GenomeNet

Database: RefSeq
Entry: NC_015724
LinkDB: NC_015724
Original site: NC_015724 
LOCUS       NC_015724             424140 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Cupriavidus necator N-1 plasmid BB2p, complete sequence.
ACCESSION   NC_015724
VERSION     NC_015724.1  GI:339323774
DBLINK      Project: 68689
            BioProject: PRJNA68689
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 424140)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of Cupriavidus necator N-1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 424140)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 424140)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002880.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..424140
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /plasmid="BB2p"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1297
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /db_xref="GeneID:10920364"
     CDS             101..1297
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /codon_start=1
                     /transl_table=11
                     /product="partitioning protein ParA"
                     /protein_id="YP_004682668.1"
                     /db_xref="GI:339323775"
                     /db_xref="GeneID:10920364"
                     /translation="MVVKSELTEIDRTVTIGSMSDFSKKLQKLTEELREHILAPRPRK
                     SPPTFTSSQVAEMCGIDRARLHYLATKDGSTLPAGELHGRVRQFTLAETRKWVQQASQ
                     VKPSPLLRKGEADGRVLISANFKGGSCKTTSSMCLAQGLSLRGRKVLLVDLDPQASLT
                     ELCGLYAEKMIVEESTVLPYIYSPDDFTLESVIQETYWDGVDVIPAHPSLFSAEFHIP
                     AMASKSANYRFWTLLRKGLEPLRKKYDYIVLDSAPSLSYLTINGLMAADAMVMPLVPE
                     SLDFISSVSFWSLFSDMADSFKNIEGNKTYDFVSILLSKVDYGVASSAPIVRSWVQRA
                     YGDWMSPIEVPASSVMSNGALALATVFDISKFEGSNKTFQRVRIPFDEYCRWVDEFYA
                     GKWEDA"
     misc_feature    155..1225
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /note="plasmid partitioning protein RepA; Region:
                     partition_RepA; TIGR03453"
                     /db_xref="CDD:234215"
     misc_feature    464..1042
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    473..>859
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    473..493
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(491..493,848..850)
                     /gene="parA"
                     /locus_tag="CNE_BB2p00010"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            1298..2284
                     /gene="parB1"
                     /locus_tag="CNE_BB2p00020"
                     /db_xref="GeneID:10920095"
     CDS             1298..2284
                     /gene="parB1"
                     /locus_tag="CNE_BB2p00020"
                     /codon_start=1
                     /transl_table=11
                     /product="partitioning protein ParB"
                     /protein_id="YP_004682669.1"
                     /db_xref="GI:339323776"
                     /db_xref="GeneID:10920095"
                     /translation="MNMRKRMLEQTANLTPANEIKVEVAPQVADRPKTAPGMMAALSA
                     AQLRIQELESQGAASTVPVEKIRPNPWQPRIRFDESSLTELADSIKELGLMQPILVRR
                     FTADNGESYYELIAGERRWRAHQVLGLPEIKALVSDASDADMAVLALAENVSRENLTD
                     YEIGKAMRRVEKEFPDRKRMAESMGMSRSTLYRYFAFDNLPEFIRVDLEKNPSLFSGT
                     AASDTYAVLKKHGEPAVTVAREVWKQLVDGSLEQSKFAKLLEASLLRREATPVTSQRD
                     IHKVYAGKTQAGSITKDSVSFTIKLKSAVLTAAQEERIRTVINELFDGGPQR"
     misc_feature    1478..1756
                     /gene="parB1"
                     /locus_tag="CNE_BB2p00020"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     gene            complement(2889..3275)
                     /locus_tag="CNE_BB2p00030"
                     /db_xref="GeneID:10920096"
     CDS             complement(2889..3275)
                     /locus_tag="CNE_BB2p00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682670.1"
