSGAEAGDKLILGKPLGVGVLSAAVKKDKLDAAGYQDLIACTTKL
                     NTPGRLLAEVPGVHALTDVTGFGLLGHLLELCRGAGVGARLDMGRIPLLPRVERMAAE
                     GLVTGASGRNWVSYGSEVDLSTSVTPSQKALLTDPQTSGGLLVSCAPEAVDEILEIFR
                     RDGFADAAVIGEMTQGAARVAVA"
     misc_feature    complement(342798..343838)
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /note="selenophosphate synthetase; Provisional; Region:
                     PRK00943"
                     /db_xref="CDD:234870"
     misc_feature    complement(342825..343817)
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /note="Selenophosphate synthetase  (SelD) catalyzes the
                     conversion of selenium to selenophosphate which is
                     required by a number of bacterial, archaeal and eukaryotic
                     organisms for synthesis of Secys-tRNA, the precursor of
                     selenocysteine in selenoenzymes. The...; Region: SelD;
                     cd02195"
                     /db_xref="CDD:100031"
     misc_feature    complement(order(343122..343124,343383..343385,
                     343395..343400,343419..343421,343518..343520,
                     343527..343529,343536..343538,343566..343568,
                     343632..343634,343638..343640,343644..343655))
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100031"
     misc_feature    complement(order(343419..343427,343566..343568,
                     343578..343580))
                     /gene="selD"
                     /locus_tag="CNE_2c03120"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100031"
     gene            complement(343862..344857)
                     /locus_tag="CNE_2c03130"
                     /db_xref="GeneID:10920802"
     CDS             complement(343862..344857)
                     /locus_tag="CNE_2c03130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680531.1"
                     /db_xref="GI:339321637"
                     /db_xref="GeneID:10920802"
                     /translation="MRPPKATVAIISPALRKANNGNWQTANRWARFLQGDYDVTLAAE
                     WSTASQGGALPDCLIALHARRSAESIARFAEACPDRPLIVVLTGTDLYRDIRTDASAQ
                     RSLALATHLVVLQDEGLAELAAAHRARCRVIYQSAPACAPAAPSQDHFDVVLVGHMRA
                     EKDPLTPMRALSLLPHDSRVRLIHIGGALDDAYQQAALALEAQAWPGVRRYVWLRNLP
                     HDQTRQHIRQAQAMVISSAMEGGANVITEAVASGVPVLASRIPGNFGMLGRDYEGYFP
                     LGDAAQLALVLERTSRDAGFLNRLRQQCALRAPLFAPARERAEVSKLVADALKPE"
     misc_feature    complement(343880..344836)
                     /locus_tag="CNE_2c03130"
                     /note="putative glycosyltransferase, TIGR04348 family;
                     Region: TIGR04348"
                     /db_xref="CDD:213961"
     misc_feature    complement(343934..>344674)
                     /locus_tag="CNE_2c03130"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            344856..346058
                     /locus_tag="CNE_2c03140"
                     /db_xref="GeneID:10920804"
     CDS             344856..346058
                     /locus_tag="CNE_2c03140"
                     /EC_number="2.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_004680532.1"
                     /db_xref="GI:339321638"
                     /db_xref="GeneID:10920804"
                     /translation="MTIGSEGAAARRINKFELDAAFAEAHRRTWGLLQELSPSQWQVP
                     YDAGINPPLWEYAHIAWFTELWVLREPRAGQDGRWVASLPSMLADADRLFDSMRVAHR
                     DRWHLALPRLPEIRDYAAAVLEHVRARLATSDDTDAALYFFRLALFHEDMHAEALTYM
                     RQTLDYPLHAPLGMPSIAPGAGSAAAGGDTFQMGSPIGGDGFVFDNEKWSHPVHIAPF
                     RIDRTCESNAAFAEFVAAGGYRDRQWWSDDGRAWLQQSGLAHPLRWRRTAGGIAGQWA
                     LRWFGQWVPLPAEQPVCHINAYEAEAYCRWAGKRLPTEAEWEYAATHDLIRWGSAVWE
                     WTADPFVPYAGFSPDPYQEYSAPWFHTHRSVRGGSFATHARMQHPRYRNFYLPHRGDL
                     FVGFRCCG"
     misc_feature    344907..346052
                     /locus_tag="CNE_2c03140"
                     /note="ergothioneine biosynthesis protein EgtB; Region:
                     egtB_TIGR03440"
                     /db_xref="CDD:234211"
     misc_feature    344916..345326
                     /locus_tag="CNE_2c03140"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     misc_feature    345423..346049
                     /locus_tag="CNE_2c03140"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     gene            346320..346709
                     /locus_tag="CNE_2c03150"
                     /db_xref="GeneID:10920803"
     CDS             346320..346709
                     /locus_tag="CNE_2c03150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680533.1"
                     /db_xref="GI:339321639"
                     /db_xref="GeneID:10920803"
                     /translation="MHYQHLAMFGAVALMAASALAQSSGLTRTLVGRADVSVPGREAV
                     VARVEVAPGAYAGRHTHPGDEISYVMEGEAQLLIDGQSPRTVKAGESFVVPAGVVHDA
                     HNSGSTATRVLGVYVVEKGKPLASPAP"
     misc_feature    346455..346667
                     /locus_tag="CNE_2c03150"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            complement(346952..347536)
                     /locus_tag="CNE_2c03160"
                     /db_xref="GeneID:10920805"
     CDS             complement(346952..347536)
                     /locus_tag="CNE_2c03160"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD/FMN-containing dehydrogenase"
                     /protein_id="YP_004680534.1"
                     /db_xref="GI:339321640"
                     /db_xref="GeneID:10920805"
                     /translation="MIVYCADAADVSRAVTFARSGGYLVAVCSGGHNVAGLSVCDDGI
                     VIDLARLKRIEFDPVHRIARAGAGLSLGEFDRATQSHGLATTMGVNSDTGIAGLTLGG
                     GFGRLGRKHGLACDNLIAAEIVLADGRMLRASATENADLLCLRERAWRHATAGFEAGW
                     RGDRPGPEDGDTLRKPRCALRLLPHLDLGRSGRR"
     misc_feature    complement(<347117..347533)
                     /locus_tag="CNE_2c03160"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    complement(347135..347533)
                     /locus_tag="CNE_2c03160"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     gene            complement(347575..347991)
                     /locus_tag="CNE_2c03170"
                     /db_xref="GeneID:10920806"
     CDS             complement(347575..347991)
                     /locus_tag="CNE_2c03170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680535.1"
                     /db_xref="GI:339321641"
                     /db_xref="GeneID:10920806"
                     /translation="MLYRAAQRVEVCVTLVANQYMRTPPSRFIKALQVPAGFDVADDR
                     IVELVSSGDLVITADIVLAAAALDKGAYVLDPRGSWFSRENIQERLTMREVMEQLRSS
                     GVDTGGPAPYAPQDSKAFAGQLDRFLARHAPPGAVA"
     misc_feature    complement(347602..347991)
                     /locus_tag="CNE_2c03170"
                     /note="Uncharacterized BCR, YaiI/YqxD family COG1671;
                     Region: DUF188; pfam02639"
                     /db_xref="CDD:251442"
     gene            complement(348131..348559)
                     /locus_tag="CNE_2c03180"
                     /db_xref="GeneID:10920807"
     CDS             complement(348131..348559)
                     /locus_tag="CNE_2c03180"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004680536.1"
                     /db_xref="GI:339321642"
                     /db_xref="GeneID:10920807"
                     /translation="MEEIANTTVLFIAGFGPIVREAEASRKLYSQTFGIPFNEEKGGY
                     LHTEALQGANSFALWPLSEAAQSCYGSDSWPGDVPIPQAWIEFDVDNVERATAELESR
                     GYRMLVRNKKEPWGQTVSRFIGPEGLLVGITFTPSMREEK"
     misc_feature    complement(348164..348505)
                     /locus_tag="CNE_2c03180"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(348167..348169,348173..348175,
                     348197..348199,348308..348310,348383..348385,
                     348389..348391,348419..348421))
                     /locus_tag="CNE_2c03180"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            complement(348884..349402)
                     /locus_tag="CNE_2c03190"
                     /db_xref="GeneID:10920808"
     CDS             complement(348884..349402)
                     /locus_tag="CNE_2c03190"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680537.1"
                     /db_xref="GI:339321643"
                     /db_xref="GeneID:10920808"
                     /translation="MKAGRDIVADRFNAGVRLGDTIDKDMIAVPIGPRLRMAVVAAPS
                     YFAGNPARKTPRDLPAHRCINLRFPTHGGLSVWDFERRGRQLKVRVDCQVVFNTTPHI
                     VMAALEGLGVAFLPEEEFAPHVEAGRLGRVLEDWCPPFGGYHLYYPRRRQASPAFSLV
                     VNALRVGGSARR"
     misc_feature    complement(348908..>349390)
                     /locus_tag="CNE_2c03190"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(348911..>349387)
                     /locus_tag="CNE_2c03190"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            349402..350013
                     /locus_tag="CNE_2c03200"
                     /db_xref="GeneID:10920809"
     CDS             349402..350013
                     /locus_tag="CNE_2c03200"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004680538.1"
                     /db_xref="GI:339321644"
                     /db_xref="GeneID:10920809"
                     /translation="MQAESRAAASGNVLRLFKSRGAALGMTACGAFFMGQFALFTYVR
                     PFLEGVTHVSMSALSLVLLTIGVAGFIGTTLIGHVPEAGGVPHPDLHPTVDGGYRLGA
                     DPLWRLVAAVAALLGLWGLAATAAPVGWWSWIARTMPKNAEAVGGSMVAVIQLAIALG
                     STLGGLLFDISGYQTTFVASAALLLVAAFLTFLASRSGMAQAA"
     misc_feature    <349402..350010
                     /locus_tag="CNE_2c03200"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     gene            350272..351732
                     /locus_tag="CNE_2c03220"
                     /db_xref="GeneID:10920810"
     CDS             350272..351732
                     /locus_tag="CNE_2c03220"
                     /EC_number="1.1.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/sorbosone dehydrogenase"
                     /protein_id="YP_004680539.1"
                     /db_xref="GI:339321645"
                     /db_xref="GeneID:10920810"
                     /translation="MSEALRYSLCRFFIACCLGLAACGGGGDGGGSDSATGTGTGTLT
                     LSISGLPSGTSAAITVSGPGQFRQTVTQSTTLSNLAAGSYTISAASVLTGSTLLKPQP
                     PSQTVAVTAGGRASASVAYGSPETVQLSLTQVAGGLSAPIFLTAPHGDSRLFVVERAG
                     RIRIVRNGTLVATPFLDIAALTTTDGERGLLSMAFDPNYGTNGRFYVYYTDANGAITI
                     ARYSVSAANPDIANASGTVLLSIPHGTFSNHNGGQLAFGPEGMLYIGTGDGGGSGDPS
                     GNAQNPGTLLGKMLRIDVSGASGYGLPAGNPFVGQSGSRGEIWALGLRNPWRFSFDAG
                     LLYIADVGEDQREEVDVAPATSAGLNYGWNRTEGTACVGAAGCDKTGLTMPVFEYGHD
                     AGACAIVGGYVYRGSASPALQGRYFYTDLCTGKLLSFMYRDGVVVEQVDWKVTVPGSV
                     FSFGVDDGQALYVLADPGTSTTSGRVYRVDVSGGTP"
     misc_feature    350680..>351375
                     /locus_tag="CNE_2c03220"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     misc_feature    350707..351705
                     /locus_tag="CNE_2c03220"
                     /note="Glucose / Sorbosone dehydrogenase; Region: GSDH;
                     pfam07995"
                     /db_xref="CDD:254571"
     gene            complement(351975..353357)
                     /locus_tag="CNE_2c03230"
                     /db_xref="GeneID:10920811"
     CDS             complement(351975..353357)
                     /locus_tag="CNE_2c03230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680540.1"
                     /db_xref="GI:339321646"
                     /db_xref="GeneID:10920811"
                     /translation="MKSKALLLCTLAGAVLAVSQINAPSLAAMTPDEVKRLDGPLTPM
                     GAERSANKDGSIPAWSGKWQATPAGLAFRPGDAYPDPYASEQPLATITAQNLEQYRAR
                     LSDGQLAMFRLYPATFKMAIYPSHRDFRYGDAVYKAIQHHAPGTQLTSDANGLKDYPP
                     TAPFPVPKNGLELMWNLRFSSAIAEEAAVYDQAVVYRDGKIAWGKWKYDIWSPVNGTA
                     FEKGSPLINRTFARVETELPLRERGNIIVSHNFWDREGSDTARTWQYNPGTRRVRQAP
                     EFGFDQPLGPGGFRTVDDDRLFNGSGERYDWKIVGKREIYIPYHNYKLADPAVKYAEL
                     LGANHAAPDLVRYELHRVWVLEAKLKPGFRHQYAKRVLYLDEDTWMAVLADNYDARGQ
                     LWRTNLQSSLFAYDARRYYPAVAFYHDLTAGAYLADRLTNEGKPVRLNSSPQFSEAYF
                     SPDSIRGAGH"
     misc_feature    complement(351987..353090)
                     /locus_tag="CNE_2c03230"
                     /note="Protein of unknown function (DUF1329); Region:
                     DUF1329; pfam07044"
                     /db_xref="CDD:254034"
     gene            complement(353387..354391)
                     /locus_tag="CNE_2c03240"
                     /db_xref="GeneID:10920812"
     CDS             complement(353387..354391)
                     /locus_tag="CNE_2c03240"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="YP_004680541.1"
                     /db_xref="GI:339321647"
                     /db_xref="GeneID:10920812"
                     /translation="MEKSMRAVVIDRTGGPDVLRLGDLPRPEPAAGEVLVRVACAGVN
                     PADWKCREGYLSHFMQYSFPFVIGFDASGVVAAVGSGVKDFVPGQRVFAQTAVGAGKW
                     GSYAEYVAVSQDCVVPIPDNLGFAEAAAVPTPALAAWTGLFDEGGLKPGQTVLVHGGA
                     GAVGTFAVQLAKAAGATVAATCSAARRDELMALGCDLAIDYRGDDIAAAMRAWAPAGV
                     DLVLDAVGCGTLPNGMDLLRPGGILVAILTLVSGDNGPDPAAAAQRGVRTAVAFSKMP
                     SGARLREIAALLGSGRLRPPRIECLPLEQAGRALDLVQSGKAASKLVLRIAEPANAGA
                     "
     misc_feature    complement(353414..354379)
                     /locus_tag="CNE_2c03240"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    complement(353420..354379)
                     /locus_tag="CNE_2c03240"
                     /note="alcohol dehydrogenase and quinone reductase-like
                     medium chain degydrogenases/reductases; Region:
                     MDR_like_2; cd05289"
                     /db_xref="CDD:176191"
     misc_feature    complement(order(353570..353578,353651..353656,
                     353717..353722,353792..353794,353834..353836,
                     353840..353845,353900..353917,353981..353983,
                     353993..353995,354245..354247,354254..354262))
                     /locus_tag="CNE_2c03240"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176191"
     gene            complement(354396..355271)
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /db_xref="GeneID:10920813"
     CDS             complement(354396..355271)
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase UcpA"
                     /protein_id="YP_004680542.1"
                     /db_xref="GI:339321648"
                     /db_xref="GeneID:10920813"
                     /translation="MTAHRKLTGKIALVTGASRGIGRAIAQRFAAEGALVVATARRAG
                     ESEDEPGTLAETVGQIRRQGGSAIALAADLEDPAQRDDLVAQAASAAGGLDILVNNAG
                     MAEYSRIESMPLEIFDRTVKHYLRIPFVLSRAAIPLMRTRGAGWILNLGSVTALSPAR
                     PYQDFDRAGGVTAYAAVKAAINRFTEGLAAELEADNIAVNSVAPSTAIRTPGSERYIP
                     DGYPTEPVEYLVETALALCSVPARLRTGHIAHSLHFPLAHGLNVRTLDGQGMLPPPVI
                     PSWAHPGLNHELSAR"
     misc_feature    complement(354528..355256)
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK05565"
                     /db_xref="CDD:235506"
     misc_feature    complement(354510..355253)
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(354651..354662,354738..354740,
                     354750..354752,354816..354824,354966..354974,
                     355149..355154,355209..355211,355215..355220,
                     355224..355226))
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(354738..354740,354750..354752,
                     354816..354818,354900..354902))
                     /gene="ucpA"
                     /locus_tag="CNE_2c03250"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(355268..355927)
                     /locus_tag="CNE_2c03260"
                     /db_xref="GeneID:10920814"
     CDS             complement(355268..355927)
                     /locus_tag="CNE_2c03260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680543.1"
                     /db_xref="GI:339321649"
                     /db_xref="GeneID:10920814"
                     /translation="MRLETAQVRLLAGFCSGTCTQEQALLARIETLPGLSHVAIGRNL
                     AGSWGAGDYTLDLLFDPTASGSPGHDIGLVAALDGMAEVDSVAYRPISDGLRAPPLCH
                     GIWRTLMFRLRPEAPDWQVRALEQDLLRMPEYMPGILNWRLARVLSPGTWTHVWQQEF
                     ASADDLLGEYLMHPFHWGHVDRWFDPEFPEWTVQAISHAFCPLATSLIANHNRTEEYA
                     P"
     misc_feature    complement(355349..355618)
                     /locus_tag="CNE_2c03260"
                     /note="Stress responsive A/B Barrel Domain; Region: Dabb;
                     smart00886"
                     /db_xref="CDD:214884"
     gene            complement(355917..356261)
                     /locus_tag="CNE_2c03270"
                     /db_xref="GeneID:10920815"
     CDS             complement(355917..356261)
                     /locus_tag="CNE_2c03270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680544.1"
                     /db_xref="GI:339321650"
                     /db_xref="GeneID:10920815"
                     /translation="MIHILDEIVLAPGHLPTVLSLLESQYLPGSAARGLALLQRCVSP
                     PVALEDAPNTLWLLWQVADAPAYYAMRASIDAPVLAFWSTVDTLCEARRRHVMADATA
                     TLPQRKEHCDAA"
     gene            356432..357520
                     /locus_tag="CNE_2c03280"
                     /db_xref="GeneID:10920816"
     CDS             356432..357520
                     /locus_tag="CNE_2c03280"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004680545.1"
                     /db_xref="GI:339321651"
                     /db_xref="GeneID:10920816"
                     /translation="MIMGGQAAPSPHPNDQPSLPKQSEPATMNAHIPGNPVPVPHGMV
                     QRLLDELKRQGVEVPPAAGASGHAPAARFTALYRAAIERLEALVAKGNGHPPMRKQEV
                     DLLCRCVLSSQTLREAIRCAADFCAMLYPRAGALSLGQSAGQAVFRMDSLRRANSSAA
                     CLVDLTGLFFYMLLFGWLVGQPLRPTHVYLAHPRREDAMPFLGLFHAAVTSGAQTYGF
                     EFDEALLDRPVVRQAAELDAFLEDFPYRLIGAPVEVVSVSQQVHGILHAALVHGARLP
                     TLAELAMRFDVSEPTLRRRLAADGSSYRVLREHSLQEYAEQCLCTTNWSVGRIAEQLG
                     FASEEAFRRAFQRWTGHAPTRFRRESRG"
     misc_feature    356591..357118
                     /locus_tag="CNE_2c03280"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    357221..>357331
                     /locus_tag="CNE_2c03280"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    357257..357502
                     /locus_tag="CNE_2c03280"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    order(357257..357259,357263..357268,357290..357304,
                     357308..357310,357311..357313)
                     /locus_tag="CNE_2c03280"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    357392..357505
                     /locus_tag="CNE_2c03280"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(357591..358706)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /db_xref="GeneID:10920817"
     CDS             complement(357591..358706)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophytochrome"
                     /protein_id="YP_004680546.1"
                     /db_xref="GI:339321652"
                     /db_xref="GeneID:10920817"
                     /translation="MRLADFILRDTGRIVAAWEEFATTLLPAARNMDSLALRDHAPQI
                     LQAVAKDLLTPQTREAQREKSMGQAPKLLGAPETAAQTHALLRARGGFNINQLVAEYL
                     ALRASVLRLWIDECQPAAPYLDDVMRFNEAIDQAVAESVAFFHSQVEQARDLLLGMVG
                     HDMRSPLQTIQTTASYLAALNAGEKVSEAAARLIRSGSRMNSLLDDLCDFNRTKLGLG
                     INITPYDVDLAELVADTVDQLRAAHPTRRIELEVKGNVQGIWDGLRLQQLLSNLVLNA
                     IRYGAPDEPVCVAVTGHDAEVSLEVRNSGPAIDPLSLERLFDPLRRGPDQENKNADGL
                     GLGLYIVSEITKAHQGSIEARSDQTGTTFDVRLPRRT"
     misc_feature    complement(357597..>358304)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(358071..358262)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(358086..358088,358098..358100,
                     358107..358109,358119..358121,358128..358130,
                     358140..358142,358188..358190,358197..358199,
                     358209..358211,358218..358220,358230..358232,
                     358242..358244))
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(358224..358226)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(357606..357914)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(357618..357620,357624..357629,
                     357639..357641,357645..357647,357693..357704,
                     357783..357788,357792..357794,357798..357800,
                     357804..357806,357873..357875,357882..357884,
                     357894..357896))
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(357882..357884)
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(357696..357698,357702..357704,
                     357786..357788,357792..357794))
                     /gene="bphP"
                     /locus_tag="CNE_2c03290"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(358881..359285)
                     /locus_tag="CNE_2c03300"
                     /db_xref="GeneID:10920818"
     CDS             complement(358881..359285)
                     /locus_tag="CNE_2c03300"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004680547.1"
                     /db_xref="GI:339321653"
                     /db_xref="GeneID:10920818"
                     /translation="MLITWSSKPDSRRCRLTLKLWPGSGYADKLAKYRDYVSQRMKFW
                     AVLLFCIAVPSEIPGYLFGSMHYPFRKFLAAMAIAEAGYAFGIVVAGESLAIDRPLPF
                     LIAVGILAVVAVLAGLVLRAVRKHKSGGLQRR"
     misc_feature    complement(359007..>359234)
                     /locus_tag="CNE_2c03300"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; cl00429"
                     /db_xref="CDD:260418"
     gene            359236..360171
                     /locus_tag="CNE_2c03310"
                     /db_xref="GeneID:10920820"
     CDS             359236..360171
                     /locus_tag="CNE_2c03310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680548.1"
                     /db_xref="GI:339321654"
                     /db_xref="GeneID:10920820"
                     /translation="MSLQRRLSGFDDHVISMYARGMSVREIQGHLQELYGLQVSPDLI
                     STITDEVLAEVEQWQQRPLEAMYPIVYFDALRLKIRDEGTVRNKAVYLALGIRADGRK
                     EVLGLWIEQTEGAKFWLKVFNELKNRGLEDILIAVVDGLRGFPQAIEAVYPAAQIQTC
                     IVHLIRNSLNLASWKDCKGLAAALKPIYQAATADAAATALDAFAGSDWGRKFPTVADM
                     WRRQWEQVIPFFAYPPEVRRIIYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLA
                     LRNIEKDWKMPPITWKQAANQFAILFGDRFTNALR"
     misc_feature    <359245..360144
                     /locus_tag="CNE_2c03310"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    <359245..360090
                     /locus_tag="CNE_2c03310"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            360228..361016
                     /locus_tag="CNE_2c03320"
                     /db_xref="GeneID:10920819"
     CDS             360228..361016
                     /locus_tag="CNE_2c03320"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS110 family"
                     /protein_id="YP_004680549.1"
                     /db_xref="GI:339321655"
                     /db_xref="GeneID:10920819"
                     /translation="MRPFVRTNKTDAADARAIWTAAQQPGMRPIPVKTEAQQALLGLH
                     RIRSELVDSRTRQVNQIRGLLGEYGLHFVLGRKAAMAQFVTRLSEIEQTIPAPLWRLL
                     SRQLQRLRQLDAEILAAEQEIAAWLKTEPAAQCVDAIPGIGPITATALVATMGSPQAY
                     RSGRAFAASLGLVPTQSGTGGKVHLGHISKRGDPYLRKLLIHGARIVLTRSKRRPCWA
                     EALLVRRPTNVAIVALANKMARTAWALLAHRRVYEPGYVSARPA"
     misc_feature    <360231..360407
                     /locus_tag="CNE_2c03320"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    <360249..360965
                     /locus_tag="CNE_2c03320"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    360624..360866
                     /locus_tag="CNE_2c03320"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(361258..361584)
                     /locus_tag="CNE_2c03330"
                     /db_xref="GeneID:10920821"
     CDS             complement(361258..361584)
                     /locus_tag="CNE_2c03330"
                     /EC_number="3.1.6.1"
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="YP_004680550.1"
                     /db_xref="GI:339321656"
                     /db_xref="GeneID:10920821"
                     /translation="MSNDNKPGGTLTRRDFLLTAGVGTMALGLGAGADAKDAPAGASD
                     AAQAAGSPASGPYNILFILVDQERYFRPGELPKGYGLPAHERLMKRGTTFLTSLYEHR
                     PDAKVN"
     gene            complement(361827..363377)
                     /locus_tag="CNE_2c03340"
                     /db_xref="GeneID:10920822"
     CDS             complement(361827..363377)
                     /locus_tag="CNE_2c03340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680551.1"
                     /db_xref="GI:339321657"
                     /db_xref="GeneID:10920822"
                     /translation="MDLKTRRGKSPERKAPSGLRFPCACLAESRGGDPSHTRHVASSW
                     AGYSVDDNMTDAFLFSKPFTFLACAGMSEVREGVDVLEALPGHLLWLENEDYIRRVYV
                     PDFLEQSRAALEAVMPGGPAQIDAMADEIRHSPRLMPDLQRLSPEIAAAAHSYCYWRY
                     SADVVGRAQGIPRSAIERQFDRAARPRDGAHKLQWICPCCDGPAHYQVDGLLASQRPA
                     RQGGFSIECAHCGHQERLYAGFLHAGRLECRCAHCTGFIKTLAGQLARPARRLCAALE
                     DYAWMHAVDTAAEIRELWEASLQMLASGARPSDNTMAFALAIQSDEARPIPDILSQID
                     PTLEGRLDKNPRAWVLLCELLREGVLDADCAIYDHDGRQHVALELALLEDDQAADSAT
                     AQDSLATLLKGYQPPERDAFINWLKALKRLRLCTARFNAAVDVAWKPNLEHCRILTAR
                     WSDGQPAPAAQASAAWLPAAPRPRRPERPVYLDAELEAVQLLKSLGYIVLSPEEIRSQ
                     RDPIEDML"
     gene            complement(363438..363911)
                     /locus_tag="CNE_2c03350"
                     /db_xref="GeneID:10920823"
     CDS             complement(363438..363911)
                     /locus_tag="CNE_2c03350"
                     /codon_start=1
                     /transl_table=11
                     /product="copper export regulator HmrR/CueR family"
                     /protein_id="YP_004680552.1"
                     /db_xref="GI:339321658"
                     /db_xref="GeneID:10920823"
                     /translation="MKIGELARLSGIAASRIRFYEASGLLEPAQRQANGYREYAPETL
                     TRLEIIMCAQGSGFSLEEIRAILPPDLDKWPHDQLLQALRRKVDEIELLEQRLAQSKH
                     RLVALIDEINGTREGEDCEGKARRVLERMNQDGNGGAPAGLPGRRTRTSRKGIPL"
     misc_feature    complement(363519..363911)
                     /locus_tag="CNE_2c03350"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    complement(363558..363911)
                     /locus_tag="CNE_2c03350"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    complement(order(363801..363809,363858..363860,
                     363900..363908))
                     /locus_tag="CNE_2c03350"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            363990..365228
                     /locus_tag="CNE_2c03360"
                     /db_xref="GeneID:10920824"
     CDS             363990..365228
                     /locus_tag="CNE_2c03360"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH oxidase"
                     /protein_id="YP_004680553.1"
                     /db_xref="GI:339321659"
                     /db_xref="GeneID:10920824"
                     /translation="MKLFTPLALPNGAVIPNRLAKAAMEENMADADHAPSDALLRLYD
                     AWANGMAGLILTGNVMVDHRAMTGPNGVVLEDDTHLDRFRRWARTARAGGAHVWMQIN
                     HPGRQMPAALGQTTLAPSAVPLDLGALSKQFPVPREMTGRDIADVQQRFTRSAQLAER
                     SDFTGVQIHAAHGYLLSQFLSPIANKRQDQWGGSIENRARLLLGIVRSVRSAVSPRFA
                     VSVKLNSADFQRGGFSADDARRVVEMLNPLNVDLIELSGGSYEAPAMQGQARDGRTLA
                     REAYFLEFARDIASVARMPLMVTGGIRRRAVAEQVIDSGIAMAGIATALSIDPNLPRN
                     WHAGKNNAPALRSITWKNKTLGSLAKMAVVKFQLKRLSEGRVTDPRVSPVRALVLQQL
                     STSCQTRRYRRWTTQRAGAR"
     misc_feature    363996..365003
                     /locus_tag="CNE_2c03360"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 2.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_2_FMN; cd04733"
                     /db_xref="CDD:240084"
     misc_feature    order(364056..364058,364062..364064,364161..364163,
                     364287..364289,364509..364511,364665..364667,
                     364953..364958)
                     /locus_tag="CNE_2c03360"
                     /note="putative active site [active]"
                     /db_xref="CDD:240084"
     misc_feature    order(364056..364058,364062..364064,364161..364163,
                     364287..364289,364665..364667,364953..364958)
                     /locus_tag="CNE_2c03360"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240084"
     misc_feature    order(364503..364505,364509..364511)
                     /locus_tag="CNE_2c03360"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240084"
     misc_feature    364509..364511
                     /locus_tag="CNE_2c03360"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240084"
     gene            365387..365911
                     /locus_tag="CNE_2c03370"
                     /db_xref="GeneID:10920825"
     CDS             365387..365911
                     /locus_tag="CNE_2c03370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680554.1"
                     /db_xref="GI:339321660"
                     /db_xref="GeneID:10920825"
                     /translation="MKLANFALAAAILFSAGTTFAQDAVNDAQIASIVVTANQVDIDA
                     GKLAKRKASGKDVKAFAQQMITDHTGVNKSATALVKKLKVKPEGNPTSTSLKSDGDKN
                     LSKLKGLKGAEFDSAYIDNEVTYHQAVIDAMDKTLIPGAKNEELKALLVKVRPAFVAH
                     LEHAKQIQGSLGKK"
     misc_feature    365465..365887
                     /locus_tag="CNE_2c03370"
                     /note="Domain of unknown function (DUF4142); Region:
                     DUF4142; pfam13628"
                     /db_xref="CDD:257938"
     gene            366088..366288
                     /locus_tag="CNE_2c03380"
                     /db_xref="GeneID:10920826"
     CDS             366088..366288
                     /locus_tag="CNE_2c03380"
                     /codon_start=1
                     /transl_table=11
                     /product="blue (type 1) copper domain-containing protein"
                     /protein_id="YP_004680555.1"
                     /db_xref="GI:339321661"
                     /db_xref="GeneID:10920826"
                     /translation="MVWVNKDPFPHTVTASGGGFDSKAIAPGKSWTYTARKTGVFPYT
                     CTLHPTMTGTLSVGSNAKASGE"
     misc_feature    <366091..366258
                     /locus_tag="CNE_2c03380"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            complement(366311..367867)
                     /gene="garD1"
                     /locus_tag="CNE_2c03390"
                     /db_xref="GeneID:10920827"
     CDS             complement(366311..367867)
                     /gene="garD1"
                     /locus_tag="CNE_2c03390"
                     /EC_number="4.2.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactarate dehydratase GarD"
                     /protein_id="YP_004680556.1"
                     /db_xref="GI:339321662"
                     /db_xref="GeneID:10920827"
                     /translation="MSVVLEQEAATAAELVIRLHPDDDVVIARAQLVAGARLGAGLVV
                     RGLVPAGHKLAVRALEAGAPVRRYGQVIGFATRPVAPGEHVHTHNLAIGAFERDYAFG
                     TATRPAAVAPQRAQFMGIVRADGRVGTRNYIGILTSVNCSATAARAIAEHFRRELNPQ
                     ALADYPNVDGVVALTHGQGCAVDGEGEGLALLRRTLAGYARHPNFAAVLIVGLGCETN
                     QIDGLLDSEGLARGAALKTMTIQATGGTARTVAAGIEQIKAMLPDANRVRREPVDASH
                     LVVGLQCGGSDGYSGISANPALGAAVDRLVAHGGTAILSETPEIYGAEHLLTRRAVSP
                     EVGHKLLDRIRWWEAYCARMNASLDNNPSAGNKAGGLTTILEKSLGAVAKGGTTNLVD
                     VYRYAEPVEAAGLVFMDTPGYDPVSATGQVAGGANLICFTTGRGSAYGCAPSPSLKLG
                     TNTALWQRQQEDIDINCGTVIDGTQTIDALGEEIFRLMLAAASGQRSKSELHGYGQNE
                     FVPWQLGAIT"
     misc_feature    complement(366314..367825)
                     /gene="garD1"
                     /locus_tag="CNE_2c03390"
                     /note="galactarate dehydratase; Region: galactar-dH20;
                     TIGR03248"
                     /db_xref="CDD:188300"
     misc_feature    complement(367595..367822)
                     /gene="garD1"
                     /locus_tag="CNE_2c03390"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF_AH_GD; cd11613"
                     /db_xref="CDD:212158"
     misc_feature    complement(366314..367531)
                     /gene="garD1"
                     /locus_tag="CNE_2c03390"
                     /note="D-galactarate dehydratase / Altronate hydrolase, C
                     terminus; Region: GD_AH_C; pfam04295"
                     /db_xref="CDD:252510"
     gene            complement(367864..369468)
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /db_xref="GeneID:10920828"
     CDS             complement(367864..369468)
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /EC_number="1.2.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent fatty aldehyde dehydrogenase
                     AldH"
                     /protein_id="YP_004680557.1"
                     /db_xref="GI:339321663"
                     /db_xref="GeneID:10920828"
                     /translation="MTILGLHYIGGERRAAGTPLYSIDAVTGERYPVSFHEATGAEVA
                     AAALAAHQAFPAFRASSPAERAALLETIADEIDALDQAFIAAASRETALPPARLEGER
                     KRTSNQLRMFAATVRRGDFLDVRIDRAQPARQPLPRPDLRQYRVGVGPVAVFGAGNFP
                     LAFSVAGGDTASALAAGCPVVVKAHPGHMVTSAYVANAIERAIARSGAPAGVFNMVFG
                     TAAAGAALVRAPHIKAVGFTGSLAAGRALFDLAQSRPDPIPVFAEMSSVNPVFLMPSA
                     LSARGAQIARELAASVTFGCGQLCTNPGVVLGIRSPAFDAFLAELGTALALAEPQPML
                     GAGIRDNFQRGLAGLREVPGVEVLVSKQADGRIGGHLLKADRSVLFAENRPLEEEVFG
                     PSTVIVALDSEDDFLAFAERMRGQLTATLMADDGDLHHHAALIVLLESKVGRLLFNGY
                     PTGVEVSDAIVHGGPYPATTDARGTSVGSAAIERFLRPVCYQNYPDSVLPPALRDRNP
                     WQLPRLVDGVPTRAAVQGAHDLEAAA"
     misc_feature    complement(367990..369309)
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /note="Alpha-Ketoglutaric Semialdehyde Dehydrogenase;
                     Region: ALDH_KGSADH; cd07129"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(367993..368004,368008..368013,
                     368071..368076,368086..368091,368104..368106,
                     368128..368130,368134..368145,368149..368151,
                     368161..368163,368173..368175,368236..368238,
                     368725..368727,368734..368736,369040..369042,
                     369046..369048,369088..369090,369292..369294,
                     369304..369306))
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(368740..368742,368749..368751,
                     368758..368760,368797..368799,368911..368916,
                     368920..368922,368998..369000))
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:143447"
     misc_feature    complement(order(368569..368571,368578..368580,
                     368680..368682,368995..368997))
                     /gene="aldH2"
                     /locus_tag="CNE_2c03400"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143447"
     gene            complement(369504..370835)
                     /locus_tag="CNE_2c03410"
                     /db_xref="GeneID:10920829"
     CDS             complement(369504..370835)
                     /locus_tag="CNE_2c03410"
                     /codon_start=1
                     /transl_table=11
                     /product="ACS family major facilitator superfamily
                     protein"
                     /protein_id="YP_004680558.1"
                     /db_xref="GI:339321664"
                     /db_xref="GeneID:10920829"
                     /translation="MQTQAANRDPLASAVSKARLRLAPFLALMFALSMLDRSNVGFVK
                     QALMVDSNIGNAAYALGAGIFFIGYAVFEIPSNLILHRVGARVWLSRIMVTWGLASAA
                     MMFAHDETSFYVLRFILGVAEAGFSPGVILYSTYWFPASQRGKALGVYYFGLPVALVL
                     GGPVSGLLLDVMGGQLGLRNWQWMFIIEGLAASVVGVIAFFYLVSKPRDAKWLNADEK
                     TSLEAAITAEDNQKTAHGPATALSALGNWQVLRFVAIYFAIQVSVYGVIFYLPTRISE
                     LTGTAIGAKVGLLTAIPWLCALVSLRLITGIADARGKQREFAMAMLAMAATGIALSTL
                     GHELVPVLMAFCLATVGFVVVQPLFWTLPTAYLSGTAAASGIALIGALGNLGGFIAPT
                     LKTAVESAFHSQQAGMLALAIAGVVGVLLLMSIGARARRASTLRLGSSEAA"
     misc_feature    complement(369600..370793)
                     /locus_tag="CNE_2c03410"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(369567..370763)
                     /locus_tag="CNE_2c03410"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(369675..369677,369684..369689,
                     369696..369701,369708..369713,369744..369746,
                     369753..369758,369768..369770,369777..369782,
                     369789..369791,369933..369935,369945..369947,
                     369954..369956,369966..369968,369978..369980,
                     370023..370025,370032..370037,370044..370049,
                     370056..370058,370362..370364,370380..370385,
                     370392..370397,370431..370433,370440..370445,
                     370452..370457,370464..370469,370605..370610,
                     370614..370619,370629..370631,370638..370643,
                     370650..370652,370701..370706,370710..370718,
                     370725..370727))
                     /locus_tag="CNE_2c03410"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(370969..372168)
                     /locus_tag="CNE_2c03420"
                     /db_xref="GeneID:10920830"
     CDS             complement(370969..372168)
                     /locus_tag="CNE_2c03420"
                     /EC_number="3.7.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase"
                     /protein_id="YP_004680559.1"
                     /db_xref="GI:339321665"
                     /db_xref="GeneID:10920830"
                     /translation="MALPLTLSATQTLPADGLAGTLVGRAWIPAGDGVPAGPAVVVLR
                     PDGVFDISDVAPTMSTLLEQDDPLTVVHNAPGRWIGKLDDLLANTADPHGSNGVARLL
                     APCDLQVIKAAGVTFAGSLVERVIEEQTKGDPQGAAEVRNRIQALVGERLSRIRPGSR
                     EAGELKALLIEHGMWSQYLEVGIGPDAEIFTKAPLLSALGTGTEIGLHPGSAWNNPEP
                     EIVLAINSRGDVLGATLGNDVNLRDFEGRSALLLGKAKDNNGSCAIGPFLRLFDQSFS
                     LDDVRRATVDLRVDGLDGFVLSGTSSMDQITRDPLELAEQAMGATHQYPDGAMLFLGT
                     LFAPVEDRDTAGGGFTHKGGDLVTISSRQLGSLVNRVGRSDRIAPWTFGVRALMANLA
                     ARGHTTF"
     misc_feature    complement(370984..372150)
                     /locus_tag="CNE_2c03420"
                     /note="Fumarylacetoacetate (FAA) hydrolase family protein
                     [General function prediction only]; Region: COG3970"
                     /db_xref="CDD:226479"
     misc_feature    complement(371056..371658)
                     /locus_tag="CNE_2c03420"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            372319..373257
                     /locus_tag="CNE_2c03430"
                     /db_xref="GeneID:10920831"
     CDS             372319..373257
                     /locus_tag="CNE_2c03430"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680560.1"
                     /db_xref="GI:339321666"
                     /db_xref="GeneID:10920831"
                     /translation="MARQTASAPSAVLAKLRFRHLQLLDVLGRSRNLRIAAEQLHITQ
                     PAATKILSDIEDTLQARLFDRLPRDMRPTELGEFALRYASTALAELGKFVSELEALRA
                     GGHGHLTVGAISASAAQVVTTAIREILQQRPRLVVKLIEQSSDQLAVWLEDRKLDIMV
                     GRLTEPRHQAIFDFEALSPEPVWVVCRPGHPLLDRPRLEIADIGAWPWILYPQLTAIR
                     QLFDETIAAAGIQGLVGMVETPSIFSTLELLQATDMLSLQPRAVVERFVAERMLSHVP
                     VPIRRAMSSYGIVTRKNELPSEAMLQFMAALRAAAR"
     misc_feature    372361..373254
                     /locus_tag="CNE_2c03430"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    372370..372549
                     /locus_tag="CNE_2c03430"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    372637..373239
                     /locus_tag="CNE_2c03430"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(372682..372687,372691..372696,372703..372705,
                     372715..372717,372721..372741,373024..373041,
                     373057..373062,373066..373071)
                     /locus_tag="CNE_2c03430"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(373237..373866)
                     /locus_tag="CNE_2c03440"
                     /db_xref="GeneID:10920832"
     CDS             complement(373237..373866)
                     /locus_tag="CNE_2c03440"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b oxidoreductase protein"
                     /protein_id="YP_004680561.1"
                     /db_xref="GI:339321667"
                     /db_xref="GeneID:10920832"
                     /translation="MKPSRQSVQIWDPIVRFTHWAVAALVLWDLYEDSGGPLHRNLGY
                     AAACLVLVRVAWSMVGNGAGNIREWLPGRGGVVAYVKAAIAGRPPRHLGHNPLGALMM
                     LVLWILILSLAATGWMSRLDMFWGEDWPKELHGILADALLALVSVHVVAAILMSRLHR
                     ENLILSMVTGRKPAAPDQRKPSAGDGEPASSSDPPAISDPRAVSPGRRP"
     misc_feature    complement(373351..373857)
                     /locus_tag="CNE_2c03440"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            complement(373892..374191)
                     /locus_tag="CNE_2c03450"
                     /db_xref="GeneID:10920833"
     CDS             complement(373892..374191)
                     /locus_tag="CNE_2c03450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680562.1"
                     /db_xref="GI:339321668"
                     /db_xref="GeneID:10920833"
                     /translation="MLIAPTIRRRLMLRIGALMAMILVSGSALASAKCPAHPKSDWMK
                     ESDARAKIEAQGYNIKKFKVDGNCYEIYGTTKEGKKAEIYFDTKTLDIVKAEIEK"
     misc_feature    complement(373895..374152)
                     /locus_tag="CNE_2c03450"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; cl17877"
                     /db_xref="CDD:266904"
     gene            complement(374432..375055)
                     /locus_tag="CNE_2c03460"
                     /db_xref="GeneID:10920834"
     CDS             complement(374432..375055)
                     /locus_tag="CNE_2c03460"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004680563.1"
                     /db_xref="GI:339321669"
                     /db_xref="GeneID:10920834"
                     /translation="MWCQYDRFGWFPCMEGTVRMRVSPQARKKCPALPEFWQARAIRT
                     IDARGRSRILLTSLFDRRRFKPADIVACYERRWQIETSYRELKQSMLGMELTLRSRTV
                     DGVCQEIWGALIAYNLIRREMASAAREAKLAPTDMSFVRAFHVIQHEMMWAAVTPAYA
                     KLPACLRRLRERLKSLPNVKRPGRSCDRVVKSRPSRYAVRFLNRDLN"
     misc_feature    complement(374702..>374974)
                     /locus_tag="CNE_2c03460"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(374633..>374947)
                     /locus_tag="CNE_2c03460"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     gene            376204..376794
                     /locus_tag="CNE_2c03470"
                     /db_xref="GeneID:10920835"
     CDS             376204..376794
                     /locus_tag="CNE_2c03470"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004680564.1"
                     /db_xref="GI:339321670"
                     /db_xref="GeneID:10920835"
                     /translation="MTDDPGVVAPNRLLALMLVAQLRTVLAAIDVFDKEIARIARTLP
                     DFDLFDSLPGAGPHLTPRLLAAFGEQRDRYNGAEELQKYSGIAPVTERSGKKRWVHWR
                     WQCPTFLRQTFVEWAGQTINKSSWAGAYYRQQRAKGSSYQAAVRALAFKWIRILYRCW
                     QTGTRYDEELYLNALKRRGSPLIGHLEARPDTKLNR"
     misc_feature    376342..376599
                     /locus_tag="CNE_2c03470"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(377032..377997)
                     /locus_tag="CNE_2c03480"
                     /db_xref="GeneID:10920836"
     CDS             complement(377032..377997)
                     /locus_tag="CNE_2c03480"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680565.1"
                     /db_xref="GI:339321671"
                     /db_xref="GeneID:10920836"
                     /translation="MPDRLTALALETLGRMRSRLKARQLNLLVALSEYGSLSRVAQEW
                     GVTQPYLTQMLAEIESMMGTALFTRQRGGVTPTPVGRIAISRASRLLVDLQDWANDMA
                     AARLGFTERLSIGVIHYLSGQLLCDTLSHTREQVGPFVFSVEEASSDRLLALLREHRL
                     EGVVARARGAAQARDLRCDILFRQRPALVCHLKTAKHLGKRALDWHELATMDWVLPPA
                     GTALGASVLDLFLHVGEEPPVPAIETHSLKIVGRMIERNPSMVAIVPADVAHDLSTRA
                     HVASVPCDLEWPLPPVALYRRQGAGDSPTMATFVRTLKTLCKARF"
     misc_feature    complement(377041..377946)
                     /locus_tag="CNE_2c03480"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    complement(377755..377931)
                     /locus_tag="CNE_2c03480"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(377059..377577)
                     /locus_tag="CNE_2c03480"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(377230..377235,377239..377244,
                     377260..377277,377563..377577))
                     /locus_tag="CNE_2c03480"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            378115..379095
                     /gene="acmD"
                     /locus_tag="CNE_2c03490"
                     /db_xref="GeneID:10920837"
     CDS             378115..379095
                     /gene="acmD"
                     /locus_tag="CNE_2c03490"
                     /EC_number="4.1.1.45"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-carboxymuconate-6-semialdehyde
                     decarboxylase"
                     /protein_id="YP_004680566.1"
                     /db_xref="GI:339321672"
                     /db_xref="GeneID:10920837"
                     /translation="MPVIDVHTHIFTKPWLELLKRKGGLYNIQQRPDGQHEVFRGDTP
                     VVIPQKGHFDYDLRIQHMDAAGIDISVMSLTCPNVFWGDEETSCEAARESNDSLAQAQ
                     AAHPSRLRWFTSLPWEYPQRALDELKRTCDNGASGVMVLANIAGRSLTDPAFAPIWAE
                     IDRRALPVLVHPTDPPGADLMDMTKFDLSWSVGFMFDTTLAITRMIFEGFFDQYPNLK
                     IIASHAGGALPYLAGRFEKGHEVEIPQRRKMQRTPIDYLRHIHYDCISYSPASLEFLI
                     SVVGADRVMFGTDWPHQVHDTCGSFANTERLSAAQRDAVRSGNAKRVFGF"
     misc_feature    378124..379092
                     /gene="acmD"
                     /locus_tag="CNE_2c03490"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            379128..380093
                     /locus_tag="CNE_2c03500"
                     /db_xref="GeneID:10920838"
     CDS             379128..380093
                     /locus_tag="CNE_2c03500"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680567.1"
                     /db_xref="GI:339321673"
                     /db_xref="GeneID:10920838"
                     /translation="MMKRRVFNWVATMALAAVLPMGALAQDKPPLKLLVGFAPGGSVD
                     VVARLLAERLRLPLGQQVVVENKPGAGGRLVLGEVKRAPADGNTLVISPSGALVISPW
                     LYNLNYDPVKDFTPVARVVTFDFAVTAGPVAPSGDIRAVLNWLKANPARANYGTSGAG
                     TVPHFAGVLLSQASGVPLTHVAYKGGAPAVSDLLGGQIPIMVDTISETIEHHRAGRLR
                     ILAVTGNARSPALPDVPTLKESGIDATAEAFVGLFAPAGLPADKVKRLSDAIAEVLKA
                     PDLQARVREIGLNANYAGPQQLGETQVAELRRWERPIKASGYKAE"
     misc_feature    379263..380078
                     /locus_tag="CNE_2c03500"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            380110..380277
                     /locus_tag="CNE_2c03510"
                     /db_xref="GeneID:10920839"
     CDS             380110..380277
                     /locus_tag="CNE_2c03510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680568.1"
                     /db_xref="GI:339321674"
                     /db_xref="GeneID:10920839"
                     /translation="MLQLCEREEEAARREYRSALTRDMPEEIRSVLLRQYEGMQNYHE
                     RIHAMRGMQIH"
     misc_feature    <380176..380259
                     /locus_tag="CNE_2c03510"
                     /note="Domain of unknown function (DUF2383); Region:
                     DUF2383; cl17556"
                     /db_xref="CDD:266747"
     gene            complement(380372..381325)
                     /gene="argC"
                     /locus_tag="CNE_2c03520"
                     /db_xref="GeneID:10920840"
     CDS             complement(380372..381325)
                     /gene="argC"
                     /locus_tag="CNE_2c03520"
                     /EC_number="1.2.1.38"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase
                     ArgC"
                     /protein_id="YP_004680569.1"
                     /db_xref="GI:339321675"
                     /db_xref="GeneID:10920840"
                     /translation="MRYPLVFIDGDQGTTGLQIHERLRGRDDLRLLTLPAGQRKDARA
                     RADAINGCDIAILCLPDSAAREAVTSIVNPAVRVIDASSAHRTQPGWTYGFPEMAAGQ
                     AQRIAGALRVSNPGCYPTGAIGLLRPLVEAGLLPHDYPLAIHAVSGYSGGGRTAVDTY
                     EGPQATRALPFQVYGLGLAHKHTPEIQQHAGLARRPAFVPAYGAFRQGIVLTVALELD
                     LLASGTDVGRLHACLLDHYAGARHVEVMPLAESAAATHLDPQALNGTNALRLGVFANR
                     EHGQALLAAVFDNLGKGASGAAVQNLDLMLAGVAAEVRRAA"
     misc_feature    complement(380405..381316)
                     /gene="argC"
                     /locus_tag="CNE_2c03520"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Provisional; Region: PRK11863"
                     /db_xref="CDD:237004"
     misc_feature    complement(381032..381310)
                     /gene="argC"
                     /locus_tag="CNE_2c03520"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     gene            381527..382411
                     /locus_tag="CNE_2c03530"
                     /db_xref="GeneID:10920841"
     CDS             381527..382411
                     /locus_tag="CNE_2c03530"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680570.1"
                     /db_xref="GI:339321676"
                     /db_xref="GeneID:10920841"
                     /translation="MREISLDRLRTLVAIADLGSFAEAARALHLAPPTVSLHIAELEA
                     RVGAVLLTRRRGEVRPSSIGETLVDRARRLLADADLALDDVQRQVQGLTGRVRLGAST
                     GAIAHLLPQALAMLAERHPDIDVQVAVLTSQETLARLAAGTLEVGLVALPQARVAGLT
                     IRPWRRDPVRAFLPASWPCPARITPAWLATRPLILNDGTTRLSRLTAEWFASGGHRPA
                     PRIQLNYNDAIKSLVAAGYGAALLPHEVTTPAPDARVVMRPLRPALWRRLGLAHSGER
                     VERATEYVLEALWALRAG"
     misc_feature    381536..382405
                     /locus_tag="CNE_2c03530"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    381542..381721
                     /locus_tag="CNE_2c03530"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    381809..382390
                     /locus_tag="CNE_2c03530"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(381854..381859,381863..381868,381875..381877,
                     381887..381889,381893..381913,382184..382201,
                     382217..382222,382226..382231)
                     /locus_tag="CNE_2c03530"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(382475..383560)
                     /locus_tag="CNE_2c03540"
                     /db_xref="GeneID:10920842"
     CDS             complement(382475..383560)
                     /locus_tag="CNE_2c03540"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004680571.1"
                     /db_xref="GI:339321677"
                     /db_xref="GeneID:10920842"
                     /translation="MRGRPKAELLLSEAEREQLKALTMRRKTAQALALRARIVLASAE
                     GLDNKTVAAKQRVDVHTVSKWRSRFVADRLDGLLDAPRPGAPRTIADAQVDAIIAKTL
                     ESVPAGATHWSTRSMARAADLSQSTVTRIWRAFGLQPHRQETFKLSSDPLFVEKVRDI
                     VGLYLDPPLKAMVLCVDEKSQIQALDRTQPILPMAPGIPERRTHDYMRHGTTTLFAAL
                     DIATGKVIGELHRRHRSSEFLQFLRTIEANVPPKLDMHLVMDNYGTHKTASIKAWFAR
                     HPRFHVHFTPTSASWINQVERWFATITEQYIRRGTHRSTRQLEQAIRQYLDLNNANPT
                     PFVWTKSADDILASIKRFCLRISDSGH"
     misc_feature    complement(383327..383467)
                     /locus_tag="CNE_2c03540"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     misc_feature    complement(383153..383458)
                     /locus_tag="CNE_2c03540"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    complement(383165..383380)
                     /locus_tag="CNE_2c03540"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(382604..383044)
                     /locus_tag="CNE_2c03540"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            383704..383880
                     /locus_tag="CNE_2c03550"
                     /db_xref="GeneID:10920843"
     CDS             383704..383880
                     /locus_tag="CNE_2c03550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680572.1"
                     /db_xref="GI:339321678"
                     /db_xref="GeneID:10920843"
                     /translation="MSAIKRIDPGHTAYQAAPHRTTRYPAKHVTLTAGSRKRLRPSVP
                     HRKVGRGKVGVGGK"
     gene            complement(384000..384887)
                     /locus_tag="CNE_2c03560"
                     /db_xref="GeneID:10920844"
     CDS             complement(384000..384887)
                     /locus_tag="CNE_2c03560"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680573.1"
                     /db_xref="GI:339321679"
                     /db_xref="GeneID:10920844"
                     /translation="MASNLDIAALRSLIAGIDLGSFARAAEQVGRSTSAVSAQIHKLE
                     DMAGTPLFRKAGRTLELTEAGSLLLGYARRMVALNDEAAAAVRGVDLSGGVRLGLQEE
                     FGEAMLPEVLGRFARAHPKVRVEAMVARNHDLFARIQARTLDLALVWGSADGARTARE
                     PGADIAVVGEPPMCWVGPAALPWHIVPGEPIPLAAFDRPCHFHDAATAALDRAGIPWR
                     VSFTSPNLGGLWAAAAAGLGLVVRTPYGLPASLRQLGAAEGLPPLGKMPLMLLRAPGP
                     ASEVSQRLADIMLEALRPV"
     misc_feature    complement(384693..384869)
                     /locus_tag="CNE_2c03560"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(384024..384608)
                     /locus_tag="CNE_2c03560"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(384183..384188,384192..384197,
                     384213..384230,384504..384524,384528..384530,
                     384540..384542,384549..384554,384558..384563))
                     /locus_tag="CNE_2c03560"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            384996..386264
                     /locus_tag="CNE_2c03570"
                     /db_xref="GeneID:10920845"
     CDS             384996..386264
                     /locus_tag="CNE_2c03570"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004680574.1"
                     /db_xref="GI:339321680"
                     /db_xref="GeneID:10920845"
                     /translation="MAESVCFPRPGGNSLAASAASHRWKVLGVGVAANASFIAAANGL
                     PATAVWLRSAYQIDNGGLGLLLGALGIGAALSELPWGAAADRWGDRRVLLYGLGATAL
                     ILAVMALFLAPRPDRVPPLPVAMACMALLGLAGGSVNGASGRAVMRWFAEGERGLAMS
                     IRQTAVPLGGALGALVLPWLALAMGFRWVYAVLAALCFASAWLTWRWLHEPTHLASPT
                     SAQRHAHDNASPLRSLRVWCIAVAIGILCAPQFAVLSFASVFLHDAAHVGVSGIAATL
                     CAVQLGAMAMRIWSGRHTDRRGNRRVWLRHCTLIAALMFVPLALCAAVGQSVPATLTM
                     VAVVLAGIAVSAWHGVAYTELATQAGAERAGTALGLANTLVFAAYFAAPAAIPLLLDR
                     GGWAGVWLLAGACAATAWPLFPRAGDRPSN"
     misc_feature    385227..386234
                     /locus_tag="CNE_2c03570"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(385227..385229,385233..385238,385398..385403,
                     385410..385415,385422..385427,385434..385436,
                     385470..385475,385482..385487,385503..385505,
                     385734..385736,385743..385748,385755..385760,
                     385767..385769,385809..385811,385821..385823,
                     385833..385835,385842..385844,385854..385856,
                     386016..386018,386025..386030,386037..386039,
                     386049..386054,386061..386063,386094..386099,
                     386106..386111,386118..386123,386130..386132)
                     /locus_tag="CNE_2c03570"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    385227..386117
                     /locus_tag="CNE_2c03570"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            complement(386286..387275)
                     /locus_tag="CNE_2c03580"
                     /db_xref="GeneID:10920846"
     CDS             complement(386286..387275)
                     /locus_tag="CNE_2c03580"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter/malic acid
                     transporter"
                     /protein_id="YP_004680575.1"
                     /db_xref="GI:339321681"
                     /db_xref="GeneID:10920846"
                     /translation="MSTLSSTQPQALQRNASIKNLPVNLFASVMGIAGLSIAWRQASQ
                     EFGVTPLISAAAGILAIVVFLALSAGYLVKAIQHPDAVRGEFRHPVAGNFFGTITIAI
                     LLLSSVVAQLSQPLAEVIWIVGTIATIALCFTIASRLLQGKIDAAHAVPAWFIPGVAT
                     LDIAVAGGSMPMPWAHEVNMFALAVGTMIALLFFTMIMSRMIHHEPLPAGMVPSLLIL
                     MAPFEVGFLAYTNFTQRVDTFSGLLFYFGLFIFLTLAPKVFRKGIPFASGWWAISFPM
                     AALASAALKYSMFAQAWPVTVIAILLLAMLSIAIVVLLVRTLHMLINGKLLAG"
     misc_feature    complement(386325..387218)
                     /locus_tag="CNE_2c03580"
                     /note="Tellurite-resistance/Dicarboxylate Transporter
                     (TDT) family includes SLAC1 (Slow Anion Channel-Associated
                     1); Region: TDT_SLAC1_like; cd09323"
                     /db_xref="CDD:187763"
     misc_feature    complement(386454..386456)
                     /locus_tag="CNE_2c03580"
                     /note="gating phenylalanine in ion channel; other site"
                     /db_xref="CDD:187763"
     gene            387678..388298
                     /gene="gstR"
                     /locus_tag="CNE_2c03590"
                     /db_xref="GeneID:10920847"
     CDS             387678..388298
                     /gene="gstR"
                     /locus_tag="CNE_2c03590"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680576.1"
                     /db_xref="GI:339321682"
                     /db_xref="GeneID:10920847"
                     /translation="MTAPIVFGRLHLLPVVAEFLKTYPDIDVRMVLTDRVMHLLEEQV
                     DVAVRIAELPDSSFIATRIGTTRRVVCASPAYFDEHGTPTNPLELTGHACITMDQIAS
                     RQVWTFLSGKAEVEVPIRSRLVVSTAEAAIDAAVAGVGLTRVLSYQMADAIRAGAVKT
                     TLEAFEPAPWPISLVHPGQGILPLKLRAFLDFAGPRLKARLKELGV"
     misc_feature    387678..388268
                     /gene="gstR"
                     /locus_tag="CNE_2c03590"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_2; cd08471"