                     /db_xref="GI:339323777"
                     /db_xref="GeneID:10920096"
                     /translation="MLQGSMTSRCSVRVVHWGSLIRSRRASRNSALFLLALPLTRAAG
                     RRGTVGDLRHELLGVRGQFLNACRRREALPIQAMGAQIDNPHRIVHVGYVPEHVTALL
                     VKHQLQVGLMMRSNRFQYTQEASMTA"
     gene            complement(5063..6916)
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /db_xref="GeneID:10920097"
     CDS             complement(5063..6916)
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase XerD"
                     /protein_id="YP_004682671.1"
                     /db_xref="GI:339323778"
                     /db_xref="GeneID:10920097"
                     /translation="MAQHNRVAADTPRYTRADFTALRFRLNRIPTEHILSRVYDEDAL
                     HAAGIETSEQLEARLDAMRDHLVERVCLSNPYLSASLADARRFNRWPKTAIDYLVRAA
                     DQDFSAPQPDDPVSAWLRPIVFRPLRQEGIQTLVQLHGYIALRGRRWYVPVPRLGAGK
                     ARAIERWLQGHAATLGPLQVDDTPRTGWVELGQDLACQLVPLEQVQRIVPALDGHRGR
                     NRAPGFCLIAARHDLDAIHAYLSRFRDRDKTARAYQKELERFLLWCVGVRRMALSSVG
                     ADDCEHYKEFLAQPDPAWIGPKTARTSARWRPFASALKPESQRYAVLVLRGFFAWLVG
                     VRYLGGNPWLLVSDPLTVRREVPIAVEKALPGRLWAALTQPEGLLDQLCGKWPSVPVS
                     APLTAKDTEAPGAQYRLARAVVLLLGCSGARREEAARTLRCHLQPVPEQAGVPAGLWE
                     LALLGKRDKWRTVFLPPRVIAALRAHWADRSHDFENAAQALALLSPVVVPSTRTAQAK
                     HLSLETGDPVLTGMGFSPDGLYQLLTTMLRRIAGDASLPLSEAERDLLRHLTPHALRH
                     TFATHAVANEMPADVLQRLLGHASLQTTSLYVRAERARGLAAVAKLYPDPT"
     misc_feature    complement(6389..6595)
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="Phage integrase protein; Region: DUF3701;
                     pfam12482"
                     /db_xref="CDD:193047"
     misc_feature    complement(5126..6145)
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="tyrosine recombinase XerC; Region: recomb_XerC;
                     TIGR02224"
                     /db_xref="CDD:233788"
     misc_feature    complement(5120..5716)
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(5126..5128,5231..5236,5549..5551,
                     5645..5650))
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(5126..5128,5153..5155,5222..5224,
                     5231..5233,5549..5551,5648..5650))
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(5126..5128,5153..5155,5222..5224,
                     5231..5233,5648..5650))
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(5126..5128,5222..5224,5648..5650))
                     /gene="xerD"
                     /locus_tag="CNE_BB2p00040"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            7803..9020
                     /locus_tag="CNE_BB2p00050"
                     /db_xref="GeneID:10920098"
     CDS             7803..9020
                     /locus_tag="CNE_BB2p00050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682672.1"
                     /db_xref="GI:339323779"
                     /db_xref="GeneID:10920098"
                     /translation="MPADDTALAPEPPNPRIGRYVSTVAFDETVHAYVPPPLPPEPPL
                     TLAPPLLQRLSEADRAIGRLDGVAMLLPDKALFLYMYVRKEAVLSSQIEGTQSTLDDL
                     LQYENAAPAGKPLDDITEVSNYVDAMMYGLGVLRDPNGLPLCLRLLRDMHARLLQKGR
                     GEAKNPGEFRRSQNWLGGTRPGNAHYVPPPVNEMQTCLSDLERFLQDDSAQIPPLIKA
                     GFLHVQFESIHPFLDGNGRLGRLLIALFLVEKKVLQEPLLYLSLYLKTHRAQYYRLLQ
                     DVRLRGDWEVWTEFFLTGVAETANNAHESAMRIVALFQADRERISASGEQINSMLRLH
                     ELLRTHPFLNAAQAQQQTGLSAPTVNKAFESLEKLAIVKEITGKQRGRVFAYTDFLSI
                     LDSGTEVQAPPRQ"
     misc_feature    7959..8960
                     /locus_tag="CNE_BB2p00050"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    7959..8198
                     /locus_tag="CNE_BB2p00050"
                     /note="Fic/DOC family N-terminal; Region: Fic_N;
                     pfam13784"
                     /db_xref="CDD:258068"