                     /db_xref="CDD:176160"
     misc_feature    order(387696..387698,387708..387710,387825..387827,
                     387867..387869,387873..387875,388059..388061,
                     388110..388112,388191..388193)
                     /gene="gstR"
                     /locus_tag="CNE_2c03590"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176160"
     misc_feature    order(387699..387704,387714..387719,387723..387728,
                     387735..387737,387747..387749,387753..387773,
                     387954..387956,388041..388055,388074..388079,
                     388086..388088)
                     /gene="gstR"
                     /locus_tag="CNE_2c03590"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176160"
     gene            388530..389162
                     /locus_tag="CNE_2c03600"
                     /db_xref="GeneID:10920848"
     CDS             388530..389162
                     /locus_tag="CNE_2c03600"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004680577.1"
                     /db_xref="GI:339321683"
                     /db_xref="GeneID:10920848"
                     /translation="MDEAGRMQGSIELYGALTGNCIRAAIALDEADIPYTVRRVNLAA
                     GEQRSEQHRVLNAFGKVPVLVEYRNGGNFVLTQSNAIMLFAAERSRNKLLPADPVARA
                     KVYERFFYFLTDVIAVSHCAFRLEQIGAGAHASHIHELARASLIEAEQFLTSTEFMAG
                     DTFSLADIAAFTIASTFSGNIQWPDHPALMRWFQTAAQRPAVVKGLKAFE"
     misc_feature    388560..388787
                     /locus_tag="CNE_2c03600"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     misc_feature    388566..389132
                     /locus_tag="CNE_2c03600"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    <388983..389144
                     /locus_tag="CNE_2c03600"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    order(389022..389024,389031..389036,389043..389045,
                     389055..389057)
                     /locus_tag="CNE_2c03600"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     gene            389388..389915
                     /locus_tag="CNE_2c03610"
                     /db_xref="GeneID:10920849"
     CDS             389388..389915
                     /locus_tag="CNE_2c03610"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004680578.1"
                     /db_xref="GI:339321684"
                     /db_xref="GeneID:10920849"
                     /translation="MEVAAREFRIHGIQATGLNNVMSPLGLTQGGFYRHFSSKDQLIA
                     EACSQAMTEVIDGLEAAARDSDADNGFAAVVNAYVSEHHRDTRTGGCPLAAMGSELAR
                     ADAQTRAAATQGFEELVDVLAKRMDGKSPKAARSSAVFAAAAMIGAVTMSRVVEDSDA
                     SAAILEDVKQHLGAM"
     misc_feature    389388..389912
                     /locus_tag="CNE_2c03610"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    389388..389525
                     /locus_tag="CNE_2c03610"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            389950..390831
                     /locus_tag="CNE_2c03620"
                     /db_xref="GeneID:10920850"
     CDS             389950..390831
                     /locus_tag="CNE_2c03620"
                     /codon_start=1
                     /transl_table=11
                     /product="NmrA family protein"
                     /protein_id="YP_004680579.1"
                     /db_xref="GI:339321685"
                     /db_xref="GeneID:10920850"
                     /translation="MEQRKYLITGATGKTGVYTTRFLLNAGHAVRAFVHQEDERSAAL
                     RNEGAEIFVGDLLEHDDVIRAMEGVAGAYLCYPVRPGYIQATSYFADAAKRAGVDVVI
                     EMSQISARDDSESHAARDHWIAERVLDWSGVPAVHIRPTYFSEWLTFPWVLDPLVQEG
                     KITLPYGAGRHAPIAAEDQARLIANILAEPSNHIGKTYSLFGPVELNQQEIADEIGKV
                     LGRKITYAPSTLEQYREHLEKYNLPEFVIQHFLATAVDYQNGIFSGTDGVIKEITGKA
                     PQTVAEFVEANREVFEA"
     misc_feature    389959..390774
                     /locus_tag="CNE_2c03620"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    389965..390729
                     /locus_tag="CNE_2c03620"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(389977..389979,389983..389988,389992..389994,
                     390049..390057,390172..390180,390259..390267,
                     390298..390300,390310..390312,390367..390378)
                     /locus_tag="CNE_2c03620"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(390193..390195,390265..390267,390298..390300,
                     390310..390312)
                     /locus_tag="CNE_2c03620"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(390865..392529)
                     /locus_tag="CNE_2c03630"
                     /db_xref="GeneID:10920851"
     CDS             complement(390865..392529)
                     /locus_tag="CNE_2c03630"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004680580.1"
                     /db_xref="GI:339321686"
                     /db_xref="GeneID:10920851"
                     /translation="MISVRNVTLRRGVNVVLDRASVTFNPGEKIGLVGRNGAGKSSFF
                     GLLNGTLHEDSGEFSIPAAWKMGQVAQEMPETEQSATDFVVEGDTVLLAAQAEVAAAE
                     VSDDGMRMAHAYMDLHDAGAHDAPARAQALILGLGFSAAQLSQPVNSFSGGWRMRLQL
                     ARALMCPSNLLLLDEPTNHLDLDALVWLEAWLKRYQGTLVVISHDREFLDAVTQVTVH
                     VDNAKLVRYGGNYSKFEDMRAEQLVLQQAAMAKQADKIAHLQKFIDRFKAKASKAKQA
                     QSRVKALERMEKIAPVLADAEFNFEFKEPLNVPNPLLSMLDASFGYPAPTGALPGTPP
                     TVIVRGINRSVLAGQRIGILGANGQGKSTLVKTVAHALAPIAGEISEGKGLNIGYFAQ
                     QELDVLRPLDTPMEHMIRLAKDTPAHMRAPGQSGTEQSLRTFLGTFNFSGDMVHQAVS
                     TMSGGEKARLVLCMIVWQRPNLLLLDEPTNHLDLATREALGMALNEFEGTVMLVSHDR
                     ALLRAVCDEFWLVTKGGVEPFDGDLDDYQQFLRDEARRMREQAPTQ"
     misc_feature    complement(390916..392529)
                     /locus_tag="CNE_2c03630"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    complement(391861..392526)
                     /locus_tag="CNE_2c03630"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(391630..391881)
                     /locus_tag="CNE_2c03630"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    complement(390955..391524)
                     /locus_tag="CNE_2c03630"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            392556..393293
                     /locus_tag="CNE_2c03640"
                     /db_xref="GeneID:10920852"
     CDS             392556..393293
                     /locus_tag="CNE_2c03640"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase orfB protein"
                     /protein_id="YP_004680581.1"
                     /db_xref="GI:339321687"
                     /db_xref="GeneID:10920852"
                     /translation="MIADRTCRAVSFLAARVKSRLRFAAHTGHKARQSLAHPAFRPST
                     VKSGGFCVRSSPRAIASHSAVQDFYFGPDFLLRRHDYELEVSGGLAVAQYVHDFVASG
                     FPASKERVERLMRDNGIRARHKRRYKVTTDSKHKLPVAENLLARSFTPTAPNQVLAEY
                     GMRCSMSRKGNCQDNAPTESFFNSLKNERVHATRYRTHQEAMADLFEYIEVFYSRSRR
                     HSSLGFVSPVQFLQNWLKAQQTEDAAA"
     misc_feature    <392859..392936
                     /locus_tag="CNE_2c03640"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    <392910..393119
                     /locus_tag="CNE_2c03640"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    393033..393236
                     /locus_tag="CNE_2c03640"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            393536..393997
                     /locus_tag="CNE_2c03650"
                     /db_xref="GeneID:10920853"
     CDS             393536..393997
                     /locus_tag="CNE_2c03650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680582.1"
                     /db_xref="GI:339321688"
                     /db_xref="GeneID:10920853"
                     /translation="MRSNLKYLSTAAIAATFCIGASAQTAQDAVRPPAILPLSGEPAP
                     KLIAYPALAEPLARGVVIVQFRTENFRVMPVFGKPAVDISPRIGHLHVTVDDVRGTWA
                     HTSEDPIIVVGLTPGPHKLRLELADPSHKILATEVVAVTVPDLRVSKPHEH"
     gene            complement(394309..395889)
                     /gene="nylA"
                     /locus_tag="CNE_2c03660"
                     /db_xref="GeneID:10920854"
     CDS             complement(394309..395889)
                     /gene="nylA"
                     /locus_tag="CNE_2c03660"
                     /EC_number="3.5.2.12"
                     /codon_start=1
                     /transl_table=11
                     /product="6-aminohexanoate-cyclic-dimer hydrolase NylA"
                     /protein_id="YP_004680583.1"
                     /db_xref="GI:339321689"
                     /db_xref="GeneID:10920854"
                     /translation="MRDKRLSLPAVRPDRCAALAMRALPMSLNENVHMKLAEYTALDG
                     MGLHHLIATREVTAMEVAQAALAAIEAVNPQVNAVLDYWPEEVEIQSAGIVSADPRPL
                     GGVPFLLKDLGVTMQGRRSEMCSRLAMGTVAKEDSYVMTSFRQAGLITLGRTAMPELA
                     VSTTTEPVLYGPTRNPWSLQHGAGGSSGGAGAAVAAGIVPIAHATDGGGSIRVPASCN
                     GLFGLKPTRGRVSNGPHVDEVWNGLGVHFAVSRTVRDSAALLDGIHGGGVGEPYYIAP
                     PKDSYLSEIRQQPGNLKIGFMMNPFSAARADTGVADALSKVARTLESLGHHVHEVAPD
                     LGVSWDAFVQCNAKIWAANAALRINGIAAATGRTVDEKHLEPATLALYRYGIEIGAVE
                     LLSALQVRNTVTRALGRFFGDYDILLTPTLPGLPPRIGEYNRVETSVDGLGWIAHVFS
                     QSPFTALSNVTGTPAMSVPLSIDPQADLPIGSHFMSGFGREDTLFRLAAQLEAACPWR
                     ERRPPVWAGSIVNKTSKQ"
     misc_feature    complement(394366..395766)
                     /gene="nylA"
                     /locus_tag="CNE_2c03660"
                     /note="GGCT-like domains, also called AIG2-like family.
                     Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
                     formation of pyroglutamic acid (5-oxoproline) from
                     dipeptides containing gamma-glutamyl, and is a dimeric
                     protein. In Homo sapiens, the protein is...; Region:
                     GGCT_like; cl18951"
                     /db_xref="CDD:267304"
     gene            complement(395952..397295)
                     /gene="ttuB2"
                     /locus_tag="CNE_2c03670"
                     /db_xref="GeneID:10920855"
     CDS             complement(395952..397295)
                     /gene="ttuB2"
                     /locus_tag="CNE_2c03670"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate transporter TtuB"
                     /protein_id="YP_004680584.1"
                     /db_xref="GI:339321690"
                     /db_xref="GeneID:10920855"
                     /translation="MSQKDQISGSRRDGASLYRKVDIRLLPLLFIGFMFAYLDRVNVG
                     FAKLQMQSDLGFSDAAYGIGAGIFFVGYVLFEVPSNLLLPRVGARLTFSRIMVLWGIT
                     SMCMVFVNSVPVFYALRFLLGVFEAGFAPGVLFYLSRWYGSSRIAGAISIVWLAGPFS
                     GIVGGPLSAWIMTAFAGTASLAGWQWMFLIEGAPTLVLGVAAYFLLVDDPSNAKWLND
                     TEKRALAAETNTAADRRHESFLMVLRDPKVYVLAVAYLCIIAPIYALSFWLPTIIKSA
                     GVTSTQTLGWYAAIPYVAAAFAIFFGGRSSDRRQERRIHIALPAAISSLCFIGWYLAD
                     GNLAVTLVCVSVATGLMWMANIVFWAVPPAYIKGNARAGAIALINTIGLSGGFFGPSI
                     IGWSKSVTGSIYPGFLLMAAMLLMCAFIILFLRLKPGGDTALRHESLPASVGQAK"
     misc_feature    complement(396048..397226)
                     /gene="ttuB2"
                     /locus_tag="CNE_2c03670"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(396021..397220)
                     /gene="ttuB2"
                     /locus_tag="CNE_2c03670"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(396138..396140,396147..396152,
                     396159..396164,396171..396176,396207..396209,
                     396216..396221,396231..396233,396240..396245,
                     396252..396254,396399..396401,396411..396413,
                     396420..396422,396432..396434,396444..396446,
                     396486..396488,396495..396500,396507..396512,
                     396519..396521,396813..396815,396831..396836,
                     396843..396848,396882..396884,396891..396896,
                     396903..396908,396915..396920,397056..397061,
                     397065..397070,397080..397082,397089..397094,
                     397101..397103,397152..397157,397161..397169,
                     397176..397178))
                     /gene="ttuB2"
                     /locus_tag="CNE_2c03670"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(397487..398761)
                     /locus_tag="CNE_2c03680"
                     /db_xref="GeneID:10920856"
     CDS             complement(397487..398761)
                     /locus_tag="CNE_2c03680"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase or
                     succinyl-diaminopimelate desuccinylase"
                     /protein_id="YP_004680585.1"
                     /db_xref="GI:339321691"
                     /db_xref="GeneID:10920856"
                     /translation="MNAPTPSSSLTPVGPRINSPRLWEHVNAMARIGATAKGGVNRQA
                     LTAEDTQGKMLLLQWASRRGYQTSIDPIGNLFIRRPGRNPGLSPVLTGSHLDSQPTGG
                     RFDGVYGVLAGFEVLETLDDHGMETERPIELVVWMNEEGSRFPPPTMGSAVAAGALPL
                     TDALAIKDVNGIDVESALTAQVAELPVLEKRPLGMSGFAYIEAHIEQGPVLENQACDV
                     GIVTGIQGLHAYEIQLLGAEAHAGTTPLRHRKDALVAATTLIGCLRAAINDPEDILRF
                     TVGRLEVYPGSPNTVPGRVTFNIDLRHPDPDSLLRAGETILQLCSGEIEGCPVSAKVL
                     LRSTPITFDDRVVATVRKAAGGRAMKFLNIVSGATHDAKYTAQHIPTGMIFVPCEKGI
                     SHNEAENAREVDVAAGAQVLCDAMLAIMSEPL"
     misc_feature    complement(397508..398719)
                     /locus_tag="CNE_2c03680"
                     /note="allantoate amidohydrolase; Reviewed; Region:
                     PRK12893"
                     /db_xref="CDD:237250"
     misc_feature    complement(397511..398698)
                     /locus_tag="CNE_2c03680"
                     /note="M20 Peptidase beta-alanine synthase, an
                     amidohydrolase; Region: M20_bAS; cd03884"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(397580..397582,397655..397660,
                     397856..397858,398075..398077,398081..398083,
                     398141..398143,398150..398152,398321..398323,
                     398342..398347,398444..398449,398480..398482))
                     /locus_tag="CNE_2c03680"
                     /note="active site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(397580..397582,398150..398152,
                     398342..398347,398447..398449,398480..398482))
                     /locus_tag="CNE_2c03680"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(397661..397663,397856..397858,
                     397862..397864,397886..397897,397901..397906,
                     397916..397939,397958..397963,397967..397972,
                     397976..397984,397988..397996,398000..398005,
                     398015..398017,398024..398026,398030..398044,
                     398075..398077,398120..398125,398132..398143))
                     /locus_tag="CNE_2c03680"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193505"
     gene            complement(398876..399397)
                     /locus_tag="CNE_2c03690"
                     /db_xref="GeneID:10920857"
     CDS             complement(398876..399397)
                     /locus_tag="CNE_2c03690"
                     /EC_number="3.1.-.-"
                     /note="endoribonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation inhibitor YjgF-family"
                     /protein_id="YP_004680586.1"
                     /db_xref="GI:339321692"
                     /db_xref="GeneID:10920857"
                     /translation="MTRDDSPWRQPYCPPSTNIMQSHDIHQRLKALDIELSPAGAPAA
                     AYVMSAQSGNLVYLSGHIAKKNGNVWVGKLGATMSTDEGRAAARAVAIDLLSTLQAHT
                     GDLNRVKRIVKVMSLVNSTPDFTGQHLVTNGASELFVDVFGDAGKHARSAFGVAQIPL
                     GACVEIEVCVELD"
     misc_feature    complement(398885..399307)
                     /locus_tag="CNE_2c03690"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_1; cd02199"
                     /db_xref="CDD:100006"
     misc_feature    complement(order(398891..398893,398897..398899,
                     398903..398905,398933..398959,398981..398983,
                     398993..398995,399002..399004,399047..399049,
                     399053..399055,399059..399064,399068..399070,
                     399218..399223,399227..399229,399233..399235,
                     399242..399244,399248..399250,399257..399262))
                     /locus_tag="CNE_2c03690"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100006"
     misc_feature    complement(order(398903..398905,398948..398950,
                     399002..399004,399014..399016,399260..399262))
                     /locus_tag="CNE_2c03690"
                     /note="putative active site [active]"
                     /db_xref="CDD:100006"
     gene            complement(399418..400167)
                     /locus_tag="CNE_2c03700"
                     /db_xref="GeneID:10920858"
     CDS             complement(399418..400167)
                     /locus_tag="CNE_2c03700"
                     /EC_number="3.5.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="creatinine amidohydrolase"
                     /protein_id="YP_004680587.1"
                     /db_xref="GI:339321693"
                     /db_xref="GeneID:10920858"
                     /translation="MLLHLSTWSEIEQFLKRSRTIVVPIGSNEQHGPTGLLGTDWLCP
                     EIIAREAEKSADILVAPTFNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVVHGFE
                     KILFLNGHGGNVSSIDAAFSELYAEASFARRRAGFALKLCNWWDLAGVGELARDQFPT
                     GHGAHATPSEIAITQYAFPDSIKSADYAPPIAPTGPIREALDFRARFPDGRIGSDPGL
                     ATREKGRALVELAAQSLARELEAFGREPMPD"
     misc_feature    complement(399448..400119)
                     /locus_tag="CNE_2c03700"
                     /note="Creatinine amidohydrolase; Region: Creatininase;
                     pfam02633"
                     /db_xref="CDD:251436"
     gene            complement(400180..401466)
                     /locus_tag="CNE_2c03710"
                     /db_xref="GeneID:10920859"
     CDS             complement(400180..401466)
                     /locus_tag="CNE_2c03710"
                     /codon_start=1
                     /transl_table=11
                     /product="ACS family major facilitator superfamily
                     protein"
                     /protein_id="YP_004680588.1"
                     /db_xref="GI:339321694"
                     /db_xref="GeneID:10920859"
                     /translation="MLVISSESAVDDTPTLYNKINWRLLPFLLICYLFAYLDRVNIGF
                     AKLQMQGDLGFSDAAYGVGAGIFFIGYVLFEIPSNLMLPRIGARKTFSRILVLWGITS
                     ACMLFVRNVPMFYAMRFLLGIFEAGFAPGMIYYLSCWYGPQRMARAIAIVFLAGPLGG
                     IVGGPVSAWLITALSGTGGLAGWQWMFLVEGLPCILLGVLALYFVPNRPADAAWLTEQ
                     EKRLLANEIGSSAAHNHSFLAVARDVRVYVLALAYFCIIAAIYAISFWLPTFIKAQGV
                     NDTVQLGWYSALPYVAAAFGMYYMGRRSDRVGERRFHSAVPATVGGLLLAASILVDGN
                     LAASLVLLTLGTCALWMAYTVFWAMPSEYIKGPAAAGGIALINTIGLSGGFWGPAIIG
                     WAKTATGNLHLGVLILSALPIIAALIILANKLPAKR"
     misc_feature    complement(400225..401415)
                     /locus_tag="CNE_2c03710"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(400207..401394)
                     /locus_tag="CNE_2c03710"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(400315..400317,400324..400329,
                     400336..400341,400348..400353,400384..400386,
                     400393..400398,400408..400410,400417..400422,
                     400429..400431,400576..400578,400588..400590,
                     400597..400599,400609..400611,400621..400623,
                     400663..400665,400672..400677,400684..400689,
                     400696..400698,400987..400989,401005..401010,
                     401017..401022,401056..401058,401065..401070,
                     401077..401082,401089..401094,401230..401235,
                     401239..401244,401254..401256,401263..401268,
                     401275..401277,401326..401331,401335..401343,
                     401350..401352))
                     /locus_tag="CNE_2c03710"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            401627..402589
                     /locus_tag="CNE_2c03720"
                     /db_xref="GeneID:10920860"
     CDS             401627..402589
                     /locus_tag="CNE_2c03720"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680589.1"
                     /db_xref="GI:339321695"
                     /db_xref="GeneID:10920860"
                     /translation="MREINQQRLRYFREVLEQGTIRGAAESLNTSPSVITRQIRLLED
                     ELGTTLFERQARGVRPTEAAAHLLEFWHGYRSHQEKLEDQLHALKGLQQGQVQLVLSE
                     GYVDALVNEVLAPFCAQYPLLDVSMEILGVDQVLDAVAESRAHIGLAFNPPPHPRIEY
                     LASSSQPVGLLVRPDHPLALRGGAASVKDILSWPLAMMPASFGVGHAAKMLEFAENIR
                     IRPTLVTNSLTALKQFVAYENYMTLIGGEFAAYREIAAGMLTVVPIDHPLFRGTQARL
                     LVKAGRPLPAAALKLLEHILRDMPMFAQGGHRLLSAHGKSDGYG"
     misc_feature    401645..402517
                     /locus_tag="CNE_2c03720"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    401645..401818
                     /locus_tag="CNE_2c03720"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    401909..402511
                     /locus_tag="CNE_2c03720"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(401954..401959,401963..401968,401975..401977,
                     401987..401989,401993..402013,402290..402307,
                     402323..402328,402332..402337)
                     /locus_tag="CNE_2c03720"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            402928..404067
                     /locus_tag="CNE_2c03730"
                     /db_xref="GeneID:10920861"
     CDS             402928..404067
                     /locus_tag="CNE_2c03730"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="YP_004680590.1"
                     /db_xref="GI:339321696"
                     /db_xref="GeneID:10920861"
                     /translation="MPTYRWQRQIRTNTLAPAIHYSRNTNPFFNAAYATETRRVGLGA
                     CRSSKMVKDMTMKTTVRSALRFTGAAGPAAALVATLLIGNAHAATPNTTPEIGFVQVN
                     PDIKLRRLVVHNARAKGTVLFLHGFPETLYAWKDVASSLGQDYEVHAFDWPGYGESSR
                     PGVDKFSYAPRDYAKVLVDYISTTGIDKQRLVIYATDIGALPALMAAVNEPAIARRII
                     VGDFAPFNRPQFMQERLQGLKDPATADAVHAAFNRTRDEILQNAFTRGLPESSHYEVS
                     PEFKADMARGWQNGELTSADAFYQYYTRFTRDQDDFEANLAKLKTHVTVIWGEKDIYI
                     RKEMGEELASRAHLNLKLLPGIGHYPHLQDKAATISEVRAAFDAE"
     misc_feature    403246..>403401
                     /locus_tag="CNE_2c03730"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    403288..404034
                     /locus_tag="CNE_2c03730"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            404112..404576
                     /locus_tag="CNE_2c03740"
                     /db_xref="GeneID:10920862"
     CDS             404112..404576
                     /locus_tag="CNE_2c03740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680591.1"
                     /db_xref="GI:339321697"
                     /db_xref="GeneID:10920862"
                     /translation="MQPAGPARIACSLRKTIKESEMNIVRITMGALVVASLAAHLHSA
                     QAQTPEVHRTDLASHDLSVPGREGIQVRVDFDRGAFAPKHSHPGEEIAHVLQGTLEYR
                     LADQQPVRLNAGESLFIPAGTPHSARNVGTGQASELATYIVTKGAPLVVPGK"
     misc_feature    404190..404573
                     /locus_tag="CNE_2c03740"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(404703..405209)
                     /locus_tag="CNE_2c03750"
                     /db_xref="GeneID:10920863"
     CDS             complement(404703..405209)
                     /locus_tag="CNE_2c03750"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004680592.1"
                     /db_xref="GI:339321698"
                     /db_xref="GeneID:10920863"
                     /translation="MIALMHRKTFTGMNCSVAGALEQIGEWWSLLIVRECTLGTTRFD
                     DFQQRLGIARNVLTTRLNTLLEHGVLVKVVAEGSERRTEYRLTEKGEALYPIIVGLMQ
                     WGDEWCSSRKPIRLVEDSTGKPVEPVSLRVGPRTLGLRDVRLEAGEGATAQTAEIIDA
                     RNKAILGK"
     misc_feature    complement(404889..405197)
                     /locus_tag="CNE_2c03750"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     misc_feature    complement(<404904..405140)
                     /locus_tag="CNE_2c03750"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     gene            405332..406525
                     /gene="pbuE"
                     /locus_tag="CNE_2c03760"
                     /db_xref="GeneID:10920864"
     CDS             405332..406525
                     /gene="pbuE"
                     /locus_tag="CNE_2c03760"
                     /codon_start=1
                     /transl_table=11
                     /product="purine efflux pump PbuE"
                     /protein_id="YP_004680593.1"
                     /db_xref="GI:339321699"
                     /db_xref="GeneID:10920864"
                     /translation="MDRRLIVLASGMFAIGTDSFVVAGVLSQVSASLGVSVALAGQMV
                     TLYAMSYALLSPVIAAAAAHWPRKRLLLAGLAVFVVGNVVTALAPNIELVLASRLIAG
                     LGAAMFSPTATATGASLVPPEQRGRALAIVIGGLSSATALGAPLGTFIGGALDWRATM
                     WFVAAVGTLAGLGVAWRLPEIPTPPAISLSRRLAPLADTRVLLTLLTTWMVYAGLFLV
                     YTYIALSFDRATGGDSRVLAALLLLWGVAATAGNLAAGRLTDRYGSRRIINVAIAALV
                     IDFALLPLTSASLASAVPALIVWGVCGWGVLVPQQHRLISITPAAAPLLLGLNSAAIY
                     IGVSMSGVIGGAAIAWFDRHALGLVGAVFLVVALFVAEWARQRIARPEVRPTGVGGAT
                     SGSAR"
     misc_feature    405332..406477
                     /gene="pbuE"
                     /locus_tag="CNE_2c03760"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    405344..406444
                     /gene="pbuE"
                     /locus_tag="CNE_2c03760"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(405386..405388,405395..405403,405407..405412,
                     405461..405463,405470..405475,405482..405484,
                     405494..405499,405503..405508,405644..405649,
                     405656..405661,405668..405673,405680..405682,
                     405716..405721,405728..405733,405749..405751,
                     405965..405967,405974..405979,405986..405991,
                     405998..406000,406040..406042,406052..406054,
                     406064..406066,406073..406075,406085..406087,
                     406229..406231,406238..406243,406250..406252,
                     406262..406267,406274..406276,406304..406309,
                     406316..406321,406328..406333,406340..406342)
                     /gene="pbuE"
                     /locus_tag="CNE_2c03760"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            406580..407818
                     /gene="bepF"
                     /locus_tag="CNE_2c03770"
                     /db_xref="GeneID:10920865"
     CDS             406580..407818
                     /gene="bepF"
                     /locus_tag="CNE_2c03770"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux pump periplasmic linker BepF"
                     /protein_id="YP_004680594.1"
                     /db_xref="GI:339321700"
                     /db_xref="GeneID:10920865"
                     /translation="MNQSMDWAAEHGRQKSRAARRRWLLAGAVLVVTTGTLVATMALK
                     DTRAATAPAASAPEVLVKTLAPENVRVWANFSGRLNAVDEALVRPEVGGKIVEVRVRD
                     GQTVKAGDVMFVIDPRPYEAAVARARAELASTRARAEFAAAERERAKGLIDAEAIPLS
                     LHDQRTNEDRMAKAAVLAAEAALRQAEINLDYAYVKAPIAGRISRAEVTLGNLVQPGA
                     NAPVLTRIVSNDGIYADFDVDEQAYVQSIRRHAETQNKEQHIPVEMRVQGDMERIYQG
                     VIYTIDNKIDTRSGTIRARAKFENRDRALVPGMFVSIGLAGSGDTSALVVPDVAVGSD
                     QSKKFVYVVGQDNKVAYREVALGTGLDGRHVVASGLKPGERVIARGLQFAKPDATVTP
                     KELAEDEVKTAASTAPRGAE"
     misc_feature    406754..407755
                     /gene="bepF"
                     /locus_tag="CNE_2c03770"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    406838..>406939
                     /gene="bepF"
                     /locus_tag="CNE_2c03770"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    407162..407503
                     /gene="bepF"
                     /locus_tag="CNE_2c03770"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            407823..408707
                     /gene="bepG"
                     /locus_tag="CNE_2c03780"
                     /db_xref="GeneID:10920866"
     CDS             407823..408707
                     /gene="bepG"
                     /locus_tag="CNE_2c03780"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux pump membrane transporter BepG"
                     /protein_id="YP_004680595.1"
                     /db_xref="GI:339321701"
                     /db_xref="GeneID:10920866"
                     /translation="MNLSKFFVDRPNFAAVISILIFLAGVLAIPKLPISEYPEVVPPS
                     VVVRAQFPGANPKVIAETVATPLEEQINGVENMLYMSSQAASDGVLTLTVTFKLGTDP
                     DLAARLVQNRVNEALPRLPEVTRQLGVSTVKSSLDLTMVVRLISPSDRYDNLYLRNYA
                     LLNVKDELSRIPGIGQIKLYGSGNYAMRVWLNPQEIAERNMTPDEVVAAIRKQNIQVA
                     AGVVGGPPYKDNVEIQLPVNVQGRLADLDQFENIIVKREGGVVTYLRDVARVEMGASE
                     YALRALLDNQQALALVIF"
     misc_feature    407829..>408701
                     /gene="bepG"
                     /locus_tag="CNE_2c03780"