     misc_feature    8226..8543
                     /locus_tag="CNE_BB2p00050"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            9226..10050
                     /locus_tag="CNE_BB2p00060"
                     /db_xref="GeneID:10920099"
     CDS             9226..10050
                     /locus_tag="CNE_BB2p00060"
                     /codon_start=1
                     /transl_table=11
                     /product="SEC-C motif domain-containing protein"
                     /protein_id="YP_004682673.1"
                     /db_xref="GI:339323780"
                     /db_xref="GeneID:10920099"
                     /translation="MNPSYSYPVSRLLTLGQSFEEVNGAPETWKGYAKLGVDNRHIPE
                     LIAVVADEALHTGYGPVPFAPVHAWRILGALKATEALPALVSLLRRIDDDFDDWIASE
                     LPRVFSQMGGQSVDLLAPFAADGRNGSYARGGACRAMGEVASGHPEQRGRCLQVLMTI
                     LRSLEDNEQTLNTEIVSVLLDLNAVESIDLIREAYAKDCVDLDCVGDLEDVEIALGLR
                     TERSTAPKRGEFFQRLRELSNHQEATRPRTAGPKTGRNDPCPCGSGKKYKKCCLEA"
     misc_feature    <9421..9906
                     /locus_tag="CNE_BB2p00060"
                     /note="Protein of unknown function (DUF1186); Region:
                     DUF1186; pfam06685"
                     /db_xref="CDD:253860"
     misc_feature    <9928..10038
                     /locus_tag="CNE_BB2p00060"
                     /note="SEC-C motif; Region: SEC-C; cl19389"
                     /db_xref="CDD:267742"
     gene            10330..11475
                     /locus_tag="CNE_BB2p00070"
                     /db_xref="GeneID:10920100"
     CDS             10330..11475
                     /locus_tag="CNE_BB2p00070"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_004682674.1"
                     /db_xref="GI:339323781"
                     /db_xref="GeneID:10920100"
                     /translation="MLNLDLRSMSAMTGMINIALGIILLAFRRAYPASIKGLLPWALA
                     PLLCALSTAFYAMDGQWPAVLVSLGGNALLLSGCALFYFGSQRFYGVPCTWKCWLALG
                     IGCLAGISWFLLVHPDYRIRVLLLTTLLAAICLTHARLSWQHGRGFAPRFMALVLAFQ
                     GLVLLMRAATTLFQDAVDTPRFSPSVIQTTYIAAYCFASLFVCLGLLLTVSERLRAQF
                     EYLAQRDDLTGVLSRRAVLHAGSSELKNRRASGQPLSLLLMDIDHFKRINDQHGHLVG
                     DRVLAHFAQTVGRALRHTDYLGRFGGEEFVVLLPHTGAEAAFAVAERVRQAVEQQTAL
                     AGQPACTASLGLASIEAGEATLDELLARADLALYRAKADGRNRVEAG"
     misc_feature    10996..11463
                     /locus_tag="CNE_BB2p00070"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(11107..11109,11236..11238)
                     /locus_tag="CNE_BB2p00070"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(11122..11124,11131..11136,11146..11148,11158..11160,
                     11224..11226,11230..11241)
                     /locus_tag="CNE_BB2p00070"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(11212..11214,11296..11298)
                     /locus_tag="CNE_BB2p00070"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            11787..13361
                     /locus_tag="CNE_BB2p00080"
                     /db_xref="GeneID:10920101"
     CDS             11787..13361
                     /locus_tag="CNE_BB2p00080"
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3 family transposase"
                     /protein_id="YP_004682675.1"
                     /db_xref="GI:339323782"
                     /db_xref="GeneID:10920101"
                     /translation="MSQVLGGIDQILARVGKRVVSSDARGETITVEARSTVRAAPCPA
                     CHRWSNRLHGRYLRRLEERPMLEQPVVLAVEVRRFKCANAGCPRRTFAENIHALAGRH
                     QRRTQSQARALHALGHALGGEAAARLANVLGLRTSADTVLRELRRAPGRKRKPRPRVV
                     GIDDWAIARGHQYGTIIVDLERREPIEVFAGREGIAVAAWMRAHPSIEIVARDRAGAY
                     SEAVDIALPAATQVSDRWHLLSNLRDNVERLLYRLGPQMRQAAQQVEVGGVTLGRQGV
                     LSRNSRRSWQRLSDQRRATRLALYERVMALRAQGGTMKGIARELSINNRTVHKFVTAG
                     AFPERAPKARGPTPLDPHRSFIEERIAQGCRFPELIWQELKQRGYTGSRASVQSCVVR
                     LLFPQGKAPLVEVPVRTMPCPSARRVFGWLVGWRKLAVEEPRSADHERFVQALCKIEP
                     ASKISSDRMSFGGACMCRFLCRGDGLVRWYAATLRITRCPRIIGRSVPSATTSLAYGD
                     ARYGDAAKRTGRRGSR"
     misc_feature    11871..>12665
                     /locus_tag="CNE_BB2p00080"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    12264..>12578
                     /locus_tag="CNE_BB2p00080"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            complement(13504..14601)
                     /locus_tag="CNE_BB2p00090"
                     /db_xref="GeneID:10920102"
     CDS             complement(13504..14601)
                     /locus_tag="CNE_BB2p00090"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682676.1"
                     /db_xref="GI:339323783"
                     /db_xref="GeneID:10920102"
                     /translation="MSSHCVAFPARGRLPASLAATVLFWAGSACAQSSVTLYGRVVGG
                     VDYVNKVATANGRTSDVFRYSSDWGASWWGIRVQEDLGQGLSAVANLESMFSSDDGRT
                     IGDSFFNRYAVVGLSSRSYGTVWLGRAMALTDGELWEVDPFAMQFTSIGTLAYGRNWG
                     PRNNAITYNSPRWGGFSFRAQGSLSGVPGNINAGRQLSGSVSYQSGPLVLKGVYEEIR
                     DANGGFSDLYATSREYALGGAYQAGDVKLFAGYSLIRSGGATVATANNPTAADKHQLL
                     WLGAAWSAAPSLTILGGAYHARLNQDGGNATLLALGANYHLSKRTLLYATVGTVINRG
                     NAAFSVVITPDTKPLPGATQQGVYTGVMHSF"
     misc_feature    complement(13507..14505)
                     /locus_tag="CNE_BB2p00090"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(13507..13509,13513..13515,13519..13521,
                     13639..13641,13648..13653,14110..14115,14119..14121,
                     14218..14226,14254..14268,14272..14277,14308..14319,
                     14323..14325,14329..14337,14341..14343,14359..14373,
                     14467..14475,14479..14481,14497..14499,14503..14505))
                     /locus_tag="CNE_BB2p00090"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(14119..14121,14179..14181,14272..14274,
                     14386..14388,14482..14484))
                     /locus_tag="CNE_BB2p00090"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(14836..15711)
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /db_xref="GeneID:10920103"
     CDS             complement(14836..15711)
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /EC_number="1.13.11.37"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyquinol 1,2-dioxygenase ChqB"
                     /protein_id="YP_004682677.1"
                     /db_xref="GI:339323784"
                     /db_xref="GeneID:10920103"
                     /translation="MRNMTEAELTEVVLQRYQDTPDPRLREILQSLIRHLHAFVRDVR
                     LTEEEWLRGILYLTAVGQISDDKRQEMILLSDNVGVSMLVNMVSAGVAQAATESTVVG
                     PFYVPGTPERQWGESIQQLPCDDAPLFVRGRVLDLAGEPVADAQIEVWQTNSNGMYDI
                     QDPEQPEHNLRGWYRVNADGEFLVRTVRPVRYPIPTDGPIGELLNATSRHPWRPAHLH
                     VKVTAAGCKPLVTHIFDAEDPYLDSDVVFAVKQSLVRKFEPVTASNSSREYGISGPCL
                     ELRYDFTIERTMPAG"
     misc_feature    complement(14857..15687)
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /note="Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes
                     the ring cleavage of hydroxyquinol
                     (1,2,4-trihydroxybenzene), a intermediate in the
                     degradation of a large variety of aromatic compounds
                     including some polychloro- and nitroaromatic pollutants,
                     to form...; Region: 1,2-HQD; cd03461"
                     /db_xref="CDD:239544"
     misc_feature    complement(14860..15660)
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /note="catechol 1,2-dioxygenase, proteobacterial; Region:
                     catechol_proteo; TIGR02439"
                     /db_xref="CDD:233869"
     misc_feature    complement(order(15085..15087,15448..15450,15463..15465,