                     /note="The (Largely Gram-negative Bacterial)
                     Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
                     2A0602; TIGR00915"
                     /db_xref="CDD:233182"
     gene            408756..408965
                     /locus_tag="CNE_2c03790"
                     /db_xref="GeneID:10920867"
     CDS             408756..408965
                     /locus_tag="CNE_2c03790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680596.1"
                     /db_xref="GI:339321702"
                     /db_xref="GeneID:10920867"
                     /translation="MAELNKHFPDGLEYRIAYDPTTFVHDSIKAVIHTLLEAIVLVVI
                     VFLQTWRAGHPPTPPDRRRRQSRAS"
     misc_feature    <408756..>408911
                     /locus_tag="CNE_2c03790"
                     /note="The (Largely Gram-negative Bacterial)
                     Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
                     2A0602; TIGR00915"
                     /db_xref="CDD:233182"
     gene            408986..409567
                     /gene="acrD"
                     /locus_tag="CNE_2c03800"
                     /db_xref="GeneID:10920868"
     CDS             408986..409567
                     /gene="acrD"
                     /locus_tag="CNE_2c03800"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside efflux pump"
                     /protein_id="YP_004680597.1"
                     /db_xref="GI:339321703"
                     /db_xref="GeneID:10920868"
                     /translation="MAFEWTELAYQQILAGNTALIVFPICILLVFLVLTAQYESPFVP
                     LAIILIVPMCLFSAIAGVWLTGGENNLFTQIGFFVLIGLACKNAILICEFARELEMQG
                     KDTLAAAIEAAHLRLRPILMTSIAFIMGVLPLVLSHGAGAEIRHAMGVAVFFGMIGVT
                     FFGLFLTPVLYVLIRNLEKRITRKERVQKHVEA"
     misc_feature    <408992..409510
                     /gene="acrD"
                     /locus_tag="CNE_2c03800"
                     /note="AcrB/AcrD/AcrF family; Region: ACR_tran; pfam00873"
                     /db_xref="CDD:201483"
     gene            409554..410738
                     /gene="nodT2"
                     /locus_tag="CNE_2c03810"
                     /db_xref="GeneID:10920869"
     CDS             409554..410738
                     /gene="nodT2"
                     /locus_tag="CNE_2c03810"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodT"
                     /protein_id="YP_004680598.1"
                     /db_xref="GI:339321704"
                     /db_xref="GeneID:10920869"
                     /translation="MLKLERLAASVLAAAAAVVAGCTSPVGPQSSGVDVAPRWQTLAP
                     AQADADLVVSHDDAQVDQQWWSHFHDAALEALIREAIAGNKSLGIARARVEEARAARL
                     QAQSALAPEVTAVASSERGNRGLLTNDKSVTVNQVALSAAWELDLFGRNQARTAQATA
                     ILQSTEASEQAVRVALLAEVARTYFELRNLDRQIELTTSNLETQRRTLKLVEAQLRGA
                     LVSNLDVQRAAAQTSTTESRVPSLRAARDAAANRLSALLGRTPGNLKEVAAAPQPPLD
                     GRIVVSAPASVIATRPDVRVAERRFVASISARKAAVAELFPKISLSALFGVQDATPFS
                     STPWGIGIGLVQPVLNFGRIRSQIDAADARQTQAFLAYQQAVLDALEDMESAMSAYLN
                     EQ"
     misc_feature    409770..410327
                     /gene="nodT2"
                     /locus_tag="CNE_2c03810"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    410400..>410735
                     /gene="nodT2"
                     /locus_tag="CNE_2c03810"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     gene            complement(411082..411435)
                     /locus_tag="CNE_2c03820"
                     /db_xref="GeneID:10920870"
     CDS             complement(411082..411435)
                     /locus_tag="CNE_2c03820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680599.1"
                     /db_xref="GI:339321705"
                     /db_xref="GeneID:10920870"
                     /translation="MCTHLPLLPAFAALIVAGCNTAPIPPGKPVDIPTALQQVAAGLC
                     AFKKDAEARKQGSFDSVTVELDLTIDGAKDPPVAVAPDIQFMPTVSYGQTISVTKGSK
                     LTMTLKNVDACDMSK"
     gene            411976..412470
                     /locus_tag="CNE_2c03830"
                     /db_xref="GeneID:10920871"
     CDS             411976..412470
                     /locus_tag="CNE_2c03830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680600.1"
                     /db_xref="GI:339321706"
                     /db_xref="GeneID:10920871"
                     /translation="MSARSASLSIVFVLSTVLSACATTTTDDNVAKEQVAAATRAWID
                     AMSSHNQEQVLALYDPEAVLWGTTSPTIRDNPESVREYFNFLRTAPPYYKGILGEQRI
                     RVHDDMAINTGTYTFVGPAVDAAGKPVSRPARFSFVYRYRNGRWLIVDHHSSAVPAPA
                     APTK"
     misc_feature    411994..412446
                     /locus_tag="CNE_2c03830"
                     /note="Calcium/calmodulin dependent protein kinase II
                     Association; Region: CaMKII_AD; cl17504"
                     /db_xref="CDD:266735"
     gene            complement(412607..412954)
                     /locus_tag="CNE_2c03840"
                     /db_xref="GeneID:10920872"
     CDS             complement(412607..412954)
                     /locus_tag="CNE_2c03840"
                     /note="modular protein"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="YP_004680601.1"
                     /db_xref="GI:339321707"
                     /db_xref="GeneID:10920872"
                     /translation="MNSDGMGLRIEPDVRAPEYGACHAPLAHLEHKAAMGFVTRNGVE
                     LRTNDDFHIHHDKTTIVDGNTVETGSFNFAPSAETVNSENVVVIRDMPEVSRQYIEHW
                     QSRWDLGKAYPTS"
     misc_feature    complement(412637..>412918)
                     /locus_tag="CNE_2c03840"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(412634..>412858)
                     /locus_tag="CNE_2c03840"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:265651"
     misc_feature    complement(order(412706..412708,412739..412741,
                     412745..412747,412784..412786,412790..412792))
                     /locus_tag="CNE_2c03840"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    complement(412790..412792)
                     /locus_tag="CNE_2c03840"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     gene            complement(412944..413543)
                     /locus_tag="CNE_2c03850"
                     /db_xref="GeneID:10920873"
     CDS             complement(412944..413543)
                     /locus_tag="CNE_2c03850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680602.1"
                     /db_xref="GI:339321708"
                     /db_xref="GeneID:10920873"
                     /translation="MSISTNRLESFSDGVISVSLTLMLFQLQVPEGFSLKDILNNSSN
                     FFGYVLSFVYVGIYWNNHHHLFKVARGINGKIMWANLHLLFWLSMIPFTTTWTGKSAF
                     AQTPTAMYAFVLFMCAVSYSLLTRLIIKYDGEHSALGQAIGNDLKGKLSIPIYALAIL
                     ASFFSSVASFFILTLMAGIWFFPDSRIEKYLLGSNTHEL"
     misc_feature    complement(412980..413525)
                     /locus_tag="CNE_2c03850"
                     /note="Protein of unknown function (DUF1211); Region:
                     DUF1211; cl01421"
                     /db_xref="CDD:260932"
     gene            complement(413556..414284)
                     /locus_tag="CNE_2c03860"
                     /db_xref="GeneID:10920874"
     CDS             complement(413556..414284)
                     /locus_tag="CNE_2c03860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680603.1"
                     /db_xref="GI:339321709"
                     /db_xref="GeneID:10920874"
                     /translation="MSANVNASDNTETNENPSLWEICKAPILLTIVGGAIDTIGFIAL
                     LGFFTAHVTGNLVLAGAAFVKGGAGLWIKLGAIPLFIVTVIISKMLIDRNQRTHQTHQ
                     TLGWLFIAEATFLLGFMVAGLYLEPFDNPDGAGLALTGGLGLVALAVRNTASKTLIKY
                     ISPSTMMTGNTTQLGIDLSNYLRARTRTNFQDLLKSASVVIGFVIGAFLGASLYVTIG
                     FWSVLPFILPVAYMARMAFRNQFR"
     misc_feature    complement(413574..414206)
                     /locus_tag="CNE_2c03860"
                     /note="Protein of unknown function (DUF1275); Region:
                     DUF1275; pfam06912"
                     /db_xref="CDD:253974"
     gene            complement(414499..415197)
                     /locus_tag="CNE_2c03870"
                     /db_xref="GeneID:10920875"
     CDS             complement(414499..415197)
                     /locus_tag="CNE_2c03870"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_004680604.1"
                     /db_xref="GI:339321710"
                     /db_xref="GeneID:10920875"
                     /translation="MSNAKLEVLTPRNSQLIIIDHQPQMAFGVQSMDRQTMKNNVVGL
                     AKAAKIFDVPTTITTVESDSFSGYTYPELLDVFPGKKTLERTSMNSWDDQKVRDALAA
                     NGRKKIVVAGLWTEVCNTTFALCAMLEGDYEIYMVADASGGTTKEAHDYAMQRMVQAG
                     VVPVTWQQVMLEWQRDWKNRETYDDVMAVAKEHSGAYGMGVDYAYTMVHKAAPRTATT
                     HESLAPVHAPVVER"
     misc_feature    complement(414673..415152)
                     /locus_tag="CNE_2c03870"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(414844..414846,414943..414945,
                     415138..415140))
                     /locus_tag="CNE_2c03870"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(414982..414984,415120..415122,
                     415129..415131))
                     /locus_tag="CNE_2c03870"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(414856..414861)
                     /locus_tag="CNE_2c03870"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            415706..417184
                     /locus_tag="CNE_2c03880"
                     /db_xref="GeneID:10920876"
     CDS             415706..417184
                     /locus_tag="CNE_2c03880"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="YP_004680605.1"
                     /db_xref="GI:339321711"
                     /db_xref="GeneID:10920876"
                     /translation="MCKFRHDHTLRRKSGLPWRVGGAGRERHACGRAYRTLMLLLLAG
                     LSACGSLPHNAPRNLPQAAAGSASAALREPTDIAGQTTVAMSFSGGGTRAAAFAFGAL
                     QGLDAMRSPGGASLLDDIAFISSVSGGSITAAYYGLHGKDSLATFRSVLLKDGEAGLR
                     FSLLNPVNLARLFAGGLNDREDLRTWLDEDVFKGATYADMFRRGKPIVWINATNVYYR
                     VAFPFSQLAFDALCSDLASFPVSEAVAASMAVPLFFAPIVLQKYPEACSAPLPSLDHV
                     QRPGQSLLLGALATAVRGHRDTSKGKYIKLVDGGVTDNYGLATILQTRLLLGTAYGPM
                     SENDAINVRRLLFIVVDAGQGPRGDWNRSQGGPSGIEVASAAIDAAMATNVRMSYDAF
                     VPMMRQWRDDLVAYRCGMPHSRQQEIAARRPGWRCDEVEFFVTRISFEALDKERAASL
                     NDLPTRLRLPEKDVDRLIEAGRDAILGNPVIREFERESTEAR"
     misc_feature    415958..416476
                     /locus_tag="CNE_2c03880"
                     /note="Patatin-like phospholipase; Region: Patatin;
                     pfam01734"
                     /db_xref="CDD:250825"
     misc_feature    order(415973..415978,415982..415984,416084..416086,
                     416627..416629)
                     /locus_tag="CNE_2c03880"
                     /note="active site"
                     /db_xref="CDD:132836"
     misc_feature    416078..416092
                     /locus_tag="CNE_2c03880"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132836"
     misc_feature    416972..417175
                     /locus_tag="CNE_2c03880"
                     /note="SAM (Sterile alpha motif ); Region:
                     SAM_superfamily; cl15755"
                     /db_xref="CDD:265771"
     gene            complement(417283..418206)
                     /gene="gnl"
                     /locus_tag="CNE_2c03890"
                     /db_xref="GeneID:10920877"
     CDS             complement(417283..418206)
                     /gene="gnl"
                     /locus_tag="CNE_2c03890"
                     /EC_number="3.1.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="YP_004680606.1"
                     /db_xref="GI:339321712"
                     /db_xref="GeneID:10920877"
                     /translation="MFLLQQPAVRDAQVLTRLPESFRRHDPDNAWAHANRGGATIDSF
                     LEGPVWADGNLWVTDIPYGRIFRVSMQGDWELVAEYDGEPNGMKRLVSGDFLITDYRN
                     GLVRLYAKSGTVTPFLERRNSERFRGVNDLTFDSQGNLYFTDQGQTGLHDPTGRVYRL
                     TPDGKLDVLLDNAPSPNGVVLSPDEKVLFVAMTRGNSVWRVPLQADGSVSKVGQFFTS
                     YGPSGPDGLAMRSDGHLLVANPGLGYVWVLNHRAEPVEVIRSPGGTSLTNLCFGGTEG
                     TTLFMTESTTGTILCADMSVGGAPVHGGRLA"
     misc_feature    complement(417361..418071)
                     /gene="gnl"
                     /locus_tag="CNE_2c03890"
                     /note="SMP-30/Gluconolaconase/LRE-like region; Region:
                     SGL; pfam08450"
                     /db_xref="CDD:254808"
     misc_feature    complement(417628..417819)
                     /gene="gnl"
                     /locus_tag="CNE_2c03890"
                     /note="Strictosidine synthase; Region: Str_synth; cl19733"
                     /db_xref="CDD:268086"
     gene            complement(418219..419184)
                     /locus_tag="CNE_2c03900"
                     /db_xref="GeneID:10920878"
     CDS             complement(418219..419184)
                     /locus_tag="CNE_2c03900"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680607.1"
                     /db_xref="GI:339321713"
                     /db_xref="GeneID:10920878"
                     /translation="MLSRTIGCLVAATTLLVSLSAVAAYPDKPVRIIVPNPPGGAVDV
                     VTRKVAQKLTVQTGQSFVVENKPGASGTIGTSQVVNAPADGYTLLANDNSYTTLPYVF
                     KKLNWDHQTALVPIAPFAFSPVVLGVKADSRFKDLASLVSYAKAHPGEVTFGTGGPGS
                     SPHFAAEAFQQAAGIKLMHVPYKGAGEAMVGLLSGSVDLLVVSTPTALAPVKGNQMRL
                     LGISGKTRVDVFPSVPTFAEAGVPNFSLFNWSGLAAPKGTPNDVITRLQTEIQKALQA
                     PDMKTFLAQMGSQPGNLDSPAFAQLIQRETAQWATVAQKAHIEKQ"
     misc_feature    complement(418231..419052)
                     /locus_tag="CNE_2c03900"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(419277..420212)
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /db_xref="GeneID:10920879"
     CDS             complement(419277..420212)
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /EC_number="1.1.1.95"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_004680608.1"
                     /db_xref="GI:339321714"
                     /db_xref="GeneID:10920879"
                     /translation="MTNKQVIIVTGADLAPEALALLDDHEIVFAGKTPQTADIAALAK
                     EHNPVGIIVRYGSITAEVMDAAPALKVISKHGTGTDTIDKAAAQARGITVAAAAGANA
                     AAVAEHAWALILACAKAVPHLNDRMRQCHWDKATYKAVELNGCTLGIVGLGEIGRRAA
                     VIGVAMGMHVTAFDPYATTVPEGVTLVDLPRLFRESDVVSLHCPLTEENRGMLNRETL
                     ATFKDGAILVNTARGGLIDEPALAEALQSGKLYAAGLDSFAVEPMPVPHPFRDIPNLI
                     LSPHIGGVSNAAYVNMGVGAAKNVLAVLQGVATPA"
     misc_feature    complement(419295..420197)
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    complement(419295..420194)
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="Phosphoglycerate dehydrogenases, NAD-binding and
                     catalytic domains; Region: PGDH_4; cd12173"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(419346..419348,419364..419366,
                     419373..419375,419517..419519,419910..419912,
                     419982..419987,419991..419993,420048..420053))
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(419364..419369,419373..419375,
                     419442..419447,419517..419525,419586..419588,
                     419601..419609,419685..419696,419748..419756,
                     419760..419762,419898..419900,419910..419912,
                     419982..419984))
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(419340..419342,419352..419363,
                     419367..419390,419394..419408,419424..419432,
                     419439..419441,419715..419720,419727..419729,
                     419778..419780,419784..419804,419811..419813,
                     419817..419825,419829..419834,419841..419846,
                     419850..419855,419859..419861,419868..419873,
                     419880..419885,419889..419894,419901..419906))
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(419373..419375,419430..419432,
                     419517..419519))
                     /gene="serA1"
                     /locus_tag="CNE_2c03910"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240650"
     gene            complement(420209..420892)
                     /gene="menG1"
                     /locus_tag="CNE_2c03920"
                     /db_xref="GeneID:10920880"
     CDS             complement(420209..420892)
                     /gene="menG1"
                     /locus_tag="CNE_2c03920"
                     /codon_start=1
                     /transl_table=11
                     /product="demethylmenaquinone methyltransferase MenG"
                     /protein_id="YP_004680609.1"
                     /db_xref="GI:339321715"
                     /db_xref="GeneID:10920880"
                     /translation="MTLPNIIKSFERVPAEIVARAAKFQPAILSDVGGRRGALHGRIR
                     ALRPSMKVAGPAFTVEVRPGDNLMIHAALALAQPGDVLVVDGKGDQTSALMGTIMMHA
                     ARQRGLAGVVIDGAVRDSLELEEMQFPVFSVGTNPNGPTKEVGGRIGHPISVGGVTVN
                     PGDYICGDADGLVVVEREKIEALLDAAAKKEDAEAQRIAQIKEGNTTAPWLLASLVTA
                     GVLKQGEAL"
     misc_feature    complement(420236..420877)
                     /gene="menG1"
                     /locus_tag="CNE_2c03920"
                     /note="Demethylmenaquinone methyltransferase; Region:
                     Methyltransf_6; cl00480"
                     /db_xref="CDD:260452"
     gene            complement(420936..421916)
                     /locus_tag="CNE_2c03930"
                     /db_xref="GeneID:10920881"
     CDS             complement(420936..421916)
                     /locus_tag="CNE_2c03930"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680610.1"
                     /db_xref="GI:339321716"
                     /db_xref="GeneID:10920881"
                     /translation="MKAISRRCIFVLATGLVLASATTQAAPQYPTKPIRVIVPFPAGG
                     GTDIIAREVTNTVAKSTGWVFVVENKPGSGGNLGVDAAAKAPADGYTIVMGQTSNLAI
                     NPSLYERLPYDPLKDLTPISLVASAPLVLVTHVNSPYKTLKDVIQAGKAKPGAINFAS
                     PGNGTVAHLGGELLQTTAKVKFTHVPYKGAAQAVNDLMGGQVDLYMASVPTLLGHIKN
                     NRMRPLAVTSPKRLQDLPQVPTVAELGYPGFDTATWFGFVAPAATPKDIVVRLNIEFN
                     KALKSPALATKLDEQGASVLTGTPEAFSALIKQDIGRWASVIKASGTKLD"
     misc_feature    complement(420951..421772)
                     /locus_tag="CNE_2c03930"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            422014..422784
                     /locus_tag="CNE_2c03940"
                     /db_xref="GeneID:10920882"
     CDS             422014..422784
                     /locus_tag="CNE_2c03940"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004680611.1"
                     /db_xref="GI:339321717"
                     /db_xref="GeneID:10920882"
                     /translation="MNANSDPKGASRGDDGAGGVIAVTRALRVLEAFGVNDPQLSLAE
                     LSRRTGIHKTTVLRLARTLAADNYLVQKEDGNWRLGRAAGWLGACYQATFNVQEVVEP
                     VLRELTIKTGESASFYVREGQQRTCLVRVEGPQAIRHHVRIGAALPLDSGSPGRVILA
                     FSGEPGELYEMIRRRGFHLSLGEREAEVSSVSAPVFGLHWRLLGSMCISGPTSRLSEE
                     RLLELAQTVVDAANKLSYAMAGSQRPAMQIERPSTWHP"
     misc_feature    422077..422727
                     /locus_tag="CNE_2c03940"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    422077..422334
                     /locus_tag="CNE_2c03940"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    422416..422724
                     /locus_tag="CNE_2c03940"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(423084..423392)
                     /locus_tag="CNE_2c03950"
                     /db_xref="GeneID:10920883"
     CDS             complement(423084..423392)
                     /locus_tag="CNE_2c03950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680612.1"
                     /db_xref="GI:339321718"
                     /db_xref="GeneID:10920883"
                     /translation="MARSREAPERIADETTLLQFRYFAAAAETRQFSKAATTEHVSQS
                     AIPNAVLTLEQHLAVRLFACLPQGVALTAEGHHFYQHAPAQPAGALSHQIPGQGVNLK
                     "
     misc_feature    complement(<423147..423347)
                     /locus_tag="CNE_2c03950"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(423165..423338)
                     /locus_tag="CNE_2c03950"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     gene            423391..423642
                     /locus_tag="CNE_2c03960"
                     /db_xref="GeneID:10920885"
     CDS             423391..423642
                     /locus_tag="CNE_2c03960"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680613.1"
                     /db_xref="GI:339321719"
                     /db_xref="GeneID:10920885"
                     /translation="MSIPPLYVLWISGFGIFDFTMARALPTLLRTKEACGDRHREYPT
                     IANLRESLAAASLDDKDTLKRGRVYLSGTQALGRLPLRQ"
     misc_feature    423517..>423639
                     /locus_tag="CNE_2c03960"
                     /note="indolepyruvate ferredoxin oxidoreductase;
                     Validated; Region: PRK09193"
                     /db_xref="CDD:236404"
     gene            423750..424016
                     /locus_tag="CNE_2c03970"
                     /db_xref="GeneID:10920884"
     CDS             423750..424016
                     /locus_tag="CNE_2c03970"
                     /EC_number="1.2.7.8"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase protein"
                     /protein_id="YP_004680614.1"
                     /db_xref="GI:339321720"
                     /db_xref="GeneID:10920884"
                     /translation="MRDTAFGIFGRPTERRAERQLIAEYLATVEELAQSLSDGKLDTA
                     VAMASLPDDIRSFGHVKEVNMQKTAQRRTALLGQFRSGALSAAA"
     misc_feature    <423753..424013
                     /locus_tag="CNE_2c03970"
                     /note="indolepyruvate ferredoxin oxidoreductase;
                     Validated; Region: PRK09193"
                     /db_xref="CDD:236404"
     gene            424200..425294
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /db_xref="GeneID:10920886"
     CDS             424200..425294
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /EC_number="2.6.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="YP_004680615.1"
                     /db_xref="GI:339321721"
                     /db_xref="GeneID:10920886"
                     /translation="MNTENQLQFVVEPHPGPTPADEIAAKLANPTFGRIFTDHMVTIR
                     WTDGRGWYDAKVEARRPFQIDPACAVLHYAQEIFEGMKAYRGEDGKISLFRPQENARR
                     FRASAARMSMADLPEATFLQAVEALVDIDRAWIPGGDGSLYLRPFMFASENFLGVRAS
                     AEFVFCVIACPVGPYFKAGKSAVTVWVSDRYTRAAPGGTGAAKCGGNYAASLIAQTEG
                     SANGCDQVVFLDAAEHRWIEELGGMNVFFVMDDGSLRTPPLTGTILPGITRASIIELA
                     RHEGIPVNETAYDFETWRTDAASGRVKETFACGTAAVVTAIGQVRHAGGGFTIGNGGE
                     GEVTQRLRSLLTGIQRGKIADPFGWVHHVD"
     misc_feature    424224..425291
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /note="branched-chain amino acid aminotransferase;
                     Provisional; Region: PRK13357"
                     /db_xref="CDD:237363"
     misc_feature    424386..425252
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /note="BCAT_beta_family: Branched-chain aminotransferase
                     catalyses the transamination of the branched-chain amino
                     acids  leusine, isoleucine and valine to their respective
                     alpha-keto acids, alpha-ketoisocaproate,
                     alpha-keto-beta-methylvalerate and...; Region:
                     BCAT_beta_family; cd01557"
                     /db_xref="CDD:238798"
     misc_feature    order(424386..424400,424407..424421,424425..424427,
                     424431..424433,424524..424526,424632..424634,
                     424638..424640,424656..424664,424674..424676,
                     424695..424697,424812..424814,424827..424829,
                     424833..424835,424845..424847,424887..424889)
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238798"
     misc_feature    order(424416..424418,424431..424433,424503..424505,
                     424668..424670,424806..424808,424821..424823,
                     424914..424916,424998..425003,425127..425129)
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238798"
     misc_feature    424806..424808
                     /gene="ilvE"
                     /locus_tag="CNE_2c03980"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238798"
     gene            425560..426957
                     /locus_tag="CNE_2c03990"
                     /db_xref="GeneID:10920887"
     CDS             425560..426957
                     /locus_tag="CNE_2c03990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680616.1"
                     /db_xref="GI:339321722"
                     /db_xref="GeneID:10920887"
                     /translation="MSLFRTKDIDAMLVDRRVCSLKKVLGPVDLVLMGIGAIIGTGIF
                     VLTGTGALTAGPALTVSFVIAAMACGFAALCYAEFASAIPVSGSIYTYSYATLGEIIA
                     WMIGWDLLLEYGLATSAVSVGWSGYFQSLAAGFGLHLPAALTAAPGAVPGVHTLFNLP
                     AFLIMLITTWVVSCGVRESVRLNNLMVAIKISVVVLFIAVGVWHVKPANWQPFAPFGV
                     SGIFNAAALVFFAFIGFDAVTSAAEEVRNPHRDLPVGIIGSLTVCTVLYVIVAAIMTG
                     VVPFAKFAGIDHPVSLVLQYAGQNWVAGFVDLGAILGMTTVILVMTFGQTRVIFAMSR
                     DGLLPAKLSSVHPVHATPFFATWTVGIVFAMIAAFVPLNVLAELINIGTLSAFTLISI
                     AVLVLRRTRPELPRAFRCPGVPVVPLLSVGFCLFLMAHLQALTWIAFLIWLGIGLSIY
                     FRYARRNAVLHGGTR"
     misc_feature    425620..426918
                     /locus_tag="CNE_2c03990"
                     /note="amino acid transporter; Region: 2A0306; TIGR00909"
                     /db_xref="CDD:129987"
     misc_feature    425725..426750
                     /locus_tag="CNE_2c03990"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     misc_feature    426781..426933
                     /locus_tag="CNE_2c03990"
                     /note="C-terminus of AA_permease; Region: AA_permease_C;
                     pfam13906"
                     /db_xref="CDD:258173"
     gene            427205..428302
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /db_xref="GeneID:10920888"
     CDS             427205..428302
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /EC_number="1.4.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine dehydrogenase"
                     /protein_id="YP_004680617.1"
                     /db_xref="GI:339321723"
                     /db_xref="GeneID:10920888"
                     /translation="MEKKLNDRTHAAAAVRLFGTCEGLSHERVTLATDPESGLQAIIA
                     IYNTRLGPAFGGCRYWAYPAEVDALSDALRLSQGMAYKNALAGLPFGGGKAVILRSPA
                     QTDRQQLFRAFGRMVESLQGSYITAEDVGTTVDDMRAVQAETRYVSGMPRDGGFGGNP
                     SPWTAYGVFVGIEAAALYRLDRKSLAGLSVAVQGLGSVGWELCRRLHEAGATLTVADI
                     DAGRTTQAQQQFGARVVSPEAITAVDADVFAPCALGAVITPAVAESCRFRVVAGGANN
                     QLASLAEGDTLHQRGIFYAPDFLINAGGIVSCAREYLGGVDESALRDEVAGIRERVLR
                     LAQRVESTGQAPARAAVTWAHEVLSRGIGPN"
     misc_feature    427280..428125
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /note="Glutamate dehydrogenase/leucine dehydrogenase
                     [Amino acid transport and metabolism]; Region: GdhA;
                     COG0334"
                     /db_xref="CDD:223411"
     misc_feature    427280..427645
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:251546"
     misc_feature    427682..428281
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /note="NAD(P) binding domain of leucine dehydrogenase,
                     phenylalanine dehydrogenase, and valine dehydrogenase;
                     Region: NAD_bind_Leu_Phe_Val_DH; cd01075"
                     /db_xref="CDD:133444"
     misc_feature    order(427784..427786,427790..427798,427853..427858,
                     427868..427870,427955..427960,428021..428023,
                     428027..428029)
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133444"
     misc_feature    428117..428119
                     /gene="ldh"
                     /locus_tag="CNE_2c04000"
                     /note="Phe binding site; other site"
                     /db_xref="CDD:133444"
     gene            428329..429546
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /db_xref="GeneID:10920889"
     CDS             428329..429546
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /EC_number="2.3.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="YP_004680618.1"
                     /db_xref="GI:339321724"
                     /db_xref="GeneID:10920889"
                     /translation="MNEFPKPHSSTSASDKLVILDTTLRDGEQSPGAAMTVRQKIAVA
                     EYLDALNVDVIEAGFAASSDGDHDAIREISGQVKGSVICSLARANERDIERAANALRS
                     ARRSRIHTFIATSALHMEKKLRMTPEEVYLRACTAVRFARQFTDDVEFSPEDGSRSDP
                     DFLCRVIEGVIKEGATTINVPDTVGYAMPVEFAEGLRKLRERIPNSDKAIWSVHCHND
                     LGLAVANSLAAVKYGGARQIECTINGLGERAGNASLEEVVMAVKTRRDLFGLDVGVNT
                     THLVAASRAVAEATGFIVPANKAVVGANAFAHASGIHQDGILKARETYEIMRPEDVGW
                     DKGALVLGKLSGRNAFKHRVQELGLHFPDDEGLSAAFARFKGLADTKAAITDDDLRHI
                     ALGVAESSTVGAS"
     misc_feature    428371..429516