                     15484..15489,15562..15567,15583..15591,15601..15603,
                     15619..15624,15628..15630,15634..15636,15640..15642))
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239544"
     misc_feature    complement(order(15058..15060,15064..15066,15073..15075,
                     15136..15138,15238..15240,15400..15405,15484..15486))
                     /gene="chqB"
                     /locus_tag="CNE_BB2p00100"
                     /note="active site"
                     /db_xref="CDD:239544"
     gene            complement(15727..17097)
                     /gene="mtaD1"
                     /locus_tag="CNE_BB2p00110"
                     /db_xref="GeneID:10920104"
     CDS             complement(15727..17097)
                     /gene="mtaD1"
                     /locus_tag="CNE_BB2p00110"
                     /EC_number="3.5.4.28"
                     /EC_number="3.5.4.n1"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methylthioadenosine/S-adenosylhomocysteine
                     deaminase MtaD"
                     /protein_id="YP_004682678.1"
                     /db_xref="GI:339323785"
                     /db_xref="GeneID:10920104"
                     /translation="MLKRTLIRNASVITVDPKLGNLDKGDVLVEGSKIAAVGVGLKAD
                     DAEIIDGTGTIVMPGMVDTHRHVWQTTLRNIAADWTLDQYFAGVRGQLGEHFRGEDIY
                     TANLAGACEALNAGITTVLDWSHNMNTPAHTDGAVQGLRDSGGRFVMCYGNSNAEWLP
                     VSNLPTSRDAYRVKKEHFSRADDLVQMGMALRGPQYATEKVTIDDWALARDIGALISV
                     HVGDGAWGKNRPVAWLAEQGLLGEDVVCVHCNSLADDEFRIMADHGAWASMTPDIELQ
                     MGHGWPATRRLLDVGLAPTLGVDIVTSNSGHLFQVMRTVLLVERAWAHHHADQAGEVV
                     QRLPIDTSDVLAFATLNGARALGMADRIGSLTPGKDADIAMIRADNLEMAPLNNPVGA
                     VVLAGHPGLVDSVWVAGKAVKRHGKLVNVDVPRLIGELERSRDHVLALAGVAPGERFL
                     PAPYSH"
     misc_feature    complement(15772..17091)
                     /gene="mtaD1"
                     /locus_tag="CNE_BB2p00110"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08204"
                     /db_xref="CDD:181288"
     misc_feature    complement(15841..17085)
                     /gene="mtaD1"
                     /locus_tag="CNE_BB2p00110"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(order(16201..16203,16354..16356,16441..16443,
                     16900..16902,16906..16908))
                     /gene="mtaD1"
                     /locus_tag="CNE_BB2p00110"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(17201..18892)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /db_xref="GeneID:10920105"
     CDS             complement(17201..18892)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /EC_number="1.1.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase BetA"
                     /protein_id="YP_004682679.1"
                     /db_xref="GI:339323786"
                     /db_xref="GeneID:10920105"
                     /translation="MTFYDDLIVGAGAAGSVLANRLSADPQRRVLLLEAGRDIRPGDE
                     PADIRSIFPLSTFNPAYMWPDTLVHWGRANGTAPSFFPQGRLLGGTSQIMGMFALRGR
                     PEDYDDWAAMGAAGWGWDDVLPFFRKLESDHDFSGTMHGCDGPVPIRREPQAQWSPLS
                     ARLHQVAAARGFSHVADMNADFGDGYGTLPISRYPDKRGSAGICYLDAAVRARSNLTV
                     QAGATVSRLLLERRDGALHCTGVACTDAQGQVRQIRARRVLLAAGALRTPALLLRAGI
                     GPGDELTRLGIAPQLERKGVGRNLQNHAILYVVAFLARAGREPGGVRPACATTMRWSS
                     AQHGGTPGDMGMYIRSWLSWHALGHRMASLAPVLNKPWSRGSVTLSAQAPQAQTVVEF
                     DLLSDPRDLARITSAFRFTASLFGELGGICGTPYVLSDARNLSRLMRYNEPTSANAVR
                     AAAAARLIDAMPGFGQRMVAKLSKMTPAAEVLRSDDALADYARRSISGTGHVSGTCRM
                     GAASDPLAVVDPHGRVHGMQGLYVADASVMPTVPSANTHLPTIMVAEKIAQGLLV"
     misc_feature    complement(17219..18892)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    complement(<18686..18880)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(17984..18682)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(17228..17782)