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /note="Isopropylmalate/homocitrate/citramalate synthases
                     [Amino acid transport and metabolism]; Region: LeuA;
                     COG0119"
                     /db_xref="CDD:223197"
     misc_feature    428383..429192
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /note="2-isopropylmalate synthase (IPMS), N-terminal
                     catalytic TIM barrel domain; Region: DRE_TIM_IPMS;
                     cd07940"
                     /db_xref="CDD:163678"
     misc_feature    order(428401..428406,428413..428415,428494..428496,
                     428587..428589,428653..428655,428779..428781,
                     428785..428787,428869..428871,428875..428877,
                     428968..428970,428974..428976)
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /note="active site"
                     /db_xref="CDD:163678"
     misc_feature    order(428401..428406,428494..428496)
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163678"
     misc_feature    order(428968..428970,428974..428976)
                     /gene="leuA2"
                     /locus_tag="CNE_2c04010"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163678"
     gene            430165..430734
                     /locus_tag="CNE_2c04020"
                     /db_xref="GeneID:10920890"
     CDS             430165..430734
                     /locus_tag="CNE_2c04020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680619.1"
                     /db_xref="GI:339321725"
                     /db_xref="GeneID:10920890"
                     /translation="MTEFPLTFISQIEWESWLAQNGGTSTGAWLRLAKKGAEQPTVTY
                     EQALEGALCYGWIDGKKQAESEKYWLQRFTPRSAKSIWSKLNKDRAEALIAAGRMRPP
                     GMTQIERAKKDGRWEAAYASASKSIVPDDLQVALDANPRAKKFFATLDSRNRYAILFR
                     VQNAKKPETRARKIEEFVNMLNRGEAFYP"
     misc_feature    430186..430731
                     /locus_tag="CNE_2c04020"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4430"
                     /db_xref="CDD:226851"
     misc_feature    430531..430719
                     /locus_tag="CNE_2c04020"
                     /note="Bacteriocin-protection, YdeI or OmpD-Associated;
                     Region: OmdA; pfam13376"
                     /db_xref="CDD:257703"
     gene            complement(431300..431496)
                     /locus_tag="CNE_2c04030"
                     /note="ATPase-like histidine kinase"
                     /pseudo
                     /db_xref="GeneID:10920891"
     gene            complement(431830..433005)
                     /locus_tag="CNE_2c04050"
                     /db_xref="GeneID:10920892"
     CDS             complement(431830..433005)
                     /locus_tag="CNE_2c04050"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680620.1"
                     /db_xref="GI:339321726"
                     /db_xref="GeneID:10920892"
                     /translation="MRQIFSDGALVQRYIDVEVALAKAEARAGVIPAEAAEAIARESR
                     IERINFDHMREETDIVGYPILPLVHQLVAMCGEAGRYVHWGATTQDIMDTAVALQMRD
                     ALDSIDADIRELRAILADLSARHRNTPMACRTHLQQALPVTFGYKTAIWLAMFDRHQQ
                     RIAELRPRVAVVEFAGAAGTLASLGGQGDNKGFAVQEALAAELGLGVPATTWHVARDG
                     FAEAVNLLALVTGSLGKIALDIMIMASTEFAEVYEPFVKGRGASSTMPQKRNPISSEL
                     MLAASKAVRQHAGLMVDAMVQDFERATGPWHAEWIAIPESFILTSGALHQAKFALGGL
                     IVDEARMQHNLGISRGLIVAEAVMMGMAPYIGRQQAHDVVSPGSSSCFCRWACVASG"
     misc_feature    complement(431884..433005)
                     /locus_tag="CNE_2c04050"
                     /note="prokaryotic 3-carboxy-cis,cis-muconate
                     cycloisomerase (CMLE)_like; Region: pCLME; cd01597"
                     /db_xref="CDD:176469"
     misc_feature    complement(432175..433005)
                     /locus_tag="CNE_2c04050"
                     /note="Lyase; Region: Lyase_1; pfam00206"
                     /db_xref="CDD:249677"
     misc_feature    complement(order(431953..431955,432070..432072,
                     432076..432078,432082..432087,432103..432117,
                     432130..432132,432142..432144,432157..432162,
                     432181..432183,432196..432201,432265..432267,
                     432271..432276,432289..432294,432301..432303,
                     432322..432327,432334..432336,432343..432348,
                     432352..432357,432361..432366,432379..432384,
                     432427..432429,432442..432444,432457..432459,
                     432466..432474,432514..432516,432523..432528,
                     432535..432537,432544..432546,432559..432561,
                     432565..432567,432583..432588,432592..432597,
                     432601..432609,432763..432768,432832..432837,
                     432844..432846,432973..432978,432985..432993))
                     /locus_tag="CNE_2c04050"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176469"
     misc_feature    complement(order(432103..432105,432196..432198,
                     432202..432207,432475..432477,432601..432606,
                     432739..432747,432817..432822))
                     /locus_tag="CNE_2c04050"
                     /note="active site"
                     /db_xref="CDD:176469"
     gene            433147..433455
                     /gene="pcaB1"
                     /locus_tag="CNE_2c04060"
                     /db_xref="GeneID:10920893"
     CDS             433147..433455
                     /gene="pcaB1"
                     /locus_tag="CNE_2c04060"
                     /EC_number="5.5.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="YP_004680621.1"
                     /db_xref="GI:339321727"
                     /db_xref="GeneID:10920893"
                     /translation="MSISILPTRTLATWCARRRTHLSARLIESRYGRQIAEIEQDVSA
                     STLADETVAKALRLEPGASVLKIVRRYLDADGQTFEVTATVHPADSFSVSMRLKRSTS
                     "
     misc_feature    <433219..433422
                     /gene="pcaB1"
                     /locus_tag="CNE_2c04060"
                     /note="UTRA domain; Region: UTRA; cl17743"
                     /db_xref="CDD:266805"
     gene            complement(433591..437538)
                     /locus_tag="CNE_2c04070"
                     /db_xref="GeneID:10920894"
     CDS             complement(433591..437538)
                     /locus_tag="CNE_2c04070"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate/guanylate cyclase"
                     /protein_id="YP_004680622.1"
                     /db_xref="GI:339321728"
                     /db_xref="GeneID:10920894"
                     /translation="MARLKIEVLGGLQVRLAGQHGSLAFPTRKSKAILAYLALSPGML
                     RSREQLASVLWERSAEEQARASLRQTLSSLRRVLPNAPPILNAEPDAIWLDGQFVEVD
                     ALQFTSLATERSPDSLSKAVALYRGALLDGFSLREEPFEQWMIIERRWFHERAVEVFT
                     ELVGHYEQSGEFDRAIATASRVLALDPSLEWAHALLMRLYARTGRRNAAVRQYQECVR
                     VLNTELGIAPAESTQRLAAQIQQDSGGAREPAGPAVAVGEPAKQSGIASRAGYAADSA
                     TALPAERKHLSVLCARVREPISVIDQETALERVDAVLKAMVDSVQRFGGLVTQLRSDG
                     VTALFGAPVAHEEHAVEACYAALAMRARISALIERSLDVRIGVHSGEAVVRTIGDEGS
                     QHYDALGSVPQIANQIDVALAAGEIGVSADTARCAEGFIELSDLRARSLPGATPPLEI
                     FTLGTKSELRLRWNARTVRGLTHFVGRDTEMASLQGMLARAGHSAGQVCAVVGEPGVG
                     KSRLVHEFVNSEQAAGWTKFETGATSRDTSAIYLPLANLLRTWFGIGTHDTLDGAAEK
                     LRRGVDAVDPALAWTCPALAAMLDLPPDDPQWDMATPPQRRKRTLEAIASLMIRASEH
                     RPSILVVEDLHWIDDGTQAVLDHLVDFIGASRVMLLVTHRPEYRHTWSGKSYFAQLHV
                     DSLGTEGAKQLLQSLLGDGSELSALRRHLIERTGCTPFFLEESVRALADSGALVGQKG
                     AYQMARTIDTFDIPSTVHAVLASRIDRLSAQQKALLQMAAVIGHEFPVDLLEPIANLD
                     RERLLDLLADLQAAEFLYQTRLLPHQQYTFKHALTHRVAYASVLKERRRPIHVQLVGV
                     IEQLYTQRLDEHVELLAHHALAGELWDKAVHYLYQSAGKALQRFAYQQAVDHLNRGLE
                     IIRMLPRSPALLRQELEYQKVLGVTMMAAKGWAAKEVLDAYTRARALCEELGDESELF
                     TVLRGEGQYRMIRGESEIARELGNRCTALTAGSHDPGMQIETHHLFWTNSFFMGEYAA
                     SEFHSRSGMVLYERERDHPLTFKYSGHDPGVCCRCFTALVQCLRGYPDKSLAICDEAL
                     GLAQELRHPLTTALTYWACSFAHILRGEPELAKQWAAREIAVCDEYMLPLLLSQGKFQ
                     LGWSLAQMGDLDEGIERMREGISAISATGAEMGLPYFNALLGEALGCAGKPEAGLVEI
                     DRALAAVNRHGGRFQLSEMLRLKGELLATRHPMQRNEALATLHEAIAVAQRQGAGLPG
                     LRAAISLARQLAAAGDIQHACAVLQPACDSIREGSDLTDVRTAQTLLAELKNR"
     misc_feature    complement(<437293..437460)
                     /locus_tag="CNE_2c04070"
                     /note="Transcriptional regulatory protein, C terminal;
                     Region: Trans_reg_C; smart00862"
                     /db_xref="CDD:214866"
     misc_feature    complement(order(437305..437310,437332..437334,
                     437341..437343,437398..437403,437458..437460))
                     /locus_tag="CNE_2c04070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     misc_feature    complement(436819..437238)
                     /locus_tag="CNE_2c04070"
                     /note="Bacterial transcriptional activator domain; Region:
                     BTAD; smart01043"
                     /db_xref="CDD:198111"
     misc_feature    complement(436882..>437070)
                     /locus_tag="CNE_2c04070"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(436930..436935,436942..436947,
                     436954..436959,437035..437040,437047..437052,
                     437056..437061))
                     /locus_tag="CNE_2c04070"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(436891..436893,436900..436902,
                     436912..436914,436948..436950,436993..436995,
                     437002..437004,437014..437016,437050..437052))
                     /locus_tag="CNE_2c04070"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(436180..436641)
                     /locus_tag="CNE_2c04070"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(436213..436215,436330..436332,
                     436339..436350,436381..436383,436390..436392,
                     436549..436554,436588..436590,436600..436602,
                     436609..436614,436621..436623))
                     /locus_tag="CNE_2c04070"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(436213..436215,436318..436323,
                     436330..436335,436345..436353,436531..436533,
                     436540..436548,436552..436554))
                     /locus_tag="CNE_2c04070"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(436540..436542)
                     /locus_tag="CNE_2c04070"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    complement(435559..436122)
                     /locus_tag="CNE_2c04070"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(433603..434787)
                     /locus_tag="CNE_2c04070"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            438031..438975
                     /locus_tag="CNE_2c04080"
                     /db_xref="GeneID:10920895"
     CDS             438031..438975
                     /locus_tag="CNE_2c04080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680623.1"
                     /db_xref="GI:339321729"
                     /db_xref="GeneID:10920895"
                     /translation="MEIMTDGHRVTTTNRYAKCIAASKRVRWDIDRDVIRGRSFDFTK
                     KFLPDALSKVDSLAFLGHDEQRLLSQIQGRTYANMFGLVERFIAAKVLEMSGPYRLGD
                     QSALEALVRFSDEEIKHQELFRRIERMCAEGMPAGYSFLPDANSVASFVLAKSTWAVL
                     ALTCHIELFVLAHYRGSIDGDMNSSELWKDVFLYHWREESQHAILDEIEWQREDARLS
                     PEERDAAVNDLIELVAAVDGILQTQANADADYFAMICPRSLSMADKDSVRIGLLAAYR
                     WQYIISGVQEPRFSQALSSMITGSQLFRIETAMAPIMS"
     misc_feature    <438673..438858
                     /locus_tag="CNE_2c04080"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     gene            complement(439018..439146)
                     /locus_tag="CNE_2c04090"
                     /db_xref="GeneID:10920896"
     CDS             complement(439018..439146)
                     /locus_tag="CNE_2c04090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680624.1"
                     /db_xref="GI:339321730"
                     /db_xref="GeneID:10920896"
                     /translation="MGVAAFPDMARFQQEALTGGTVLLTLFPAILAPPFRREAHDA"
     gene            439257..439397
                     /locus_tag="CNE_2c04100"
                     /db_xref="GeneID:10920897"
     CDS             439257..439397
                     /locus_tag="CNE_2c04100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680625.1"
                     /db_xref="GI:339321731"
                     /db_xref="GeneID:10920897"
                     /translation="MIRFLAAAILCGLTLSMFGCAGPQMGADNTHRFNSDPYNYEFSR
                     NL"
     gene            439782..440834
                     /locus_tag="CNE_2c04110"
                     /db_xref="GeneID:10920898"
     CDS             439782..440834
                     /locus_tag="CNE_2c04110"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin"
                     /protein_id="YP_004680626.1"
                     /db_xref="GI:339321732"
                     /db_xref="GeneID:10920898"
                     /translation="MRRMGALLVVAVAAVPGIAAAQSGVTIFGVADLYTEYVKSGANH
                     VARVEDGGLYQSRWGLRGKEELAPGLSTVFTLETGLALDSGTAQQGGRLFGRQAWVGL
                     SSKDWGALTLGRQNTPIYYIEGQASAFGFSPYGPLGRLQNGGPAGSSLTARADNSIRY
                     ESPELAGLQGSVIYSFGAERTSAPRDADRLAAGGLTYARGPLWLGLAYERTYSIGAVT
                     DADRDERAIGATYEFPWVKLFANVRQATRWVPGQATLKDRGFHVGTTIPVGGAGLVLL
                     AYGMQQSVGTPNRGQQASIGYQYSMSKRTTLYANASKIWNTNKANYTFSNIPNEVTAS
                     SVSDPRGVMMGMRHLF"
     misc_feature    439848..440831
                     /locus_tag="CNE_2c04110"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(439848..439850,439854..439856,439872..439874,
                     439878..439886,439965..439979,439995..439997,
                     440001..440009,440013..440015,440019..440030,
                     440064..440069,440073..440087,440115..440123,
                     440238..440240,440244..440249,440682..440687,
                     440694..440696,440817..440819,440823..440825,
                     440829..440831)
                     /locus_tag="CNE_2c04110"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(439869..439871,439950..439952,440067..440069,
                     440160..440162,440238..440240)
                     /locus_tag="CNE_2c04110"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            440920..441429
                     /locus_tag="CNE_2c04120"
                     /db_xref="GeneID:10920899"
     CDS             440920..441429
                     /locus_tag="CNE_2c04120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680627.1"
                     /db_xref="GI:339321733"
                     /db_xref="GeneID:10920899"
                     /translation="MKRFTLAVAFGLHLFCAPIASAAGVTQLQTLGADAAVRLTDAAK
                     RFAEDRKLAVSIVVVDVSGHFLSGVRMDGAPFATFDVARGKAIASAATGGASGAELVK
                     RYQANPIVFGQMSSLVYGGPVFPSQGSLGIYVGGRLVGAVGVSGGPSDVDEEIGRRGV
                     VAIGATEAP"
     misc_feature    441007..441408
                     /locus_tag="CNE_2c04120"
                     /note="Domain of unknown function (DUF336); Region:
                     DUF336; cl01249"
                     /db_xref="CDD:260854"
     gene            complement(441528..442316)
                     /locus_tag="CNE_2c04130"
                     /db_xref="GeneID:10920900"
     CDS             complement(441528..442316)
                     /locus_tag="CNE_2c04130"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="YP_004680628.1"
                     /db_xref="GI:339321734"
                     /db_xref="GeneID:10920900"
                     /translation="MHYNQDGAVVTIGNGPNHVIALHGWFGHARGWGPFVDVLDGDRF
                     TYAFIDYRGYGSRRGIQGRFDMREIAADVLALGDELGWQRFSLIGHSMGGKAMQAVAM
                     LAPARVTAMVGVTPVPPTPVPFDKPARALFERAAGELAARIAVLDNSTGKRLSRHWVE
                     KMVRASTQHADADAFAAYFRAWADTDFSAEVAGSSVPTLLLVGEHDPSLTADIMEQTY
                     GKAFLDLAIDVIRNAGHYPMDETPVDLATRIERFLSDIQSRSEP"
     misc_feature    complement(441573..442262)
                     /locus_tag="CNE_2c04130"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<441981..442262)
                     /locus_tag="CNE_2c04130"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            442588..443634
                     /locus_tag="CNE_2c04140"
                     /db_xref="GeneID:10920901"
     CDS             442588..443634
                     /locus_tag="CNE_2c04140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680629.1"
                     /db_xref="GI:339321735"
                     /db_xref="GeneID:10920901"
                     /translation="MQSRKPPSFLTAPRRVATLAAITAAITATLAVAVAGLRPVAANA
                     AAADTNIQASWKPSKPIVFIVPFPPAGINDVLARALAQRLSNALGQPVVVENRPGASG
                     NIGAEALVRAAPDGYTIGILNSIHAVNAAFYRKLPYDVTRDLVPVAPLGESPLVLVTN
                     PHTPYKSVPELIAYAKANPGKINYGGPTSYPLEMIKTMAGVDITNIPYKGSGPTINDM
                     IAGHIDLATGPLLEYMPHVNSGKLKLLAVGTASRLKALPNVPTVAESIPGYDTTVWYG
                     VFAPKGTPAPVVERLRGEIHAIMSDAGIRAKLTGLSVDTAFSQTGVTGLSTRLTSETQ
                     RAHQIVAKTGGYLN"
     misc_feature    442816..443535
                     /locus_tag="CNE_2c04140"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            443643..444317
                     /gene="cycA"
                     /locus_tag="CNE_2c04150"
                     /db_xref="GeneID:10920902"
     CDS             443643..444317
                     /gene="cycA"
                     /locus_tag="CNE_2c04150"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="YP_004680630.1"
                     /db_xref="GI:339321736"
                     /db_xref="GeneID:10920902"
                     /translation="MPCCENSDVKHPMERRRLSACMLALCALAVPSLAQPAPEAGESR
                     PARLMVEQVCAACHGNTGQSTQKEYPSLAGQNADYLFKQLRQFKAGAGEPALRQDATM
                     AAVVQSMSETEMREVARYFSRQPPARGQAALPHLVEAGKAIYWKGNPSNRLPACISCH
                     RPKGEGIAPDFPRIAGQQPEYVVRQLHAWRSGTRGGPGKLMSLLVPLMTDEEIVAVAQ
                     NVAQLH"
     misc_feature    443679..444074
                     /gene="cycA"
                     /locus_tag="CNE_2c04150"
                     /note="Cytochrome c553 [Energy production and conversion];
                     Region: COG2863"
                     /db_xref="CDD:225418"
     misc_feature    444021..444311
                     /gene="cycA"
                     /locus_tag="CNE_2c04150"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            444388..445524
                     /locus_tag="CNE_2c04160"
                     /db_xref="GeneID:10920903"
     CDS             444388..445524
                     /locus_tag="CNE_2c04160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680631.1"
                     /db_xref="GI:339321737"
                     /db_xref="GeneID:10920903"
                     /translation="MMIDRRHWLKAAGALGLGAASLKAAAQVTAGRNTPLAASDAASL
                     PIVKPGKIHRIESATETVRVGILDPKAAPVASIESGDLVMYPNTWVNWANGASYGMSY
                     EDREPVRKRFPQGPYSNVGPVELRGSMPGDVVECRMVKLRPIGWGWNSAPKGVGALPN
                     DFAKPYLRYFKFDESRQYTEFAPGIRIKLAPFQGVMAVQPAGDEPVSGILSGPYGGNL
                     VLRELVEGTSLFLPVQRPGAMIWTGDSHAAQGDGVVNQTAIETAMEDMQIQYFLHKQR
                     PLALPMAETPSHWIILGFGKNLDEALVACLRQMLNWVSAATGMDPHDVYSLASITSDF
                     RITQYSNQTASNYTSIPAKTVHGMLPKAVFDAVIQDKLSRSLRG"
     misc_feature    444562..445482
                     /locus_tag="CNE_2c04160"
                     /note="Acetamidase/Formamidase family; Region: FmdA_AmdA;
                     cl19826"
                     /db_xref="CDD:268179"
     gene            complement(445557..446420)
                     /locus_tag="CNE_2c04170"
                     /db_xref="GeneID:10920904"
     CDS             complement(445557..446420)
                     /locus_tag="CNE_2c04170"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004680632.1"
                     /db_xref="GI:339321738"
                     /db_xref="GeneID:10920904"
                     /translation="MAKDRQIRIVHGSFGRATLHRISGPLVAHAHAEFHLIFKIGGTD
                     ATFKIDGQPATLTDGCALLINPWSTHAKSAKEGSPSLLLALLLEPEWLGRTLGVDNPA
                     GGLHFSKALVRMDADTVTSLTALGTCLARDLADDSAIGSADCEAAVANLARRVSACHL
                     QRRSMTEVLANTRPLDYRIKRATEYIRSHAGENPNVETVASAVGMSRSRLFHQFKACM
                     GISPQQYLDWIRIGIATRLLAERHASIGDVAHQLGFSAQGHFTRFFVQHLGLSPSEFR
                     RTGMPGGAHGD"
     misc_feature    complement(445587..445943)
                     /locus_tag="CNE_2c04170"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(445743..445865)
                     /locus_tag="CNE_2c04170"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(445590..>445691)
                     /locus_tag="CNE_2c04170"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(446775..447821)
                     /locus_tag="CNE_2c04180"
                     /db_xref="GeneID:10920905"
     CDS             complement(446775..447821)
                     /locus_tag="CNE_2c04180"
                     /codon_start=1
                     /transl_table=11
                     /product="Bll6274 protein"
                     /protein_id="YP_004680633.1"
                     /db_xref="GI:339321739"
                     /db_xref="GeneID:10920905"
                     /translation="MTARPSTMISAAGLQAFAQALLASAGLHEPGASLVAESLVWADL
                     RGSPGHGVSRIPQYTAWLASGDMNGQAQPRPGLSLPALTVVEGDRCAGALGMRIAAGQ
                     AIAGARQAGASLVLLRETTHTGALGFHTAHVASAGMFAMAMAASSPLMAYHGASVAGV
                     STAPLSMACPGLGEPIVFDMASGAVAFGKLMQARATGRPLEPGWAIDAMGNPTTDARQ
                     ATTPLPLGGPKGSGLALMAEIACSLLTNHPILAPTLLAPAAGHRHTQNAWLLVIDIAQ
                     VVDPSLFQAQLAELAGAIHNLPASVEGPPRLPGERGYAEARERGANGIALAPVTADAL
                     EALASQAGIRAPWA"
     misc_feature    complement(446793..447797)
                     /locus_tag="CNE_2c04180"
                     /note="Malate/L-lactate dehydrogenase; Region: Ldh_2;
                     cl00900"
                     /db_xref="CDD:260688"
     gene            complement(447818..448774)
                     /locus_tag="CNE_2c04190"
                     /db_xref="GeneID:10920906"
     CDS             complement(447818..448774)
                     /locus_tag="CNE_2c04190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680634.1"
                     /db_xref="GI:339321740"
                     /db_xref="GeneID:10920906"
                     /translation="MLGQPSEGGFRTTSCATKLGEMSVHTVVKFDSDGLRLAGALHLP
                     PDLAAGERRPAIAVLHGFGSNKDDGMVQLATRLFSSLGYVVLRFDMRGCGNSEGARGK
                     VLCEDQVSDTRNAVSYLQSLPEVEPAKIAVMGHSFGAAVAVYAAGVDPRIVACISSAG
                     WGDGEVKLRQQHAGSAAWQRFEAMVEEGRARLATGQSMQVSRFDIVPIPPEMRSSLPA
                     GSFMEFPFEVVESMLRFRPNAVVGNIAPRPLLLLHPADDSVTPTDQSIGLFRNARMPA
                     ELHLFSEIDHFIFSDDNRAVLNLVTDWLHKFFPARQASLGAA"
     misc_feature    complement(447863..448711)
                     /locus_tag="CNE_2c04190"
                     /note="Hydrolases of the alpha/beta superfamily [General
                     function prediction only]; Region: COG1073"
                     /db_xref="CDD:223999"
     misc_feature    complement(448466..448675)
                     /locus_tag="CNE_2c04190"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(449016..449333)
                     /locus_tag="CNE_2c04200"
                     /db_xref="GeneID:10920907"
     CDS             complement(449016..449333)
                     /locus_tag="CNE_2c04200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680635.1"
                     /db_xref="GI:339321741"
                     /db_xref="GeneID:10920907"
                     /translation="MAPEATLKDDTGQLVVKHYAGPTWEAPDGSKVTGKVLRQTPNAQ
                     EPDSIPLLLLQATSTGGTGLLARTRYVQRLNTLGGQALPQACTQEGLENRMPYRADYV
                     FLE"
     misc_feature    complement(449025..>449330)
                     /locus_tag="CNE_2c04200"
                     /note="Protein of unknown function (DUF3455); Region:
                     DUF3455; pfam11937"
                     /db_xref="CDD:256742"
     gene            450571..450612
                     /locus_tag="CNE_2c04210"
                     /note="transposase IS4 family"
                     /pseudo
                     /db_xref="GeneID:10920908"
     gene            complement(451747..452076)
                     /locus_tag="CNE_2c04230"
                     /db_xref="GeneID:10920909"
     CDS             complement(451747..452076)
                     /locus_tag="CNE_2c04230"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase, catalytic region"
                     /protein_id="YP_004680636.1"
                     /db_xref="GI:339321742"
                     /db_xref="GeneID:10920909"
                     /translation="MLRRPVESVQYASAEYQTLLARHQIVCSMSRKGNCWDNAVTERF
                     FLNLKMERVWQRQYANHAEARRDITQYIVGFYNPVRLHSTLGYLSPAAYEAKSIEKEP
                     ICLSEIT"
     misc_feature    complement(451807..452010)
                     /locus_tag="CNE_2c04230"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(452057..453454)
                     /locus_tag="CNE_2c04240"
                     /db_xref="GeneID:10920910"
     CDS             complement(452057..453454)
                     /locus_tag="CNE_2c04240"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_004680637.1"
                     /db_xref="GI:339321743"
                     /db_xref="GeneID:10920910"
                     /translation="MGRPAGWMQKLTGRGAMRSPGAPSHRREIERRFWAQIATGITSE
                     KAAEAVGVSQAVGARWFRYRGGMPLFMSNPISGRYLSFAEREEIGLLSLQGVGVREIA
                     RRIGRSPSTVSRELTRNAATRGGQLEYRASVAQWKAELVAKRPKPSKLVTNPRLRHYV
                     QDRLEGKVCDADGREISGPRQAPFKGRNKPHRGDRKWVNGWSPEQISNRLQIDFPDDE
                     SMRISHEAIYQALYIQGRGALKRELVSCLRTGRALRVPRARAQAKAWAHVSEDVMISS
                     RPAEAQDRAVPGHWEGDLIIGLNRSAIGTLVERSSRFTMLVHLPREKGYGSTPRTKNG
                     PALAGYGAVTMANALKKTVSDMPAQLWRSLTWDRGKELSDHARFTVESGVKVFFADPH
                     SPWQRGTNENTNGLLRQYFPKGTDLSRWSAREIQAVANALNTRPRKTLGWKTPAEALD
                     DYLKSVQQSSVATTG"
     misc_feature    complement(452108..453238)
                     /locus_tag="CNE_2c04240"
                     /note="Transposase and inactivated derivatives, IS30
                     family [DNA replication, recombination, and repair];
                     Region: Tra8; COG2826"
                     /db_xref="CDD:225382"
     misc_feature    complement(453098..453229)
                     /locus_tag="CNE_2c04240"
                     /note="Helix-turn-helix domain; Region: HTH_38; pfam13936"
                     /db_xref="CDD:258198"
     misc_feature    complement(452222..452611)
                     /locus_tag="CNE_2c04240"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(453469..454086)
                     /locus_tag="CNE_2c04250"
                     /db_xref="GeneID:10920911"
     CDS             complement(453469..454086)
                     /locus_tag="CNE_2c04250"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004680638.1"
                     /db_xref="GI:339321744"
                     /db_xref="GeneID:10920911"
                     /translation="MSYRVVAHLQQEAVSVSNACRVLQVSRSGYYAHRRAKPSMKTLQ
                     EQTHVKAAFAASGASYGSRRVMHAVREQGVRLGRYRIRRLMREAGLRATWKRKFVSTT
                     DSKHTLPVAENVLDRQFDVAEPNRAWTSDITYVRTAQGWLYLAVVLDLYSRKVVGWSM
                     APTMPADLVMSALSMALQQRRPAPGLVLHSDRGSQDGFNRSSQHL"
     misc_feature    complement(453793..453945)
                     /locus_tag="CNE_2c04250"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(<453502..453720)
                     /locus_tag="CNE_2c04250"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(454083..454280)
                     /locus_tag="CNE_2c04260"
                     /db_xref="GeneID:10920912"
     CDS             complement(454083..454280)
                     /locus_tag="CNE_2c04260"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004680639.1"
                     /db_xref="GI:339321745"
                     /db_xref="GeneID:10920912"
                     /translation="MELGETAVRRWMAQYDAECAGGPGVGKPLTAEQQRIRQLEAENR
                     QLREDNALLKKASAFFARELK"
     gene            complement(454672..455091)
                     /locus_tag="CNE_2c04270"
                     /db_xref="GeneID:10920913"
     CDS             complement(454672..455091)
                     /locus_tag="CNE_2c04270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680640.1"
                     /db_xref="GI:339321746"
                     /db_xref="GeneID:10920913"
                     /translation="MPATASEAISRIQHVLDTQANLSQLIERQAKQDLAIRGYRLTDD
                     ASHATAKLKITVRHALSVPVGANDVRGIAMSVGTEMVRVSDGKQLFLAGASQIKDPGT
                     KGVRLMPYAEWFTNEGFLVEQYRLVAWLLTAQTLEGL"
     gene            455361..455537
                     /locus_tag="CNE_2c04280"
                     /db_xref="GeneID:10920914"
     CDS             455361..455537
                     /locus_tag="CNE_2c04280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680641.1"
                     /db_xref="GI:339321747"
                     /db_xref="GeneID:10920914"
                     /translation="MGTCGCCDEEYFYLKVKVTFPGVPRRTERKTTSRSDATWPELLF
                     PRGGTLAQSSKMLA"
     gene            complement(455872..456258)
                     /locus_tag="CNE_2c04290"
                     /db_xref="GeneID:10920915"
     CDS             complement(455872..456258)
                     /locus_tag="CNE_2c04290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680642.1"
                     /db_xref="GI:339321748"
                     /db_xref="GeneID:10920915"
                     /translation="MLAAIPEEFRESMDCISAGLDRVLALLEVESECSDACFGIRCLV
                     EMIKAKFDRTSNGGRDFSGGMSGEADVAGGVAPVGWDNRSFGCGYFFGAGTELVGLSR
                     GLTHIGHEASLARAITRALKRRHSPR"
     misc_feature    complement(456091..>456216)
                     /locus_tag="CNE_2c04290"
                     /note="Protein of unknown function (DUF1484); Region:
                     DUF1484; pfam07363"
                     /db_xref="CDD:148780"
     gene            complement(456607..457104)
                     /locus_tag="CNE_2c04300"
                     /db_xref="GeneID:10920916"
     CDS             complement(456607..457104)
                     /locus_tag="CNE_2c04300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680643.1"
                     /db_xref="GI:339321749"
                     /db_xref="GeneID:10920916"
                     /translation="MHHTDDALPEHEFTAIHEPRLWRDKGWTARVIKNEDGDGWAVEM
                     IRDGSAEPALVGPWTMGRNKVDPKPLDATAHQTLVKTASEVIRRHEQQLHAQLNKQVS
                     IESESGTVMVKLVITPDEFEPFGTLTAEDSFGDVLATVKVRPDFRLTRDSAERWAAGG
                     FDRIR"
     gene            complement(457322..459685)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /db_xref="GeneID:10920917"
     CDS             complement(457322..459685)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /EC_number="3.5.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidase FmdR"
                     /protein_id="YP_004680644.1"
                     /db_xref="GI:339321750"
                     /db_xref="GeneID:10920917"
                     /translation="MHLLRFSTEAYPRNRRGAAWRDELRAARLHCESLCADHTLHGTI
                     QSRTTPAGIELTCIASVPQTLAITSGDGRGLMLVMLTEGEAHLAAPELREPLRPGQVV
                     CVPEHAARRLALATSFRMLIVHIGQALLSARITAPLPRSALVLSGDSAELFARLLQSM
                     AASFDTIVSANAKAIQPFDNTITACLDAALADSQPSAPPDMTPSRAAVFARVCSRIDA
                     RLAEPELSLAAIAADERMSARYLQKLFEKSGSSFSAYLRTSRLERCRADLANHQYDKL
                     SVSDICYRWGFNDPSHFSHAFREQFGLSPRAYREQTANTPEHRPPQNVSRGLPAHAKR
                     APASPGAPANDVPAARLQPAPTIVPITQARSHAARPEGRHHWLQATDKTVHWGYLSHD
                     LPPVLEVMPGDTVTIETLTQHASDDRERMIEGDAGAESVFHWTAEQKNVNRRGAGPID
                     ASVYGRGAGEGFGVHICTGPVAVRGAMPGDVLEVRILDVRPRPCCNPRFAGRAFGSNA
                     ATWWGFHYRDMLTEPREREVVTVFEIDCERADSRARAVYNFRWTPQRDPFGVLHPTID
                     YPGVPVDHDTIVKNYDVLRDIEIPVRPHFGVIAVAPAQDGLIDSIPPSSFAGNLDNWR
                     VTRGASVYLRVAVPGALLSIGDPHASQGDSELCGTAIECSLTGDFQLILHKSTMIDRD
                     APFADLSYPLVETADEWILHGFSSPNHLAELGQMAQSHIYLKSTLDDAMRDAFRKTRR
                     FLMSVKGLSEDEAVALISVAVDFGITQVVNGNWGVHAIIRKSMFTRR"
     misc_feature    complement(459128..459628)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    complement(458759..459016)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(458759..458884)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(457334..458557)
                     /gene="fmdR"
                     /locus_tag="CNE_2c04310"
                     /note="Acetamidase/Formamidase family; Region: FmdA_AmdA;
                     cl19826"
                     /db_xref="CDD:268179"
     gene            complement(459783..459974)
                     /locus_tag="CNE_2c04320"
                     /db_xref="GeneID:10920918"
     CDS             complement(459783..459974)
                     /locus_tag="CNE_2c04320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680645.1"
                     /db_xref="GI:339321751"
                     /db_xref="GeneID:10920918"
                     /translation="MLEIALGSTELQAAAVGLVTGVIYTAVRAPIPAPNVLGGIFAIF
                     GTFAGFVLVAAMRGQLLFG"
     misc_feature    complement(459804..459947)
                     /locus_tag="CNE_2c04320"
                     /note="XapX domain; Region: XapX; TIGR03510"
                     /db_xref="CDD:132549"
     gene            complement(460007..460216)
                     /locus_tag="CNE_2c04330"
                     /db_xref="GeneID:10920919"
     CDS             complement(460007..460216)
                     /locus_tag="CNE_2c04330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680646.1"
                     /db_xref="GI:339321752"
                     /db_xref="GeneID:10920919"
                     /translation="MQYVYIGRNELVALIVGLVTGTLYSWLNLPIPAPNVTGGICAIL
                     FTYIGYLIVHAWRRTIAFGRPPESR"
     misc_feature    complement(460046..460192)
                     /locus_tag="CNE_2c04330"
                     /note="XapX domain; Region: XapX; TIGR03510"
                     /db_xref="CDD:132549"
     gene            complement(460249..461274)
                     /gene="fmdA"
                     /locus_tag="CNE_2c04340"
                     /db_xref="GeneID:10920920"
     CDS             complement(460249..461274)
                     /gene="fmdA"
                     /locus_tag="CNE_2c04340"
                     /EC_number="3.5.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidase FmdA"
                     /protein_id="YP_004680647.1"
                     /db_xref="GI:339321753"
                     /db_xref="GeneID:10920920"
                     /translation="MLHDLPARPETVHWGYFDAAKAPALTVKSGDLIRAEAVTHHAGD
                     APDLMMDDAIREIFRAIPHDDRNPGVHIMTGPIYVEDAKPGDVLEVRYLQMIPRFRFG
                     ANAAAHWGQLYKEFEKERVTIYELDQRSNTAHALYAFDYPGKMTIPGKLVDDRECCRQ
                     PALAGVRVPVRPHLGTAGVAPDARGRVTTVEPGLHGGNIDNWRIGAGATMYYPVQVDG
                     ALFSIGDPHISQGDGEVSGTAIEASLNVLFQVVLRKDFHFPSPLLETPDCWVVHGFHE
                     DLDEAGKNAARDMIHLLTEQQGLSRDDAYSLMSVSADFGVTQVVDGTQGIHCTMPRSI
                     FPPKDKG"
     misc_feature    complement(460267..461262)
                     /gene="fmdA"
                     /locus_tag="CNE_2c04340"
                     /note="Acetamidase/Formamidase family; Region: FmdA_AmdA;
                     cl19826"
                     /db_xref="CDD:268179"
     gene            complement(461566..462888)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /db_xref="GeneID:10920921"
     CDS             complement(461566..462888)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /EC_number="2.7.13.3"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="CAI-1 autoinducer sensor kinase/phosphatase
                     CqsS"
                     /protein_id="YP_004680648.1"
                     /db_xref="GI:339321754"
                     /db_xref="GeneID:10920921"
                     /translation="MDAKVAQAEDGRTSLAGVARHAWQTVFETAARATLLDEESVIRL
                     RRIQMVGALGVIGHPLYYVIWSYIFPQPYENLWLRLVCTALFVPLLFASAFSDRRWLP
                     PYALFAITVGLPFAFIFFYLENGGSMVWAESVIIAVVILYHFNTAFATIALFSGAAAA
                     IALFVLAGNSMGGIPWEPVLLQLPVIGFVIAVLVVIKMDRQLLAEQKRRGMAAALATV
                     AHELRTPLTSLAMTARGLKARLPAALDQDTPLRDGLMQAVARMESDLAHISNSIELLV
                     ANSKNPDNATQELFELGGVIRDAVGRFPFEQSDLELVTVDLPGPAYVMGNAQLFGLVT
                     TNLLKNALEATKRAGKGTIHIRCEVRPDAVHVVFRDTATGVPPQVLARMFQPFFSYPA
                     HRGTGIGLAFCQKVLNSWGASISCRSEEHVFTEFDMRFPRKGKWPEAQ"
     misc_feature    complement(461572..462513)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(462049..462276)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(462064..462066,462076..462078,
                     462085..462087,462097..462099,462106..462108,
                     462118..462120,462193..462195,462202..462204,
                     462214..462216,462223..462225,462235..462237,
                     462256..462258))
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(462229..462231)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(461599..461892)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(461611..461613,461617..461622,
                     461635..461637,461641..461643,461689..461700,
                     461764..461769,461773..461775,461779..461781,
                     461785..461787,461860..461862,461869..461871,
                     461881..461883))
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(461869..461871)
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(461692..461694,461698..461700,
                     461767..461769,461773..461775))
                     /gene="cqsS1"
                     /locus_tag="CNE_2c04350"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(462897..464189)
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /db_xref="GeneID:10920922"
     CDS             complement(462897..464189)
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /EC_number="2.3.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="CAI-1 autoinducer synthase CqsA"
                     /protein_id="YP_004680649.1"
                     /db_xref="GI:339321755"
                     /db_xref="GeneID:10920922"
                     /translation="MFSEAEPPHSMRHASRAKAPTLPPWITARMAQHFDERMGKLWGG
                     DHLLHGRTPGPDALHLSSNDYLCLLGESSLVQAQARAFLNEEPELLMSSVFQHGDTPQ
                     RRVERKIADLMQAEDGLIAQSGWAANVGLVQCIAGPGIPVYIDMNGHASLWEGIIAAG
                     AQAVPVRHNDCEHVRRQLERFGPGVIMVDSVYSTTGSVAPLEDYVDLAEASGCVLVVD
                     ESHSLGTHGPSGGGLVRALGLSERVHFRTASLAKAFAGRAGYVACSTDFKDFFAVESR
                     PAIFSSGLLRHEVAWFDAVTDFVATADERRARLHAITRDTRAAIAELGYNIGEGSEQI
                     IGLEAGTEPQVKVLRDALQSRGIFGAVFCAPATPKNRALMRLTLHAKLAANEIDRLVS
                     VLASIRDEVRLDEWSSTRRARRKSQNPTSGPLAGSREE"
     misc_feature    complement(462963..464186)
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07179"
                     /db_xref="CDD:180866"
     misc_feature    complement(463005..464030)
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    complement(order(463434..463436,463443..463445,
                     463527..463529,463536..463538,463623..463625,
                     463806..463808,463815..463820))
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(463434..463436)
                     /gene="cqsA"
                     /locus_tag="CNE_2c04360"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(465073..466269)
                     /gene="bcd1"
                     /locus_tag="CNE_2c04370"
                     /db_xref="GeneID:10920923"
     CDS             complement(465073..466269)
                     /gene="bcd1"
                     /locus_tag="CNE_2c04370"
                     /EC_number="1.3.8.1"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain specific acyl-CoA dehydrogenase"
                     /protein_id="YP_004680650.1"
                     /db_xref="GI:339321756"
                     /db_xref="GeneID:10920923"
                     /translation="MIRDSARQQALLADIRRFVLETCIPLEAEIDRTDVIPEPVVEQM
                     RRLGLFGHSIPEAYGGAGLTTEELALVNIEVSQAATVFRARFGGNTGIASESLVADGT
                     EAQRQRYLPQLASGKVTGCFALTEPEAGSDATSLQTTARQDGDHYVLNGSKCFITNAP
                     IADLFTVFARTDPDTPGAHGISAFLIERGTPGLSTSEPERKMGQHGSPVGDVYLKDCR
                     VTASAIVGGKPNVGGKPNVGFKTAMKALNKQRINLAGLCVGPAIRLVDEMVRYAAQRR
                     QFGKPIADYQLVQQMIADSNTELHAARALVLDTARKRDAGEDVTMEASMCKLFASEMA
                     GRVADRAVQVFGGSGYMARTVAERFYRDVRLFRLYEGTTQIHQLNIARRTMEARGAAL
                     VGGSAA"
     misc_feature    complement(465121..466257)
                     /gene="bcd1"
                     /locus_tag="CNE_2c04370"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(465124..466248)
                     /gene="bcd1"
                     /locus_tag="CNE_2c04370"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(465148..465150,465154..465156,
                     465160..465168,465799..465801,465805..465807,
                     465898..465900,465904..465906,465994..465996))
                     /gene="bcd1"
                     /locus_tag="CNE_2c04370"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(466311..467309)
                     /locus_tag="CNE_2c04380"
                     /db_xref="GeneID:10920924"
     CDS             complement(466311..467309)
                     /locus_tag="CNE_2c04380"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680651.1"
                     /db_xref="GI:339321757"
                     /db_xref="GeneID:10920924"
                     /translation="MDAIQPLRRLAAGMLACAALMPLPALAAPDNAARFPDRPIRIIV
                     PFSAGGVVDSVTRITAENMARVLKQPVIVENKTGAGGAIGADFVARSPADGYTLLAVS
                     PSYVVGPLLNPSIQGKGGKDFRAVAGIGAVPNVIVVPAASPLRTLPELLDAARSQPGT
                     LTYASAGVGTSNHLSAELLAQMTHVKLTHVPYKGQPEAMSDLLGARVSMMALTSAIAR
                     QQVQSGKLRALAVTSAKRSAVMPDVPTVAEAARLPGYEVGGWFGLVAPQGTPDAVVRK
                     LAEAAAQATSDPATARRLAELGMDLAPQSTAVFDRFLDTETKKWTGVLKTAGITAQ"
     misc_feature    complement(466323..467147)
                     /locus_tag="CNE_2c04380"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(467433..468278)
                     /locus_tag="CNE_2c04390"
                     /db_xref="GeneID:10920925"
     CDS             complement(467433..468278)
                     /locus_tag="CNE_2c04390"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004680652.1"
                     /db_xref="GI:339321758"
                     /db_xref="GeneID:10920925"
                     /translation="MEPKQPPHSMDRNPEHLPLPGLASEDALATDRQFATNLARGLEV
                     LRAFTPSSPVLGNQDIVARTGLPKATVSRLTYTLGLLGFLSRVPGNQKYRLGAGVLAL
                     AYPMLAGLAIRQVARPYMEAIARETGCTVNLGMRERLSVVYVDSCRLDPGNLYQPDIG
                     STRPLLASAIGRAVLLACSADERTALLNRLRVDDPERFNVERQMWADDQKHFRAHGYC
                     LSRGEWRPEIHAIAAPVRQSLHEDPFALNCTIAASRNRDNMLEREVAPRLREAVRQIE
                     LSCAR"
     misc_feature    complement(467904..468173)
                     /locus_tag="CNE_2c04390"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(467451..468167)
                     /locus_tag="CNE_2c04390"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(467451..467804)
                     /locus_tag="CNE_2c04390"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            468404..469636
                     /locus_tag="CNE_2c04400"
                     /db_xref="GeneID:10920926"
     CDS             468404..469636
                     /locus_tag="CNE_2c04400"
                     /EC_number="2.8.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA transferase"
                     /protein_id="YP_004680653.1"
                     /db_xref="GI:339321759"
                     /db_xref="GeneID:10920926"
                     /translation="MQDQEHAVSPDAHCTGPLGGLRILDMATVVAGPFSATLCADMGA
                     DVVKLELPDGSDPLRGLEPVTEDHALYWKVTNRGKRGISLDVRTPRGREIFLRLLPQF
                     DVLVENFRTGTLARWGLDLDTLHAANPKLIVLRLTGFGQTGPDAARPGFARIFEARSG
                     LTNLAGTAQSGPMHMNYPVGDMIAGLFGAFAIATAAAEQRARPGQRGREIDLAATEAL
                     FRLLDPLAIEYEQLGHVRQRAGNRTTYAAPSNMYRTADEIWVTVVASSDATFRRLAEA
                     IGAPQLAQAPEYATNAGRVRNIEALDGSIAEWFAAQPYAAVAARLEQCQVPFSKVFSI
                     ADIVDDPQMAARQAIVRLPDPDLGSVPAPCVVPRFSGYAPPSPRTGPDVGEHNAEVYG
                     QLGIGDEELARLRAEGVV"
     misc_feature    468446..469633
                     /locus_tag="CNE_2c04400"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(469829..470410)
                     /locus_tag="CNE_2c04410"
                     /db_xref="GeneID:10920927"
     CDS             complement(469829..470410)
                     /locus_tag="CNE_2c04410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680654.1"
                     /db_xref="GI:339321760"
                     /db_xref="GeneID:10920927"
                     /translation="MNTIPLATAKARLAQYVEAKDNNRPTLIHEAFAPDASLTFSIDT
                     DSISFPPRAEGADAIAATLVSEFAKTFDRCRTYYIGDVGAALDGNAMTIPWLVVMRET
                     AASALRVGKGYYRWGFAAGDDGTYRIASLHIHIERIDTIADPGAVTLAALQAALPYPW
                     LPAPVLAASIEAQASAQPALGFLNVFAQAARLP"
     misc_feature    complement(470015..470374)
                     /locus_tag="CNE_2c04410"
                     /note="SnoaL-like domain; Region: SnoaL_4; pfam13577"
                     /db_xref="CDD:257893"
     gene            470522..471064
                     /locus_tag="CNE_2c04420"
                     /db_xref="GeneID:10920928"
     CDS             470522..471064
                     /locus_tag="CNE_2c04420"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004680655.1"
                     /db_xref="GI:339321761"
                     /db_xref="GeneID:10920928"
                     /translation="MATTPANKNLTVTHPACLVDGSDREFRHLVNGLLPFAARLLSVR
                     DGFGGLIGLTGVQYSLIRSILHLSQQGEVTVNQLADHLHLSGPFITIETGKLKKLGLI
                     DKKAHPEDKRKMRLTITAAGTRLLNELLPVQQQINDVLFDGVSRTEFKVLCSVVDRLV
                     ANGDRAALDLEHLQARRQKG"
     misc_feature    470672..470965
                     /locus_tag="CNE_2c04420"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    470675..470956
                     /locus_tag="CNE_2c04420"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            complement(471061..472284)
                     /gene="iscS"
                     /locus_tag="CNE_2c04430"
                     /db_xref="GeneID:10920929"
     CDS             complement(471061..472284)
                     /gene="iscS"
                     /locus_tag="CNE_2c04430"
                     /EC_number="2.8.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase IscS"
                     /protein_id="YP_004680656.1"
                     /db_xref="GI:339321762"
                     /db_xref="GeneID:10920929"
                     /translation="MQSEPKTLPIYMDYSATTPVAPQVVEKMVPYLHQQFGNPASRSH
                     YYGWQAEEAVEAARAHVAALLNADPREIIWTSGATEGNNLAIKGAAHFYRGKGNHIIT
                     VKTEHKAVLDTCRELERQGFEVTYLDVGTDGLVDLDALRAAMRPDTILVSVMMVNNEI
                     GVIQPVAQIGELCRAAGVVFHCDAVQAAGKIAIDLEALKIDLLTVTAHKVYGPKGVGA
                     LYVRRKPRIRIEAQIHGGGHERGMRSGTLPTHQIVGMGEAFRLAKLELAEEARRVGAL
                     RDRLLAGLSRLDEVYVNGSLAHRIPHNLNISFNYVEGESLIMGIKDVAVSSGSACTSA
                     SLEPSFVLRALGRSDELAHSSIRFTLGRYTTEAEVDEVIRQVSETVTRLRELSPLWEM
                     HQEGIDVGTVQWAAH"
     misc_feature    complement(471064..472266)
                     /gene="iscS"
                     /locus_tag="CNE_2c04430"
                     /note="cysteine desulfurase; Provisional; Region:
                     PRK14012"
                     /db_xref="CDD:184450"
     misc_feature    complement(order(471658..471660,471667..471669,
                     471727..471729,471736..471738,471820..471822,
                     472039..472041,472048..472053))
                     /gene="iscS"
                     /locus_tag="CNE_2c04430"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(471658..471660)
                     /gene="iscS"
                     /locus_tag="CNE_2c04430"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            472655..473200
                     /gene="ntaB1"
                     /locus_tag="CNE_2c04440"
                     /db_xref="GeneID:10920930"
     CDS             472655..473200
                     /gene="ntaB1"
                     /locus_tag="CNE_2c04440"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase component B"
                     /protein_id="YP_004680657.1"
                     /db_xref="GI:339321763"
                     /db_xref="GeneID:10920930"
                     /translation="MAESSVGQGVKADAEADAEAHRRFRNALAMFATGVAVITAPREE
                     GLPVGITVASFNSVSLDPPLVLFSVDRRCLSLGDLRSARRYAVNVLAEAQQDISNRFA
                     RANSGKWEGIGFSKRNEDSHVLLPDALATFECEPYAMHDGGDHVIFIGRVVRHQARQD
                     GRPLIFFGGKYRALEDSPAAA"
     misc_feature    472736..473167
                     /gene="ntaB1"
                     /locus_tag="CNE_2c04440"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            473237..474721
                     /gene="hpaH"
                     /locus_tag="CNE_2c04450"
                     /db_xref="GeneID:10920931"
     CDS             473237..474721
                     /gene="hpaH"
                     /locus_tag="CNE_2c04450"
                     /EC_number="1.14.14.-"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate 3-monooxygenase oxygenase
                     component HpaH"
                     /protein_id="YP_004680658.1"
                     /db_xref="GI:339321764"
                     /db_xref="GeneID:10920931"
                     /translation="MIKTGNQHIVMLRDGREVYLDGKRVTDVTSHPAFRNSIRSYANL
                     YDFQAQPGNVDKMTFQPAGTDRRVSRIWELPTSYNELVERRQMLEAWTELHYGFMGRS
                     PDHVASCISGMYMGIDVFEQADPARAGALRDYYRYARDNDLFLTYVIVNPQANQSKSA
                     HEQEDKYLAVGIVDQDAEGITVRGAKMLATSGIMANEVFCSCIQPLREGDEMYALSFA
                     VPMNTKGLKVMSRKSYEANATSVFDNPLASRFDENDAVLYFDDVKVPWERIFVAGDVG
                     LCARQFHATPAHVYQNYQCQVRLMVKLRFLVGLAHRITEINGTSSFPQVREMLGQLAA
                     EAGMVEAWVYGMEAKGQVGKHGYFVPDRSMLYGSQVVTQQLYGKVLATLRELAGGGMI
                     MLPSSIEDFANPSLAGIIAKTQKSPVCSPEERVKFFKLAWDAVGSEFASRHNQYEMFY
                     AGATFVTKGHAYRTYDWQNASGLVDNMLGSYSLESELAKLPQAA"
     misc_feature    473237..474679
                     /gene="hpaH"
                     /locus_tag="CNE_2c04450"
                     /note="Aromatic ring hydroxylase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG2368"
                     /db_xref="CDD:225243"
     misc_feature    <473762..>474268
                     /gene="hpaH"
                     /locus_tag="CNE_2c04450"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    474065..474676
                     /gene="hpaH"
                     /locus_tag="CNE_2c04450"
                     /note="4-hydroxyphenylacetate 3-hydroxylase C terminal;
                     Region: HpaB; pfam03241"
                     /db_xref="CDD:251823"
     gene            474767..475147
                     /locus_tag="CNE_2c04460"
                     /db_xref="GeneID:10920932"
     CDS             474767..475147
                     /locus_tag="CNE_2c04460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680659.1"
                     /db_xref="GI:339321765"
                     /db_xref="GeneID:10920932"
                     /translation="MAITKLHDEFHTLDLESGWEVPHGYPSGIQQKILSGSLDENGRS
                     GSRTRLLRFQPGVFTTSPFVHEYWEEVYLLSGDLTVGNDANGKGGEAFVPNTYACRPP
                     GAFHGPFKSDGGCMLLEIHYYDPA"
     misc_feature    474848..475120
                     /locus_tag="CNE_2c04460"
                     /note="ChrR Cupin-like domain; Region: Cupin_7; pfam12973"
                     /db_xref="CDD:193446"
     gene            475150..476493
                     /gene="gatA1"
                     /locus_tag="CNE_2c04470"
                     /db_xref="GeneID:10920933"
     CDS             475150..476493
                     /gene="gatA1"
                     /locus_tag="CNE_2c04470"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="YP_004680660.1"
                     /db_xref="GI:339321766"
                     /db_xref="GeneID:10920933"
                     /translation="MEATIATAQRQLAAGSANALSLLASCVERICNPGSEGARVFPHG
                     VSMAARKQAQASDMLREQGVVGPLAGVPVSVKDLFDVQGDVTRAGARVLPERAASADA
                     PAIARLRAAGAVFVGRTNMTEFAYSGVGINPHYGTPRNPYDRQAGRIPGGSSSGAAVS
                     VTDGMALAAIGSDTGGSCRIPAALCGIAGFKPTARRVPLQGTVPLSPSYDSVGCLANT
                     VACCAAIDAVMAGEAPPAGPAPLAGLRLAVPSGLVLEGMSDEVAEVFSRTLRRLSAAG
                     ALLQDVSFDSWDQLAGIGANGGLVAAEASAWHGSLLAEQADRYDPRVLSRIRLADGQR
                     AADYLRMLQRRGELCRQADAELAGFDAVVLPTVPVVAPRIANLDDDEAFFRTNRLLLR
                     NPAIANMLDLCALSVPCHRLGDAPVGLMLFGRHLSDRRLLAIGMGIEAALRHERG"
     misc_feature    475150..476478
                     /gene="gatA1"
                     /locus_tag="CNE_2c04470"
                     /note="Amidase; Region: Amidase; cl11426"
                     /db_xref="CDD:264363"
     gene            476541..477767
                     /locus_tag="CNE_2c04480"
                     /db_xref="GeneID:10920934"
     CDS             476541..477767
                     /locus_tag="CNE_2c04480"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004680661.1"
                     /db_xref="GI:339321767"
                     /db_xref="GeneID:10920934"
                     /translation="MPDIRTGAAVLACATLFAATASAADPAPISDGVVKIGVLTDMSS
                     IFSDIGGKGSVVAAQMAVDDFGGKVLGAPIQVVSADHQNKTDVAATLARGWLDNQKVD
                     VIQDALPSSVALAVSNLGKLKHKIVIASGAGTTRLSNEDCSPYTIQYSYDTYAFAANT
                     VKALARRGDNSWYFLTVDYALGASLEKDGTEALSSVGGTLKGKARHPINSADLSSYLL
                     QGQSSGAKVIGLANAGADTVNAIKTAADFGINTAGKQKLAGLHMFISDIHSLGLQAAQ
                     GMTLTTSFYWDRDDATRAWSQRFFEKTGRMPTLVHAGVYSSTTHYLKAIQAARTDDSD
                     AVLARMRETPVNDFFAKNGTIRADGLMVHDMYLVEVKRPQESKRPWDYYKIKTVIPAS
                     EAFRPLSASACPLVRK"
     misc_feature    476643..477644
                     /locus_tag="CNE_2c04480"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins that belong to the type I periplasmic
                     binding fold protein family; Region: PBP1_SBP_like_1;
                     cd06327"
                     /db_xref="CDD:107322"
     misc_feature    476709..477644
                     /locus_tag="CNE_2c04480"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(476862..476870,476931..476939,477081..477083,
                     477237..477239,477321..477323)
                     /locus_tag="CNE_2c04480"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107322"
     gene            477835..478524
                     /locus_tag="CNE_2c04490"
                     /db_xref="GeneID:10920935"
     CDS             477835..478524
                     /locus_tag="CNE_2c04490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680662.1"
                     /db_xref="GI:339321768"
                     /db_xref="GeneID:10920935"
                     /translation="MKTLTFELDSRQGKSQRTVTIHQLIVAGWTGRDVEAMEAHIREL
                     EELGVKRPPYTPVFYRVAAQRLGPAPEIQVSGEASSGEAEFLLVRDGDDILVGIASDH
                     TDREAETYGITVSKQMCEKPCASALWRLSEVEGHWDQLVLRSYATIDGERVLYQEGPV
                     TAMRSPADLLQRFCGHGGEFGEGSAMLCGTLPAIGGIRPAERFEIELEDPVLGRTLRH
                     AYAVAALPVAG"
     misc_feature    477913..478494
                     /locus_tag="CNE_2c04490"
                     /note="Protein of unknown function (DUF2848); Region:
                     DUF2848; pfam11010"
                     /db_xref="CDD:256246"
     gene            478574..479347
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /db_xref="GeneID:10920936"
     CDS             478574..479347
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein BraF"
                     /protein_id="YP_004680663.1"
                     /db_xref="GI:339321769"
                     /db_xref="GeneID:10920936"
                     /translation="MHHDLILETRNLGKAFRGFTAVSDVNLRVRRGSIHALIGPNGAG
                     KTTCFNLLTKFLEPTTGTILFNGIDITREKPAQIARRGVIRSFQISAVFPHLTVMENV
                     RIGLQRQLGTAYQFWRSERSLDVLNDRAMELLEQVGLTEFAQTLTVNLPYGRKRALEI
                     ATTLAMEPELMLLDEPTQGMGHEDVDRVTQLIKKVSAGRTILMVEHNMSVVSSIADKI
                     TVLQRGAILAEGPYAEVSKDPRVMEAYMGTVDAELQGAH"
     misc_feature    478583..479317
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    478592..479296
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    478688..478711
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(478697..478702,478706..478714,478835..478837,
                     479093..479098,479189..479191)
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    478826..478837
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    479021..479050
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    479081..479098
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    479105..479116
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    479177..479197
                     /gene="braF1"
                     /locus_tag="CNE_2c04500"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            479365..480090
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /db_xref="GeneID:10920937"
     CDS             479365..480090
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein LivF"
                     /protein_id="YP_004680664.1"
                     /db_xref="GI:339321770"
                     /db_xref="GeneID:10920937"
                     /translation="MTTSNTPALEIRDLHAWYGESHILHGVDLTVNRGEVVTLLGRNG
                     AGRTTTLRAIMGLTGTRKGSIKVNGHETISLPTHKIAHYGIGYCPEERAIFSSLSCEE
                     NLMLPPVLKGADTSKGMSETDIYEMFPNLKERRQSQGTRLSGGEQQMLAVGRILRTGA
                     NLLLLDEISEGLAPVIVQALARMILMLKQKGYTVVMVEQNFRFAAPLADRFYVMEHGS
                     IVERFAANELQAKMPVLHELLGV"
     misc_feature    479380..480087
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    479389..480054
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    479485..479508