                     /gene="betA"
                     /locus_tag="CNE_BB2p00120"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(18889..19791)
                     /gene="hgd"
                     /locus_tag="CNE_BB2p00130"
                     /db_xref="GeneID:10920106"
     CDS             complement(18889..19791)
                     /gene="hgd"
                     /locus_tag="CNE_BB2p00130"
                     /EC_number="1.1.1.291"
                     /codon_start=1
                     /transl_table=11
                     /product="2-(hydroxymethyl)glutarate dehydrogenase Hgd"
                     /protein_id="YP_004682680.1"
                     /db_xref="GI:339323787"
                     /db_xref="GeneID:10920106"
                     /translation="MNIGWIGAGKMGMPMMASLLAAGHAVRLYEPANIAREQAQALGA
                     TRAQNPADAARDAHAVFSSLPDDAALLTVAPAVFEGTAPGVLYVDTSTVSPQASATVA
                     RAAEAAGVSYLRAPVSGTPVQAHERALTTIVSGPRDAFEAARLLLSRWGPNLRYVGEQ
                     EQARSMKLVLNLMVGATAAMMAEALALGSKGGIRWDDLLDVMASSALASPLLKVKAAQ
                     LRQRDFSPLFSCAQMAKDLRLILAAGSDADVPLPLAALVSQLNAISLAHGRGGEDYIA
                     SVMTAEMLAAAGPVLDDDDTGDAR"
     misc_feature    complement(18964..19791)
                     /gene="hgd"
                     /locus_tag="CNE_BB2p00130"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    complement(19315..19791)
                     /gene="hgd"
                     /locus_tag="CNE_BB2p00130"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    complement(18964..19296)
                     /gene="hgd"
                     /locus_tag="CNE_BB2p00130"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            complement(19788..20888)
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /db_xref="GeneID:10920107"
     CDS             complement(19788..20888)
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /EC_number="1.3.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetate reductase TftE"
                     /protein_id="YP_004682681.1"
                     /db_xref="GI:339323788"
                     /db_xref="GeneID:10920107"
                     /translation="MSGMRSFVYSQFAGRVVFGAGAVRDVAEEVRRIGCKRVLVLSTP
                     EQRGPAESVREQLRELAVGVHDGAQMHVPVSVVREAQAVATQLGADGFVTIGGGSTTG
                     LGKMLALESGLPLLAIPTTYAGSEVTPLYGTTQDGAKTTGKNPAVLPRTVIYDPELTL
                     DLPLPVSLASGMNAIAHAAEGLYAVDLNPVVRLMALEGIGALSRALPALRDAPRDTGL
                     RADCLYGAWLCAMVLANVGMGLHHKACHVLGGSFGLSHAEMHAVMLPHALAYNVPAAA
                     PALASLSAALGGSGNAGDAPGEVFTLLDRLHLPTALSALGMPEDGLDRASRLMAERAY
                     PNPRPLEQARLRMLLADAFHGRAPRIDIGSLS"
     misc_feature    complement(19842..20846)
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /note="Maleylacetate reductase is involved in many
                     aromatic compounds degradation pathways of aerobic
                     microbes; Region: MAR; cd08177"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(20121..20123,20151..20153,20163..20165,
                     20358..20360,20370..20372,20391..20393,20415..20417,
                     20469..20474,20520..20522,20526..20531,20574..20576,
                     20583..20585,20592..20600,20760..20762))
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /note="active site"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(19935..19937,19941..19943,20397..20402,
                     20754..20756))
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(20121..20123,20163..20165,20358..20360,
                     20370..20372))
                     /gene="tftE"
                     /locus_tag="CNE_BB2p00140"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173936"
     gene            complement(20885..21184)
                     /locus_tag="CNE_BB2p00150"
                     /db_xref="GeneID:10920108"
     CDS             complement(20885..21184)