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(479494..479499,479503..479511,479632..479634,
                     479860..479865,479959..479961)
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    479623..479634
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    479788..479817
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    479848..479865
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    479872..479883
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    479947..479967
                     /gene="livF1"
                     /locus_tag="CNE_2c04510"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            480101..480985
                     /locus_tag="CNE_2c04520"
                     /db_xref="GeneID:10920938"
     CDS             480101..480985
                     /locus_tag="CNE_2c04520"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004680665.1"
                     /db_xref="GI:339321771"
                     /db_xref="GeneID:10920938"
                     /translation="MNLFEIPLPALLSQLLLGLVNGAFYAMLSLGLAVIFGLLSVINF
                     AHGALFMLGAVLAWAGMTYAGLSYWAMLLLSPLVVAALGVVIEKTMLRWIYKLDHIYG
                     LLLTLGITLVVEGIFRSVYGVSGLPYGPPEALQGASDLGFMRLPNYRVWVVGASLAVC
                     LSTWYVIEKTRLGAYLRAGTENAKVVEAFGVNVPRMVTLTYGFGVALAAFAGVLAAPV
                     MQVSPLMGQNLIIVVFAVVVIGGMGSIMGAILTGLGLGVIEGLAKVLYPEASSTVVFV
                     IMVVVLLLRPAGLFGKEK"
     misc_feature    480158..480907
                     /locus_tag="CNE_2c04520"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    480650..480706
                     /locus_tag="CNE_2c04520"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            480985..482001
                     /locus_tag="CNE_2c04530"
                     /db_xref="GeneID:10920939"
     CDS             480985..482001
                     /locus_tag="CNE_2c04530"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004680666.1"
                     /db_xref="GI:339321772"
                     /db_xref="GeneID:10920939"
                     /translation="MSGQSIAAIGVRQQQVAGRLPKQVIYGVVLACLLAAPLAGAYPV
                     FVLKVLCFALFACAFNLLIGYTGLLSFGHAAFFGGAGYAAGHALKVWGVTPEIGLILG
                     TAAGALIGYVVGSLAIRRQGIYFSMITLALAQMLFFICLQAPFTGGEDGLQGIPRGKL
                     FGVLPLSDDLTLYYVALAIIVAAFALIVRTVHSPFGQILKAIKENEPRAVSLGYDVDH
                     FKLTAFVLSAALSGLAGSVKALVLGFETLSDVHWSMSGMVILMTLLGGLGTLTGPIIG
                     AFVVIALENKLGELGGYLAAVTGIDWFNGLGESVSMVTGIIFIVCVLTFRKGIVGSLG
                     RGPE"
     misc_feature    481129..481977
                     /locus_tag="CNE_2c04530"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    481603..481659
                     /locus_tag="CNE_2c04530"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(482081..483349)
                     /gene="dadA1"
                     /locus_tag="CNE_2c04540"
                     /db_xref="GeneID:10920940"
     CDS             complement(482081..483349)
                     /gene="dadA1"
                     /locus_tag="CNE_2c04540"
                     /EC_number="1.4.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="YP_004680667.1"
                     /db_xref="GI:339321773"
                     /db_xref="GeneID:10920940"
                     /translation="MKSIAVIGGGITGVTTAYALARRGFSVTLFERHRYAAMETSFAN
                     GGQLSASNAEVWTHWSTIVKGMKWMLRNDAPLLLNPRPSWHKLSWFAEFIAAIPHYRR
                     NTIETARLAIAAREHLFDWAAQEGIDFDLKKEGILHIYRDKAGFDHAGRVSALLAQGG
                     LERRAVTPEEMRAIEPTLAGSYYGGYFTESDSTGDIHKFTSGLAAAIDRLGVRCLYGQ
                     DVRAVKTDGRRATVTVQDGADTASSTFDGAVICAGTASRALAAGLGDRVNIYPVKGYS
                     ITVNLTDEASRAAAPVVSLLDDETKLVTSRLGDDRFRVAGTAEFNGYNRDIRADRIRP
                     LVEWVQQCFPGVSTRSVVPWAGLRPMMPDMLPRVGRGRTACIFYNTGHGHLGWTLSAV
                     TADMVAGIVYQHLGAKLAVAPGASLALAKA"
     misc_feature    complement(482126..483349)
                     /gene="dadA1"
                     /locus_tag="CNE_2c04540"
                     /note="D-amino acid dehydrogenase small subunit;
                     Provisional; Region: PRK12409"
                     /db_xref="CDD:237093"
     misc_feature    complement(<483251..483346)
                     /gene="dadA1"
                     /locus_tag="CNE_2c04540"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(482156..483292)
                     /gene="dadA1"
                     /locus_tag="CNE_2c04540"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            483780..486110
                     /locus_tag="CNE_2c04550"
                     /db_xref="GeneID:10920941"
     CDS             483780..486110
                     /locus_tag="CNE_2c04550"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane receptor TonB dependent"
                     /protein_id="YP_004680668.1"
                     /db_xref="GI:339321774"
                     /db_xref="GeneID:10920941"
                     /translation="MLRSGGVSQKKRRQQGFPVKKNRIALAVSAVLMGPAVAAAQVVD
                     ALEPLQEVVVSAKSERGETPAIPPNTPSPAYGISSRRMADFNVVNTEDALKYAPNLAV
                     RKRFIGDMNSIISVRSTSSRQSARGLVYADGLLLSNLLGSDFSFPPRWSLVNSAEIER
                     MDVLYGPYSALYPGNSLGATVLITTRTPEKFEGDASVQLFTQRFSLYGTHDNFNGVHA
                     NAYVGDRVGPFSWLVSVDRQDSKSQPLSFYTAARSTARATSADKPVTGAHFDQDQTGR
                     DRVVMGVNSEGVTHTVQDQLKLKLGYDITNTLQAQFTAAYWQQDRSSATGSYLRDASG
                     NVVSNGPVNIGGYEYVIPANAFAPSNGEDARWLYGLSLRTRNETGWNFSGVASLFDVS
                     KDISRSANTVGSGPGTVTYGDGTGWRTLDLKADYRPQQLQGGHWVTFGYHYDNYRLSN
                     TTYNTSDWQAATITAFNNAFAGKTETQALYAQDAWYFAEDWKLIPGVRYEHWRAYDGS
                     RSQPGADIGYPVRSESNWSPKLALEKAFGQDWLGRLSLGQAYRYPTVSELFQGRITGT
                     ALINNDPNLRPERSFSKDLTFERTLDSSYFRVSVYEDDIRDALVSQTNTTVFPTVTSF
                     QNVDRVRTRGIELAYDARDVFVSGFDLSASGAYNHSKTLENANNPASVGKYFYRIPKW
                     RANLMGTYRITPAWAGTLAMTYSGRQYNTLDNSDVNPDTFGGTSSFLTFDVKVTYRPA
                     KNVRLGLGIDNLTDQRYYVYHPYPGRTFYAEAKLSF"
     misc_feature    483846..486107
                     /locus_tag="CNE_2c04550"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    484008..486107
                     /locus_tag="CNE_2c04550"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(484008..484025,484053..484082,484119..484130,
                     484146..484163,484191..484196,484242..484274,
                     484308..484334)
                     /locus_tag="CNE_2c04550"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    484959..484961
                     /locus_tag="CNE_2c04550"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            486136..487356
                     /locus_tag="CNE_2c04560"
                     /db_xref="GeneID:10920942"
     CDS             486136..487356
                     /locus_tag="CNE_2c04560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680669.1"
                     /db_xref="GI:339321775"
                     /db_xref="GeneID:10920942"
                     /translation="MQGVCPSFRLIVAGLMACAALAATAQTHGDHAGHGSQAKTAKMS
                     ELGTGAAFDREGKLWVAYKDGPYVAVRASTDYGRSFGPAQHVNSVPEQVAADHESRPK
                     VAAGRDGEIYVTWTQPLPKPWTGFIRFARSTDGGKSFAEPLTVHANRDQIAHRFDAIA
                     VDNAGRVFVSWIDKRDVVASEARKQPYTGAAVYYAVSADQGKTFQGDYKIADQSCECC
                     RIALSPTPDGKMLALWRHVFPPNARDHALALLGTDGRATPMQRATFDDWRIDACPHHG
                     PGASVAPDGTVHMVWFNVREGKPTVSVGRWKDGKLLAQRPLDDPRAQHADIVALKDNE
                     IAVTWKSFDGQQTRLSAMLSQDGGKTWQTRKLAGTERDSDQPHLLQHAGRAYVLWRTE
                     AEGFQVFPLGKEGA"
     misc_feature    486514..487224
                     /locus_tag="CNE_2c04560"
                     /note="BNR repeat-like domain; Region: BNR_2; pfam13088"
                     /db_xref="CDD:257491"
     gene            487353..487850
                     /locus_tag="CNE_2c04570"
                     /db_xref="GeneID:10920943"
     CDS             487353..487850
                     /locus_tag="CNE_2c04570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680670.1"
                     /db_xref="GI:339321776"
                     /db_xref="GeneID:10920943"
                     /translation="MMPSRRKLLAAAVLTLAMTAANAGSAPAERVAVFASATQLAASQ
                     QGKPFVLVVWSLDCVYCKRNFDAIGKLRAQHRDLRVVTLATDNPDALPQVQQLLQRVR
                     LTRNAWVFGHEPQERLRYAVDPDWMGEMPRTYFYRADGQRQGVSGVISDADWGKHLRW
                     AGIAG"
     misc_feature    487476..487775
                     /locus_tag="CNE_2c04570"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(487876..488865)
                     /locus_tag="CNE_2c04580"
                     /db_xref="GeneID:10920944"
     CDS             complement(487876..488865)
                     /locus_tag="CNE_2c04580"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680671.1"
                     /db_xref="GI:339321777"
                     /db_xref="GeneID:10920944"
                     /translation="MTSINPLRRHLLKTTAALGACALAPTLARAQAWPAKPIRLVVPF
                     APGGSSEIVARSTAAELTKLLGVSVFVENKPGAAGNIAMGEVARADDNHTLILGHIGT
                     LAVNPFIFPKLPYDPIKDFRAISLLSKVPSLYVVHPDVPAKNLKEFVALAKSKPGKLN
                     YGSAGNGSAGHLAFEYLKAATGTFITHVPYRGSGPQITDLLSGRLDAAAVGAPAIIQF
                     IKAGKLRCIATGTTQRIPQLPDVPTVAEQGYPGFEMTQWYGLLAPASLPQAAADKLAD
                     ATAKAVKSKSSVERLSADAAIVVGDTPAEFSRFIAQEQQRWKPIIARAGIKPD"
     misc_feature    complement(487888..488709)
                     /locus_tag="CNE_2c04580"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(488927..489907)
                     /locus_tag="CNE_2c04590"
                     /db_xref="GeneID:10920945"
     CDS             complement(488927..489907)
                     /locus_tag="CNE_2c04590"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680672.1"
                     /db_xref="GI:339321778"
                     /db_xref="GeneID:10920945"
                     /translation="MHARHAIAATIAAMITTTTLVQAADTAAAWPARPITIVVTYPPG
                     GGADLMARLIAPGLGRELGQTVIVENRPGAGGQIGAAYVAKAAPDGYTMMVDASSYAV
                     NPSLYPRLPYDPDKAFRPVGVLARYPNVLVATASFPASKVSDVMAMARQKPGSVAFAS
                     SGNGSAQHLAGVLFEQRAGVDLLHVPYKGGGPAMTDVIAGQVPLFFANVASSLQHIKA
                     GKLKPLAVTSHARTQALPSVPTMQEAGVASYEVYEWNAAFLPAATPDPIAAKLADALQ
                     KVMTSPEIRQRVAELGGEVVAAPPAQARQFIDGQTRLWAKVIRDGNIKPE"
     misc_feature    complement(488939..489760)
                     /locus_tag="CNE_2c04590"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(489934..490683)
                     /locus_tag="CNE_2c04600"
                     /db_xref="GeneID:10920946"
     CDS             complement(489934..490683)
                     /locus_tag="CNE_2c04600"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680673.1"
                     /db_xref="GI:339321779"
                     /db_xref="GeneID:10920946"
                     /translation="MPDNALFQTTTTAAGLSRYGQIAAELQARIVSGAWAPGSAIPAE
                     GALAKEFGIALGTIRQAIAVLVQQGLLERVQGKGTFVRKGLSGASLMRFFRFGGADGA
                     PAVPRSEILSCRAVRLDKAMATRFGLPTGARGLAISRRRWLDDTPRLLESIWLPLPRC
                     EALQQLPPVQWGDLLYPLLGSACGITVHRAVDEVTFRTLAADEAALLDLPDAHPCAVV
                     TRHAFDLGGSCIEYRLTRGDAFAFRYTADVR"
     misc_feature    complement(489955..490650)
                     /locus_tag="CNE_2c04600"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    complement(490438..490635)
                     /locus_tag="CNE_2c04600"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(490447..490458,490462..490467,
                     490495..490497,490504..490509,490513..490527,
                     490549..490554,490558..490560,490627..490629,
                     490633..490635))
                     /locus_tag="CNE_2c04600"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(489964..490371)
                     /locus_tag="CNE_2c04600"
                     /note="UTRA domain; Region: UTRA; pfam07702"
                     /db_xref="CDD:254372"
     gene            490809..491663
                     /locus_tag="CNE_2c04610"
                     /db_xref="GeneID:10920947"
     CDS             490809..491663
                     /locus_tag="CNE_2c04610"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="YP_004680674.1"
                     /db_xref="GI:339321780"
                     /db_xref="GeneID:10920947"
                     /translation="MSKRALPLVDTHFHVFDAGVAAPSARYRPPYAADLKGWHVRLAE
                     LGELYGVVVQPSFLGTDNAALLAALQAMPGRLRGVAVVDPEVTDQELATLHGAGVRGI
                     RLNLYGDPDWLRIATAPWRGLFSRIAGLGWHVELHTSNGDGAMVLAQLDAALGDAGAP
                     VVLDHFGRPGPAGTADAIFDVATAVRARRQVWVKISAPYRLASPQDWHGLAQRWREVV
                     GDDRLLWGSDWPWTNHEAPARVDECRMLAAWPGQGASGDSEEAGAALSAALRWRNAAA
                     LYGFAVKG"
     misc_feature    490833..491561
                     /locus_tag="CNE_2c04610"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(490842..490844,490848..490850,491205..491207,
                     491301..491303,491490..491492)
                     /locus_tag="CNE_2c04610"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(491686..492606)
                     /locus_tag="CNE_2c04620"
                     /db_xref="GeneID:10920948"
     CDS             complement(491686..492606)
                     /locus_tag="CNE_2c04620"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680675.1"
                     /db_xref="GI:339321781"
                     /db_xref="GeneID:10920948"
                     /translation="MEPITHDRLAGISAFVAAAEAGSFAQAAARLGLTRSAIGKAIAR
                     LEARVGTRLFVRTTRSLALTDDGQAFYERCAQALEDLDAAQLMLEAGRREAAGRVRVS
                     APVVFGRHHVAPLLLELADRHPQLRLEGNFTDRLVDFADDGIDLAIRSGRLPDSDMLV
                     ARPLGMQAMVLCAAPGYLRKHGTPASIADLASHRCLVYMHGGESVPWSLAGPDGNIAR
                     PELAHRLGFDDIDTIAAAAIRGAGLVNVPLWLVRQPLDQGTLVRVLPQASVIRTPLHL
                     VWPRTRFLPHKLRVTIDLLVEAIPAVLALD"
     misc_feature    complement(491695..492585)
                     /locus_tag="CNE_2c04620"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(492403..492567)
                     /locus_tag="CNE_2c04620"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(491722..492318)
                     /locus_tag="CNE_2c04620"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_6; cd08475"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(491785..491787,491866..491868,
                     491917..491919,492106..492108,492112..492114,
                     492157..492159,492274..492276,492286..492288))
                     /locus_tag="CNE_2c04620"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(491890..491892,491899..491904,
                     491923..491937,492025..492027,492211..492231,
                     492235..492237,492247..492249,492256..492261,
                     492265..492270,492280..492285))
                     /locus_tag="CNE_2c04620"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176164"
     gene            492699..493712
                     /locus_tag="CNE_2c04630"
                     /db_xref="GeneID:10920949"
     CDS             492699..493712
                     /locus_tag="CNE_2c04630"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent alcohol dehydrogenase"
                     /protein_id="YP_004680676.1"
                     /db_xref="GI:339321782"
                     /db_xref="GeneID:10920949"
                     /translation="MTSSMQRWQLSAFGRNNLRRVDAPIPVPGPGEVLVRVHAVALNY
                     RDLLIIQDGMGMPVQPPLVPGSDMRGEVVAIGEGVADFAPGDAVISTFFTGWLDGVQP
                     RRSMPLGVPGPGMLSEYVVLAEDSLVSAPRTLDAAQASTLTCAGLTAWQALAEATVTR
                     PGDTVVVIGTGGVALFAVQIARAQGARVIVVSGSDDKLARVQELGAAHGVHRGRTADW
                     PAAVRELTGGRGADHMLELAGGDNFGRSLAALAQGGRISVIGNLQGDELRASVYPVLH
                     GRVTVQGIGVSHRRALQDLVRAVDWLGLRPVIEREYDFGDLPAALDHLERGAFGKVVV
                     RLR"
     misc_feature    492711..493706
                     /locus_tag="CNE_2c04630"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR7; cd08276"
                     /db_xref="CDD:176237"
     misc_feature    492711..493703
                     /locus_tag="CNE_2c04630"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    order(492825..492833,492840..492842,493128..493130,
                     493140..493142,493203..493220,493272..493277,
                     493287..493289,493332..493334,493407..493412,
                     493416..493418,493473..493478,493548..493556)
                     /locus_tag="CNE_2c04630"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176237"
     gene            complement(493729..494424)
                     /locus_tag="CNE_2c04640"
                     /db_xref="GeneID:10920950"
     CDS             complement(493729..494424)
                     /locus_tag="CNE_2c04640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680677.1"
                     /db_xref="GI:339321783"
                     /db_xref="GeneID:10920950"
                     /translation="MASLDVAADIRAQLDAWQASGADQADPVRFRLMEALARRCAGHS
                     GAVRGLLDERLRGLAAAYAAIVQRYTGNDSDIADGGAPSTPTSSPTASALGALVHDIT
                     ARARPAVAVASNDARSPAPVPAHAPQSNAPLVDALADYFRETWARVSVEQHFRLSLER
                     VPENAGPLNTDHLVHRSLSLMRETSPEYLRHFLSYVEGMSWLEQLGAAAAAEKEAARA
                     AAAKKSARGKARK"
     misc_feature    complement(493810..494385)
                     /locus_tag="CNE_2c04640"
                     /note="Protein of unknown function (DUF2894); Region:
                     DUF2894; pfam11445"
                     /db_xref="CDD:256461"
     gene            complement(494417..495064)
                     /locus_tag="CNE_2c04650"
                     /db_xref="GeneID:10920951"
     CDS             complement(494417..495064)
                     /locus_tag="CNE_2c04650"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA/MotB-like protein"
                     /protein_id="YP_004680678.1"
                     /db_xref="GI:339321784"
                     /db_xref="GeneID:10920951"
                     /translation="MREDLDAGVEPTVPAWAVFGDLMSVLLGAFVLVLLGVIGVQMEL
                     SARLEAEVKQRQEEAQRRETLEKALAGPLAAGRVTLVNGRIGISGNVLFALNSDQLQP
                     DGRDLLKSLAQPLSAYLRSRDEILMVSGFTDDQQVREGNRRFADNWELSAQRALTVTR
                     TLIDAGIPPTSVFSAAFGSQQPVTPNADAEGRAKNRRVEISPVPRVTAGTVKPHG"
     misc_feature    complement(494420..495061)
                     /locus_tag="CNE_2c04650"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09040"
                     /db_xref="CDD:181620"
     misc_feature    complement(494465..494797)
                     /locus_tag="CNE_2c04650"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    complement(order(494477..494479,494489..494491,
                     494615..494617,494624..494629,494645..494647,
                     494666..494671,494777..494782))
                     /locus_tag="CNE_2c04650"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(495061..498198)
                     /locus_tag="CNE_2c04660"
                     /db_xref="GeneID:10920952"
     CDS             complement(495061..498198)
                     /locus_tag="CNE_2c04660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680679.1"
                     /db_xref="GI:339321785"
                     /db_xref="GeneID:10920952"
                     /translation="MTRYLTHIVAFLAGLAIVCWIAAGYAGTNFLALAVTLLIGGCYL
                     AGAFELYRYRQATATLAQAVASLSEAPASLGSWLERLHPSLRDSARLRVEGERVGLPG
                     PALTPYLVGLLVLLGMLGTFLGMVATLRGTGIALETATDLQAIRASLAAPVKGLGFAF
                     GTSVAGVATSAMLGLLSALCRGERIQAAQALDARIATTLRPYSRGHQRDEAFRLLQRQ
                     ADVMPALVERMQAMMTTMAEQNQALTERLAASQDAFHGKTEVVYTRLASSVEQSLKDS
                     IADSARASSAAIQPAVDATMAGLARETTALRDTVTHAVQQHLDGVSSRFESATAGVAD
                     TWNQALAGHQRASEALAADLRTSLDGFAQTFEQRSAGLLDGVATRLDTAAASAADAWR
                     EALSRQERTGEKLASDNQQALTAAAVAIGEQAATLVRTVGESHAGLQTQLAAHDAQRL
                     SAWADTLGTMTAGLRQELEQLNAHTVSRQDEISTTLAQSVREISAQTQAHASQTLAEI
                     DRLVQAASDAPKAAVALQAELASRDAQRFAAWTDTLGTMTAALRQEWEQLNAHTVSRQ
                     DEISTTLAQSVREISAQTQAHASQTLAEIDRLVQAASDAPKAAVALQAELASRDAQRF
                     AAWTDTLGTMTAALRQEWEQLNAHTVSRQDEISTTLAQSVRDISTQTQAHASRTLAEI
                     DRLVQAATDAPKAAVALQAELAARDEQRFASWTDTLGTIAATLRQQWEQASTHAATRQ
                     QEICEALAQTARAISTETQAHASTTLAEIDRLVQAAAEAPKAATTLQAELASQDAQRM
                     AAWTDTLGTMAASLRQEWEQASAHTVSRQQEICETLAVTARDMAAQAQAQATGTIAEV
                     AHLMQAASEAPKAAAEVIAELREKLTDGMARDNAMLEERSRMLETLGTLLDAVNHAST
                     EQRSVVDTLVATTADLLDRVGTRFTDKVESETGKLTDIASQVTGSAVEVASLGEAFGV
                     AVQLFSESNGKLIDHLQRIEVALDKSMTRSDEQLAYYVAQAREVVDLSMLSQKQILED
                     LQQRAGQQAPSAEAA"
     misc_feature    complement(498043..>498180)
                     /locus_tag="CNE_2c04660"
                     /note="UbiA family of prenyltransferases (PTases); Region:
                     PT_UbiA; cl00337"
                     /db_xref="CDD:260365"
     misc_feature    complement(497080..497238)
                     /locus_tag="CNE_2c04660"
                     /note="Domain of unknown function (DUF802); Region:
                     DUF802; pfam05650"
                     /db_xref="CDD:203299"
     gene            complement(498209..498949)
                     /locus_tag="CNE_2c04670"
                     /db_xref="GeneID:10920953"
     CDS             complement(498209..498949)
                     /locus_tag="CNE_2c04670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680680.1"
                     /db_xref="GI:339321786"
                     /db_xref="GeneID:10920953"
                     /translation="MLQVPRRTGFSGPTLVRLLARLTDADAPPPASSLSSQLSQWLGW
                     ADAIALSSALKANAPAAPPAARAADSTEARECARVRAALADAIVEDTTLAGKRRGPAR
                     PSALPDPVDAQVDYAVYRQRYLTLQQTMETAIGDLRGRLRGALSGHAPGMAKLAMVDA
                     VMERVLGAREQSLLGALPTMLEPHFQRLRQAEAAALAEAQAAGQPATARPGAWLGVFR
                     KDMQSVLLAELDIRWQPLEGLLAALQDS"
     misc_feature    complement(498212..498949)
                     /locus_tag="CNE_2c04670"
                     /note="Protein of unknown function (DUF3348); Region:
                     DUF3348; pfam11828"
                     /db_xref="CDD:256652"
     gene            499165..500232
                     /locus_tag="CNE_2c04680"
                     /db_xref="GeneID:10920954"
     CDS             499165..500232
                     /locus_tag="CNE_2c04680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680681.1"
                     /db_xref="GI:339321787"
                     /db_xref="GeneID:10920954"
                     /translation="MKTKLHRLKVLSAVLCVTLAACGGGGDGNGGGSGSSGGTGNSGN
                     TSGTGGTGGTGGTGGTGGSTATRTVMFEATPVTGTSAEFLTQLNGQGARGFRFVSGFY
                     FLGNPAGSEQKGVYVKDAQTTYSYELPQEPGGADVQAWVTAYEAWLNSHGARGFVWGG
                     PYMVGGQIHALMRKDNGSSSTFSYKVVVVDTNASLSAFVQNQANPLGADGYYLAVPAY
                     LGPFGVSSTVAIFRKDLQGSARYGYEVLSNPASDGDLVAQINTEGVRGYRFKVPFVSG
                     GTQVNLYEKDLSQSSTFRFYDFASQQTSAGFLTQANAEGQKGSSLMGAYGLPSGTIRD
                     FYFEPASCTGFLCDTRSLFGL"
     gene            500359..501048
                     /locus_tag="CNE_2c04690"
                     /db_xref="GeneID:10920955"
     CDS             500359..501048
                     /locus_tag="CNE_2c04690"
                     /codon_start=1
                     /transl_table=11
                     /product="NarL family response regulator"
                     /protein_id="YP_004680682.1"
                     /db_xref="GI:339321788"
                     /db_xref="GeneID:10920955"
                     /translation="MTRSQGAAENNNDDNIDDSGCRNYAIVVDDHPLMARGIAGYLAA
                     HCGFDAALHAADAKECAALTEREGCPALLVVDFWLPDGTAVGVLREAAARLPACKLLV
                     MSADDDARVCIKAREAGAHGFILKNEPPEVFATAVASLRRGRRWFQQAGPPSARRELP
                     LEPSELGLTARQAEVLGMMLRGLPNKRIALTLSVSEQTVKEHVTAILGKLGVRNRIEA
                     IALLHGRRLES"
     misc_feature    500434..501030
                     /locus_tag="CNE_2c04690"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    500434..500778
                     /locus_tag="CNE_2c04690"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(500443..500448,500584..500586,500608..500610,
                     500668..500670,500725..500727,500734..500739)
                     /locus_tag="CNE_2c04690"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    500584..500586
                     /locus_tag="CNE_2c04690"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(500593..500598,500602..500610)
                     /locus_tag="CNE_2c04690"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    500734..500742
                     /locus_tag="CNE_2c04690"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    500860..501027
                     /locus_tag="CNE_2c04690"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(500863..500871,500908..500916,500938..500943,
                     500947..500952,500956..500970,501001..501003)
                     /locus_tag="CNE_2c04690"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(500896..500898,500902..500904,500908..500910,
                     501001..501009,501016..501018,501025..501027)
                     /locus_tag="CNE_2c04690"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            501045..502841
                     /locus_tag="CNE_2c04700"
                     /db_xref="GeneID:10920956"
     CDS             501045..502841
                     /locus_tag="CNE_2c04700"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_004680683.1"
                     /db_xref="GI:339321789"
                     /db_xref="GeneID:10920956"
                     /translation="MKKALARLLGLSRPDADADISPRARARLLDMTFGRLVFSVNAIP
                     FVGLPFVIWLYVQQLDGGALLAWTLGYGVAAVWMQLRFRRYKQEREDDDALVRRWLPF
                     VQHVALVHGFCLSLAAVLTASLGGFDFKLLLYISIAAIVAANATHQTPILGVFQRFFV
                     ACWTLQIVNTPRSFPEHWPFVLPLALLYALAIYRHALIANQFFRQQVRLEDDGIRLAE
                     RYRLAKEEAEKALHAKNLFLTTASHDLRQPVHAMGFLIEAIARRNRDPALIPPLEDLR
                     RSVRSVHLMFNSLLDLSRIEGGIASPRNTAVAFAPLVEEVASLFREEARSRGLDLRVR
                     LPAGAAAVLADPALLRQSLVNLVHNALRYTKRGGVLVSARRRGSHWLLEVWDTGVGIA
                     SEEKGRVYSPFYRNEHAWRIDSAGHGLGLAVVARCATLMGATYGLDSVERRGSRFWLR
                     FPEAKPLAPTAIEPVYEPDGLSASTLLQGVCLIVEDDPLVTAAWTSLMEAWGVQAACA
                     ASGQEALALVDAGLQPQAILCDQRLRSGESGFEVLKALFERCPDASGAMVSGEFDSEA
                     LMQAEREGYLVLHKPLEPSQLHALLFQWLCAA"
     misc_feature    501423..502421
                     /locus_tag="CNE_2c04700"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    501735..501926
                     /locus_tag="CNE_2c04700"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(501753..501755,501765..501767,501777..501779,
                     501786..501788,501798..501800,501807..501809,
                     501867..501869,501876..501878,501888..501890,
                     501897..501899,501909..501911)
                     /locus_tag="CNE_2c04700"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    501771..501773
                     /locus_tag="CNE_2c04700"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    502089..502397
                     /locus_tag="CNE_2c04700"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(502107..502109,502119..502121,502128..502130,
                     502194..502196,502200..502202,502206..502208,
                     502212..502217,502296..502307,502353..502355,
                     502359..502361,502374..502379,502383..502385)
                     /locus_tag="CNE_2c04700"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    502119..502121
                     /locus_tag="CNE_2c04700"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(502206..502208,502212..502214,502296..502298,
                     502302..502304)
                     /locus_tag="CNE_2c04700"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    502488..502829
                     /locus_tag="CNE_2c04700"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(502497..502502,502632..502634,502659..502661,
                     502719..502721,502767..502769,502782..502787)
                     /locus_tag="CNE_2c04700"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    502632..502634
                     /locus_tag="CNE_2c04700"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(502641..502643,502647..502649,502653..502661)
                     /locus_tag="CNE_2c04700"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    502782..502790
                     /locus_tag="CNE_2c04700"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            503020..504396
                     /locus_tag="CNE_2c04710"
                     /db_xref="GeneID:10920957"
     CDS             503020..504396
                     /locus_tag="CNE_2c04710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680684.1"
                     /db_xref="GI:339321790"
                     /db_xref="GeneID:10920957"
                     /translation="MSISNRAVAASMLAVSMLAGLAGCHSPSAAALAAASAVTSRPDP
                     AAVSEQDINDAYVYLLGRLLVLRQQQIDFQKEGFQWNRIIHRDVGGVSWANPNLDVAY
                     SEAWVAVDEKTCTVFSVPAIKGRYYTIQFLNGWGETVANINERNYPDHPSGEFAMCLK