                     /locus_tag="CNE_BB2p00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682682.1"
                     /db_xref="GI:339323789"
                     /db_xref="GeneID:10920108"
                     /translation="MHWIIYAVDKPSMLPTRTANVDKHREYLAAHPIRTLISGPLTDD
                     AGTNMTGSFFLVEADSRAEVEAFNRNDPFWSLGIWESVDIHAFYKRVDDRAGAPQ"
     misc_feature    complement(20903..21184)
                     /locus_tag="CNE_BB2p00150"
                     /note="YciI-like protein; Reviewed; Region: PRK12863"
                     /db_xref="CDD:183800"
     gene            complement(21198..21530)
                     /locus_tag="CNE_BB2p00160"
                     /db_xref="GeneID:10920109"
     CDS             complement(21198..21530)
                     /locus_tag="CNE_BB2p00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682683.1"
                     /db_xref="GI:339323790"
                     /db_xref="GeneID:10920109"
                     /translation="MSTPMYFMVIGTDKPDSLALRVATRARHRDWLRGGHERVTVVAS
                     GASLAGESTVMNGSLLIVAAASHEDVVAFSHADPYFSAGLFASVDIRRWDWTFGNPNG
                     PTPSLNPV"
     misc_feature    complement(21231..21518)
                     /locus_tag="CNE_BB2p00160"
                     /note="YciI-like protein; Reviewed; Region: PRK12863"
                     /db_xref="CDD:183800"
     gene            complement(21527..22315)
                     /locus_tag="CNE_BB2p00170"
                     /db_xref="GeneID:10920110"
     CDS             complement(21527..22315)
                     /locus_tag="CNE_BB2p00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682684.1"
                     /db_xref="GI:339323791"
                     /db_xref="GeneID:10920110"
                     /translation="MSQANRDNPTSALCRHNAEAIWYRDQNLVDDLLGKQPFVATACR
                     HILGHELAPGQLALVEAILIVLMEHGMTPSAISARLIYMSSPESLQAGVAAGLLGVGS
                     AFIGTMEECARMLAVIADAGQPDAADTAARTLAQRLVSEKRTCPGFGHHLHKPDDPRA
                     IALLALAERHGVAGRHTAALRRLAAALDEARGRHLTINATGAVAAILGDIGVPVGAMR
                     GFALLSRTAGLVAHLLEEQETPSGRFIWNLVDRAIPFSAQEEGA"
     misc_feature    complement(21566..22225)
                     /locus_tag="CNE_BB2p00170"
                     /note="Citryl-CoA lyase (CCL), the C-terminal portion of
                     the single-subunit type ATP-citrate lyase (ACL) and the
                     C-terminal portion of the large subunit of the two-subunit
                     type ACL. CCL cleaves citryl-CoA (CiCoA) to acetyl-CoA
                     (AcCoA) and oxaloacetate (OAA); Region: CCL_ACL-C;
                     cd06100"
                     /db_xref="CDD:99854"
     misc_feature    complement(21596..>22162)
                     /locus_tag="CNE_BB2p00170"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    complement(order(21578..21580,21587..21589,21641..21643,
                     21716..21718,21722..21724,21731..21733,21839..21841,
                     21863..21886,21986..21988,21995..21997,22004..22012,
                     22100..22102,22109..22111))
                     /locus_tag="CNE_BB2p00170"
                     /note="active site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(21578..21580,21641..21643,21839..21841,
                     21863..21868,22004..22006,22100..22102,22109..22111))
                     /locus_tag="CNE_BB2p00170"
                     /note="oxalacetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(21641..21643,21722..21724,21839..21841,
                     21863..21877,21881..21886,22004..22009,22100..22102,
                     22109..22111))
                     /locus_tag="CNE_BB2p00170"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(21587..21589,21716..21718,21722..21724,
                     21731..21733,21863..21886,21986..21988,21995..21997,
                     22004..22012))