                     GATAALSPNARRIDLPAKTSRVLARVEIGADKKQAIALQHQITTRITGTPTIAPVPAT
                     PAFSNDKLPGVEAFDSAVVALRSEPDINPGMEPIQAKVRAVSAAVASSPAERARVDKI
                     IREKTLPAFFQSFSTAGTVRNGWNRPATIGKYGSDYQTRTRIDLGGIWANSTDEVVYF
                     KTDTDGTGTKLDGGNVYTITFPKGELPARHVKYFWSVIAVDSRNFRVIPNAKNRFLIN
                     KQSRLSYGTDDSLTLYFGPARPKDAPDGNWLPTPKGKNYNLTFRLYGPDQPVLSGEWF
                     PAPLVKRN"
     misc_feature    503179..504387
                     /locus_tag="CNE_2c04710"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5361"
                     /db_xref="CDD:227659"
     misc_feature    503260..503628
                     /locus_tag="CNE_2c04710"
                     /note="Protein of unknown function (DUF1254); Region:
                     DUF1254; pfam06863"
                     /db_xref="CDD:253949"
     misc_feature    503878..504360
                     /locus_tag="CNE_2c04710"
                     /note="Protein of unknown function (DUF1214); Region:
                     DUF1214; cl08447"
                     /db_xref="CDD:263661"
     gene            complement(504448..504894)
                     /locus_tag="CNE_2c04720"
                     /db_xref="GeneID:10920958"
     CDS             complement(504448..504894)
                     /locus_tag="CNE_2c04720"
                     /codon_start=1
                     /transl_table=11
                     /product="bleomycin resistance protein/dioxygenase"
                     /protein_id="YP_004680685.1"
                     /db_xref="GI:339321791"
                     /db_xref="GeneID:10920958"
                     /translation="MLMRRLRESPLAGVMIWHSCATTEQKTMNLSAGIPILRIFSVDK
                     AKEFYLDFLGFTLDWEHRFEDGLPLYAQVRRSGLTLHLSEHHGDATPGSTVFVTVEDI
                     DALQRELSAKAYPYARPGVEDVGWGRMLQVADPFGNRLRFCEVSGD"
     misc_feature    complement(504463..504795)
                     /locus_tag="CNE_2c04720"
                     /note="Bleomycin binding protein (BLMA) and similar
                     proteins; BLMA confers bleomycin (Bm) resistance by
                     directly binding to Bm; Region: BLMA_like; cd08349"
                     /db_xref="CDD:211357"
     misc_feature    complement(order(504469..504471,504571..504573,
                     504580..504585,504598..504615,504652..504654,
                     504658..504666,504685..504687,504787..504795))
                     /locus_tag="CNE_2c04720"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:211357"
     misc_feature    complement(order(504472..504474,504478..504486,
                     504496..504498,504502..504504,504520..504522,
                     504607..504609,504643..504648,504652..504654,
                     504685..504687,504718..504723))
                     /locus_tag="CNE_2c04720"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:211357"
     gene            504970..505941
                     /locus_tag="CNE_2c04730"
                     /db_xref="GeneID:10920959"
     CDS             504970..505941
                     /locus_tag="CNE_2c04730"
                     /codon_start=1
                     /transl_table=11
                     /product="TauT family ABC transporter permease"
                     /protein_id="YP_004680686.1"
                     /db_xref="GI:339321792"
                     /db_xref="GeneID:10920959"
                     /translation="MNPTHDSRRRLLLAAAGAATAASALPGVSWGQGQTALRIGYQKS
                     STLMILLKSRQTLEKALPAKGVAVQWYEFTSGLPLLEALNLGNIDLSADVADAVPPFA
                     LAAGAALTYYASETPSPQAQAIVVRGDSPIREVAQLKGQRVAFAKGAGAHYLVLEALA
                     RAGLSIRDIEPAYLSPADARAAFERGSVAAWVIWDPFLAAVQRQANARVLRDGEGLAS
                     YRRFYLAATPFARAHAEVLEVVFDALRDAGDWVKRNPAEAARWHAPLIGLDAATVEAA
                     NARRSYAVRTVDAAALAEQQRIADAFTAQQILPRKVTISASPVWRKA"
     misc_feature    505078..505905
                     /locus_tag="CNE_2c04730"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    505132..505701
                     /locus_tag="CNE_2c04730"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(505192..505194,505279..505281,505417..505419,
                     505549..505551)
                     /locus_tag="CNE_2c04730"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(505498..505500,505510..505512,505528..505530)
                     /locus_tag="CNE_2c04730"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    order(505618..505626,505645..505653)
                     /locus_tag="CNE_2c04730"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(506025..508229)
                     /gene="plcN1"
                     /locus_tag="CNE_2c04740"
                     /db_xref="GeneID:10920960"
     CDS             complement(506025..508229)
                     /gene="plcN1"
                     /locus_tag="CNE_2c04740"
                     /EC_number="3.1.4.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-hemolytic phospholipase C"
                     /protein_id="YP_004680687.1"
                     /db_xref="GI:339321793"
                     /db_xref="GeneID:10920960"
                     /translation="MTFNPSKRQFLKTSLGTGAAAAVLASFPPSIRRALAIEANNATG
                     TIQDVKHVVMVMLENRSFDNYFGTFKGVRGYGDRFAIPLPNGKNAFYQTDANGNLLTP
                     YHLDETQGNAQRAGGTPHTWPDAQAAWDHGRMDRWPVAKKTLSMGYYDDAEIPFQRAL
                     ADAFTLCDAYHCAMHTGTIPNRLFYWTGSNGPTGDNVAVMINEFNAGADVGPSTEGWT
                     WKTYADRLQAAGVGWKVYQNVPDNYGCNQMMSFRHWRAEMEKMPVGRKLSNTAGTGVN
                     PPYNPDIDDQYSPLAKGFCNTMPDGGFLQSLRDDVLNGKLPEVSWIIPPAEFSEHPGP
                     SSPAKGGWYVQAILDALTASPEVWSKTVLLINFDENDGFFDHSPPPTAPSRNLDGTLA
                     GKSTLDDAQMAYEYFNFQPATAKQPPQDGKPFGPGPRVPMWVVSPWSRGGWVNSEVFD
                     HTSVLRFLEARFGVMEPQISAYRRAICGDLTSAFNFATPNTETLPTLAGRTTRADATS
                     LTAWQQTQPAIPVPATPALPEQDTGTRPSRKLPYELHTSARVDAASKAVRLLFANAST
                     NQAGALFHVYDKLHLDRIPRRYVVEAGKTLDDAWDINADGGKYDLWVLGPNGYHRAFS
                     GDINEAVTTSTEIQVCYNPCKKPTIQVKLHNDSDADVTFTVTALAYRDDGPWTQRVKR
                     GKVETLEWPVADSGNWYDFVVTCEASPSFARRFAGRMETGENAVSDPEMGVV"
     misc_feature    complement(506034..508214)
                     /gene="plcN1"
                     /locus_tag="CNE_2c04740"
                     /note="phospholipase C, phosphocholine-specific,
                     Pseudomonas-type; Region: PC_PLC; TIGR03396"
                     /db_xref="CDD:234195"
     misc_feature    complement(506835..508085)
                     /gene="plcN1"
                     /locus_tag="CNE_2c04740"
                     /note="Phosphoesterase family; Region: Phosphoesterase;
                     pfam04185"
                     /db_xref="CDD:252434"
     misc_feature    complement(506352..506624)
                     /gene="plcN1"
                     /locus_tag="CNE_2c04740"
                     /note="Domain of unknown function (DUF756); Region:
                     DUF756; pfam05506"
                     /db_xref="CDD:253229"
     gene            complement(508276..508485)
                     /locus_tag="CNE_2c04750"
                     /db_xref="GeneID:10920961"
     CDS             complement(508276..508485)
                     /locus_tag="CNE_2c04750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004680688.1"
                     /db_xref="GI:339321794"
                     /db_xref="GeneID:10920961"
                     /translation="MRPSLLSRSARPWLAAGTLTLALMLTACGGDDSPGASGSTLQPT
                     AANGNKPDQPGKPDRPGTCTTRCAP"
     misc_feature    complement(<508348..508476)
                     /locus_tag="CNE_2c04750"
                     /note="Photosystem II Pbs27; Region: PSII_Pbs27; cl11841"
                     /db_xref="CDD:245784"
     gene            508871..509557
                     /locus_tag="CNE_2c04760"
                     /db_xref="GeneID:10920962"
     CDS             508871..509557
                     /locus_tag="CNE_2c04760"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004680689.1"
                     /db_xref="GI:339321795"
                     /db_xref="GeneID:10920962"
                     /translation="MSEEKKSLSETIRAAIEQEILSGKLPSGAQLEEQQLLARFGVSR
                     TPVREALIQLESAGLVDLVPRQGAIVSSISLREYVAMNEILVQLEALAARLAARRISA
                     AQRTAMQAAFDDCRAAAERADSDRYREANDAFHEVIYAACCNDILSRQIRTMRARMRG
                     MRDLRFEKPARILASLAEHEAVMGAIVRGNEDDAAAAMVRHIATGGDVYADMIASMPG
                     DEAGGKRGRR"
     misc_feature    508871..509533
                     /locus_tag="CNE_2c04760"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    508889..509083
                     /locus_tag="CNE_2c04760"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(508889..508891,508895..508897,508967..508972,
                     508994..509008,509012..509017,509024..509026,
                     509054..509059,509063..509074)
                     /locus_tag="CNE_2c04760"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    509150..509482
                     /locus_tag="CNE_2c04760"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(509572..510549)
                     /gene="bugT2"
                     /locus_tag="CNE_2c04770"
                     /db_xref="GeneID:10920963"
     CDS             complement(509572..510549)
                     /gene="bugT2"
                     /locus_tag="CNE_2c04770"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004680690.1"
                     /db_xref="GI:339321796"
                     /db_xref="GeneID:10920963"
                     /translation="MKHTLGRAAIGAALATLAALPGMAAAQDYPTRPIRLLVGYTPAG
                     AADYVSRVFGEALSKELGQTVLVDNKPGAGSTLASAALAQAVPDGYTLGLATSTLYGI
                     DQQLYKARYKATDFTPVTRLTVSPLILAVNKNLNVSDIKTLVAKARAQQGKFNYSSSG
                     IGGSPHLAGLQFEKATGVKMTHVPYKGGAPALQAVAAGEVELSFGTAASVLPMGTQGV
                     VKMIGVTTPKPSAVAPGLPALAEMGLPGFDFTFWFGLYGPAGLPDGIRDKLFAATAKV
                     MADPQLRAKLASNGSEVSTSASPAEFGKWAAADGKSAVTRIEQAGVKLD"
     misc_feature    complement(509587..510480)
                     /gene="bugT2"
                     /locus_tag="CNE_2c04770"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            complement(510604..511839)
                     /locus_tag="CNE_2c04780"
                     /db_xref="GeneID:10920964"
     CDS             complement(510604..511839)
                     /locus_tag="CNE_2c04780"
                     /EC_number="2.3.1.86"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthase"
                     /protein_id="YP_004680691.1"
                     /db_xref="GI:339321797"
                     /db_xref="GeneID:10920964"
                     /translation="MTSLPPGTEAAGPHAPPADLPLSGITVLDLSIARAGPAAVRLLS
                     DWGADVIRVEPPPPQDRGSVTGRRRGSDEQNLHRNKRSLCLDLKTPQGAEVLARLVRR
                     SDVVVENFRSVVKERLGLTYERLSAINPRVILASISGFGQDGPYCERPGLDQIVQGMS
                     GLSSVTGEPGKGPLRVGIAISDTTAGMFLGQGILLALLHRARTGRGQWVHTSLIEGML
                     NKLDFQATRYTVDGEVPTQQGNAHPTLVPMGTYRCRDGVVNIAASTDRMWTNFCRTVE
                     AGWLLDDPAFQTATGRAAERHRLDEAINRCTAAFSAAELTSRLNAAGVPCGPVFDIGQ
                     AFEDAQVRHLRMTRPAEHPALGPLELLRSPINLSAAPHPERFARAAPDPGEHTDEILR
                     GLGYDEAGVAALRKAKVAS"
     misc_feature    complement(510610..511794)
                     /locus_tag="CNE_2c04780"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            512085..513065
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /db_xref="GeneID:10920965"
     CDS             512085..513065
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase Qor"
                     /protein_id="YP_004680692.1"
                     /db_xref="GI:339321798"
                     /db_xref="GeneID:10920965"
                     /translation="MLTDSVCINRVGGPEVLESCQVTVPPPGPGELQLCQSAIGLNFA
                     DIYQRKGAHGPYTAAPFPVTLGSVGAGKVTAVGPGVEGFEVGQRVACMHPGAYQVTRN
                     VPAGRVVPLPDAIPEEVAGATLLRGLTAEYLLRRLYAVQSGDAVLVHAAAGGMGVLLS
                     QWARALGATVIGTVGSEAKRAVALEHGCHHVINYREADFVAEVQALTGGEGVAVVYDA
                     VGKDVFVPSLQCLRPCGMAINYGTASGDVEAFDLQLLHARSLIVSRPTLRTYIASPQA
                     LANAAATLFAAVAGGQLRLEVNHRYPLAAVRDAHRDLEGRATTGSAVLIP"
     misc_feature    512100..513062
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /note="Quinone oxidoreductase (QOR); Region: QOR2;
                     cd05286"
                     /db_xref="CDD:176189"
     misc_feature    512118..513062
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    order(512208..512213,512223..512225,512457..512459,
                     512469..512471,512478..512480,512532..512534,
                     512541..512549,512604..512609,512619..512621,
                     512664..512666,512736..512741,512802..512816,
                     512874..512885,513024..513026,513030..513032)
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    order(512493..512495,512781..512786,512823..512840,
                     512859..512882,512889..512894)
                     /gene="qor1"
                     /locus_tag="CNE_2c04790"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            513142..513900
                     /locus_tag="CNE_2c04800"
                     /db_xref="GeneID:10920966"
     CDS             513142..513900
                     /locus_tag="CNE_2c04800"
                     /EC_number="4.2.1.116"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxypropionyl-coenzyme A dehydratase"
                     /protein_id="YP_004680693.1"
                     /db_xref="GI:339321799"
                     /db_xref="GeneID:10920966"
                     /translation="MQTDGSLPSLDIAGHVATITLRRPEVANRLGPDDLAELQRHVDA
                     VNDSDLRVLRLRGTGKYFCSGFDIGRLAAGQRGAGFETLVNAVEDCRAVTIAEIHGGV
                     YGGGTDLALACDFRLGTAAVDMFMPAARLGLHFYQRGMERYISRLGLNHAKHLFLTAE
                     RIDADEMLRRGFLTELLPAERLRERADQLSDTVAGLAPLAVQGMKRHLNAIGRGTLDT
                     EALAGDISRATQSQDIREGALAWKEKRRPQFTGT"
     misc_feature    513148..513888
                     /locus_tag="CNE_2c04800"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    513166..513708
                     /locus_tag="CNE_2c04800"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(513220..513222,513226..513228,513319..513321,
                     513331..513345,513442..513444,513448..513456,
                     513520..513525,513532..513534)
                     /locus_tag="CNE_2c04800"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(513337..513339,513454..513456)
                     /locus_tag="CNE_2c04800"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(513394..513396,513418..513420,513481..513492,
                     513526..513537,513553..513555,513559..513567,
                     513571..513576,513589..513594,513598..513603,
                     513607..513612,513619..513621,513652..513654,
                     513661..513663,513706..513708)
                     /locus_tag="CNE_2c04800"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(513907..514797)
                     /locus_tag="CNE_2c04810"
                     /db_xref="GeneID:10920967"
     CDS             complement(513907..514797)
                     /locus_tag="CNE_2c04810"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004680694.1"
                     /db_xref="GI:339321800"
                     /db_xref="GeneID:10920967"
                     /translation="MELRHLRYFQVVAQELNVTRAAERLHMAQPPLSRQIRQLEEEVG
                     VALFDRVGRGLRLTEAGRFLLEQSTQLTQRLEETIEGTRRIGRQDKRWFGIGFVPSVL
                     YGVLPELIRELRESDRHDQQVEVGLAEMITVEQIEALKAGRIDLGFGRIALNDPAIRQ
                     QVVMAEPLVAALPARLPAPRRKALTPQALAAQPFILYPARPRPSYADHLLSLFRAQGL
                     QLRVAQEANELQTALGLVAAGIGITLVPASIQRLHRDDVRYCPIDAPGFVSPVIMSYR
                     EGDTSPFLARVVEWVMRQRQ"
     misc_feature    complement(513925..514797)
                     /locus_tag="CNE_2c04810"
                     /note="DNA-binding transcriptional regulator HcaR;
                     Provisional; Region: PRK09906"
                     /db_xref="CDD:182137"
     misc_feature    complement(514612..514791)
                     /locus_tag="CNE_2c04810"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(513916..514527)
                     /locus_tag="CNE_2c04810"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators involved in benzoate
                     catabolism; contains the type 2 periplasmic binding fold;
                     Region: PBP2_BenM_CatM_CatR; cd08445"
                     /db_xref="CDD:176136"
     misc_feature    complement(order(514084..514089,514093..514098,
                     514105..514110,514114..514119,514279..514281,
                     514411..514413,514417..514419,514423..514425,
                     514456..514458,514465..514470,514474..514479,
                     514489..514494,514507..514509))
                     /locus_tag="CNE_2c04810"
                     /note="dimerizarion interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176136"
     misc_feature    complement(order(514111..514113,514183..514185,
                     514189..514191,514204..514209,514345..514350,
                     514402..514404,514498..514500,514504..514506))
                     /locus_tag="CNE_2c04810"
                     /note="CrgA pocket; other site"
                     /db_xref="CDD:176136"
     misc_feature    complement(order(514111..514113,514183..514188,
                     514204..514209,514345..514350,514402..514404,
                     514504..514506))
                     /locus_tag="CNE_2c04810"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176136"
     gene            514910..516028
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /db_xref="GeneID:10920968"
     CDS             514910..516028
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /EC_number="5.5.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="muconate cycloisomerase CatB"
                     /protein_id="YP_004680695.1"
                     /db_xref="GI:339321801"
                     /db_xref="GeneID:10920968"
                     /translation="MTTTITSVEAILVDLPTIRAHQLAMATMQQQTLVIVRLRCSDGV
                     EGIGEATTIGGLSYGDESPEGIKLTIDTYLAPALAGQDATNVHGAMARLGKVARGNRF
                     AKSALETALLDAQGKRLGVPLATLLGGAVRSTLPVLWTLASGDTARDIAEAEQLLAER
                     RHHTFKLKIGRRSVRDDVAHVAAIKRALGDRARVTVDVNQAWNEADAATGIAMLEAAG
                     IDLIEQPTPREQRMALARLAARFVVPIMADEAVCGPEDAMELARIGGADVFALKIAKA
                     GGIFGMLRTAAVGDAAGIALYGGTMLEGSVGTIAAAHGFCTLPQLAWGTELFGPLLLK
                     DDIVQQRPEYRDFSLHLPEGPGLGLALDEDKLAHYRRG"
     misc_feature    514919..516013
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /note="Muconate Lactonizing Enzyme (MLE), an homooctameric
                     enzyme, catalyses the conversion of cis,cis-muconate (CCM)
                     to muconolactone (ML) in the catechol branch of the
                     beta-ketoadipate pathway. This pathway is used in soil
                     microbes to breakdown lignin-derived...; Region: MLE;
                     cd03318"
                     /db_xref="CDD:239434"
     misc_feature    514922..516022
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /note="muconate and chloromuconate cycloisomerases;
                     Region: mucon_cyclo; TIGR02534"
                     /db_xref="CDD:162905"
     misc_feature    order(515087..515089,515093..515095,515099..515101,
                     515114..515116,515126..515128,515159..515164,
                     515168..515170,515195..515203,515207..515209,
                     515282..515284,515291..515299,515594..515596,
                     515672..515674,515768..515770,515858..515860)
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /note="octamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239434"
     misc_feature    order(515405..515407,515411..515413,515498..515500,
                     515504..515506,515576..515578,515651..515656,
                     515723..515725,515885..515887)
                     /gene="catB"
                     /locus_tag="CNE_2c04820"
                     /note="active site"
                     /db_xref="CDD:239434"
     gene            516094..517089
                     /locus_tag="CNE_2c04830"
                     /db_xref="GeneID:10920969"
     CDS             516094..517089
                     /locus_tag="CNE_2c04830"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004680696.1"
                     /db_xref="GI:339321802"
                     /db_xref="GeneID:10920969"
                     /translation="MKTLFQRLASTGRAGALALAAGLSFAAPTAHAAYPDHPIRWIVP
                     FPAGGAMDNIARTLGEDMSRTLGQAIVVENRPGAGGNIGAELVARAPADGYTLIIVAN
                     GMAVNPALYGRLSYDPVKDFAPVSLLAVVPNVLVASKARRQESTVKDVVAHAKAAPGK
                     YTYASAGNGTSIHLAGELFTSMAGVDMLHIPYKGSGPAMTDLLGGQVDYMFDSITSAR
                     PHIESGKLTAIAVTTSKRSSALPNVPTVAEAGLPGYELSPWFAAFVPAKTPQPVIDTL
                     NRAMLEALRKPAVQKRLAQIGAEPIGSSPAVLREHLAKETEKWGVLIRQRGIRAD"
     misc_feature    516253..517077
                     /locus_tag="CNE_2c04830"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            517247..518974
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /db_xref="GeneID:10920970"
     CDS             517247..518974
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="activator of phenol-degradative
                     genes,PspF-family"
                     /protein_id="YP_004680697.1"
                     /db_xref="GI:339321803"
                     /db_xref="GeneID:10920970"
                     /translation="MSSSTDKFSATMRDGLADLARRLRFAMEEGAIWLDEQRMILIHT
                     AALGALRKELVDTLGMERARGLFTRMGFHSGMRDAEVARKLRAGHSDFGQLEIGPCLH
                     TIEGVVRVTPVKVDIDIAAGIYDGEFLWEDSFEGDVHRQLFGIVDEPACWMQIGYATG
                     YTSALMGRTILYREVECIACGHPHCRIIGKPVEAWEDGAQALALYQPDPVIETIIALQ
                     SEVEHLRALQGTPATPADLVGTSPGFRAAWSLLQRAAASNVTVLLLGETGVGKERFAQ
                     ALHSVSGRADKPFIAVNCAAIPDELIESELFGVEKGAFTGASQSRPGRFERAHGGTLF
                     LDELGELSASAQSKLLRVLQEGEVERVGGTGTRKVDVRLVAATNVDLAEAVKQGTFRK
                     DLYYRLNVYPVTIPPLRERLDDIRPLAERFVARYGARHGKRIVGITDRALAELRHYDW
                     PGNVRELENVIERGVILASQGGQITADHLFLPGTVAPVVDTAPRLGAGGTLPDLREAA
                     VHALLDQMSEQQLALGEVETVLMEAAMQRADGNMSQAARLLGITRPQLAYRWKMRGTR
                     GGNGHGNGN"
     misc_feature    517298..517606
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Activator of aromatic catabolism; Region: XylR_N;
                     pfam06505"
                     /db_xref="CDD:115177"
     misc_feature    517634..517819
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="V4R domain; Region: V4R; pfam02830"
                     /db_xref="CDD:202420"
     misc_feature    517772..518938
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Transcriptional regulators containing an AAA-type
                     ATPase domain and a DNA-binding domain [Transcription /
                     Signal transduction mechanisms]; Region: PspF; COG1221"
                     /db_xref="CDD:224142"
     misc_feature    518027..518467
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    518039..518062
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(518042..518065,518252..518254,518378..518380)
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    518240..518257
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    518435..518437
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    <518510..>518749
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    order(518645..518647,518651..518656)
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     misc_feature    518810..518929
                     /gene="poxR"
                     /locus_tag="CNE_2c04840"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            519498..519722
                     /gene="poxA"
                     /locus_tag="CNE_2c04850"
                     /db_xref="GeneID:10920971"
     CDS             519498..519722
                     /gene="poxA"
                     /locus_tag="CNE_2c04850"
                     /EC_number="1.14.13.7"
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase P0 protein PoxA"
                     /protein_id="YP_004680698.1"
                     /db_xref="GI:339321804"
                     /db_xref="GeneID:10920971"
                     /translation="MNTPSVPLFEATPRYVRVEGRTPEGFVQFAFSVADPELNVELIM
                     PEPMFEAFCCVNRVRFLPPLEAAPQPQADD"
     misc_feature    519507..519686
                     /gene="poxA"
                     /locus_tag="CNE_2c04850"
                     /note="Phenol hydroxylase subunit; Region: Phenol_hyd_sub;
                     pfam06099"
                     /db_xref="CDD:147972"
     gene            519773..520768
                     /gene="poxB"
                     /locus_tag="CNE_2c04860"
                     /db_xref="GeneID:10920972"
     CDS             519773..520768
                     /gene="poxB"
                     /locus_tag="CNE_2c04860"
                     /EC_number="1.14.13.7"
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase P1 protein PoxB"
                     /protein_id="YP_004680699.1"
                     /db_xref="GI:339321805"
                     /db_xref="GeneID:10920972"
                     /translation="MQVDIKTQQIQPLRQTYGHVARRFGDKPASRYQEATYDVQSEVN
                     FHYRPTWDPGFELYDKRRTAIVMQDWYALKDPRQFYYGAYVTARGRQQDATEKSFAFV
                     EKRGLLQALPAEWQERLATGLLPLRHVEWGANMNNFYCADYGWGTAITQACTYCAMDR
                     LGIAQYLSRIGMLLDGNTGVALERARVAWLESAAWQPLRRFVEHTFVTEDWFETFVAQ
                     NLVLDGLLYPLVYQHADAVIARACGTGLAVLTEFMNDWRDEHARWVDAVIQAAAAESE
                     ANRVLLSGWARAACAEVAQALVPVADALTGEDGAQMVALCREQFEVRLGKLGLAA"
     misc_feature    519830..520714
                     /gene="poxB"
                     /locus_tag="CNE_2c04860"
                     /note="Aromatic and Alkene Monooxygenase Hydroxylase,
                     subunit B, ferritin-like diiron-binding domain; Region:
                     AAMH_B; cd01058"
                     /db_xref="CDD:153116"
     misc_feature    order(520028..520033,520040..520045,520049..520054,
                     520061..520066,520082..520087,520091..520093,
                     520454..520456,520466..520468,520475..520477,
                     520487..520489,520502..520504,520514..520516,
                     520523..520528,520532..520534,520541..520546,
                     520553..520555,520679..520681,520691..520696,
                     520700..520708)
                     /gene="poxB"
                     /locus_tag="CNE_2c04860"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153116"
     gene            520801..521082
                     /gene="poxC"
                     /locus_tag="CNE_2c04870"
                     /db_xref="GeneID:10920973"
     CDS             520801..521082
                     /gene="poxC"
                     /locus_tag="CNE_2c04870"
                     /EC_number="1.14.13.7"
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase P2 protein PoxC"
                     /protein_id="YP_004680700.1"
                     /db_xref="GI:339321806"
                     /db_xref="GeneID:10920973"
                     /translation="MSATPANVYIALQNNDDTRPIIDAITEANPHAVVSQFPAMVKID
                     APGHLTIVRELVAGKLGRDWDLQEIHLNLISLCGNIDEDEDAFTLRWNA"
     misc_feature    520819..521073
                     /gene="poxC"
                     /locus_tag="CNE_2c04870"
                     /note="MmoB/DmpM family; Region: MmoB_DmpM; pfam02406"
                     /db_xref="CDD:251275"
     gene            521118..522638
                     /gene="poxD"
                     /locus_tag="CNE_2c04880"
                     /db_xref="GeneID:10920974"
     CDS             521118..522638
                     /gene="poxD"
                     /locus_tag="CNE_2c04880"
                     /EC_number="1.14.13.7"
                     /codon_start=1
                     /transl_table=11
                     /product="phenol hydroxylase P3 protein PoxD"
                     /protein_id="YP_004680701.1"
                     /db_xref="GI:339321807"
                     /db_xref="GeneID:10920974"
                     /translation="MDARKKLNLREKYASMTRDLAWETTYEPMDKVFPFDKYEGIRIH
                     DWDKWEDPFRMTMDAYWKYQSEKERKLYAIIDSFVQNNGHLNVSDPRYLNALRLFLTG
                     VTPLEYAAHRGYAHLGRHFRGAGARVAAQMQSVDELRHAQTQLHTLSVYNKYFHGFGE
                     WRHMHDRVWYLSVPKSYFEDAMSAGPFEFITAISFSFEYVLTNLLFMPFMSGAAYNGD
                     MATVTFGFSAQSDESRHMTLGLEVVKFLCEQDPGNIPILQKWLDKWFWRGFRLLTLVG
                     MMMDYMLPKRVMSWAEAWEMYFEQAGGALFKDLERYGLRMPKYHEVATKTKDRITHEA
                     WATFYNYAGAAGFHTWVPKADEMAWLAEKYPQTFERYYKPRLDHWQERQQAGDRFYNA
                     TLPMLCQTCQIPMVFSEPDDPTQTCYRESSYHGMKFHFCSDGCKDIFDDEPAKYAQAW
                     LPVHQIYQGNCGGATLEDVLKWYRLNPGADNLDFEGSQDQRNWNAWKGIGPAADAA"
     misc_feature    521166..522536
                     /gene="poxD"
                     /locus_tag="CNE_2c04880"
                     /note="Aromatic and Alkene Monooxygenase Hydroxylase,
                     subunit A, ferritin-like diiron-binding domain; Region:
                     AAMH_A; cd01057"
                     /db_xref="CDD:153115"