                     /locus_tag="CNE_BB2p00170"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(21716..21718,21866..21868,22004..22006))
                     /locus_tag="CNE_BB2p00170"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99854"
     gene            complement(22312..23895)
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /db_xref="GeneID:10920111"
     CDS             complement(22312..23895)
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase LcfA"
                     /protein_id="YP_004682685.1"
                     /db_xref="GI:339323792"
                     /db_xref="GeneID:10920111"
                     /translation="MFDMIQSLAILHNIRMFGRSTEKEPMYPIDFFWRAADRYPARIA
                     VRSPAADLTFAELAARVGSLAAAFARIDPEPGSRLAIGAANSVDHLVALLAAIAAGKV
                     WVPLNPRNGTPELERILAFTEPSIVVLDAAMRERLPGVSGHMAPLEDIEKVIREHAGS
                     ARPALNLGLDATQAIKFTGGTTGVPKGVMQPMRAWNTTVLTQWHEFDFHADDRFLVSA
                     PLTHGASTYVLAVLGSGGGLVFPPDTSAPTLLDWTAQAGVTSLFLPPTAIYALCAEQT
                     RAPRDVSSLRLLIYGAAPMPPARIQETQRVFGNVVATTYGQTEAPTVLTCMRPDQLAD
                     PRNLGSVGRPSMNTLVAIMGKDGTLLGPGQEGEIVARGDLLMTGYWRMSEQTATTIVD
                     GWLHTGDVGAFDERGFLFIKSRVREVIISGGFNVYPSDVEEAIGRHAAIYESAVVGIA
                     DDKWGEAVHAAVQLRPGASVSPEELIGFVKREIGAVKAPKVVHIFDTLPKSPVGKTLK
                     DEVVRRIHQQAATQTGSKA"
     misc_feature    complement(22381..23796)
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="acyl-CoA synthetase; Validated; Region: PRK06188"
                     /db_xref="CDD:235731"
     misc_feature    complement(22363..23388)
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="Bacterial Bile acid CoA ligases and similar
                     proteins; Region: BACL_like; cd05929"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(23338..23343,23347..23364,23371..23373))
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(22381..22383,22621..22623,22654..22656,
                     22663..22665,22699..22701,22942..22959,23020..23025,
                     23362..23364))
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(22438..22440,22621..22632,22654..22656,
                     22663..22665,22699..22701,22942..22959,23020..23025,
                     23086..23088,23095..23100,23104..23106,23239..23244,
                     23362..23364))
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="putative active site [active]"
                     /db_xref="CDD:213295"
     misc_feature    complement(order(22438..22440,22456..22458,22624..22632,
                     23023..23025,23086..23088,23095..23100,23242..23244))
                     /gene="lcfA"
                     /locus_tag="CNE_BB2p00180"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213295"
     gene            23885..24673
                     /locus_tag="CNE_BB2p00190"
                     /db_xref="GeneID:10920113"
     CDS             23885..24673
                     /locus_tag="CNE_BB2p00190"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682686.1"
                     /db_xref="GI:339323793"
                     /db_xref="GeneID:10920113"
                     /translation="MSNIRMILRAPSRSMPPMSQFLQAPQPQYLAVANELMEDILAGR
                     LAVGDHLPPEPELVRKYKLSRYGVRLAIKALIDLGLVSRQQGIGTRVLSNQTRARYNQ
                     TIAGLDDIARYAQETNFRILSKGLLSSDEARVPLVSAGAEKWLHIAGLRTTQGRGLPI
                     SLADIYVSPKYARLPKLGATLNVPVHALIERQYGVRVTRVDQDIQGALVSKDEARLLD
                     VDPGAAALRIVRTYYVAEEVIEVTLSVHPSERYSYKQTFELEGR"
     misc_feature    23951..24646
                     /locus_tag="CNE_BB2p00190"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    23963..24157
                     /locus_tag="CNE_BB2p00190"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(23963..23965,23969..23971,24038..24040,24044..24049,
                     24071..24085,24089..24094,24101..24103,24131..24136,
                     24140..24151)
                     /locus_tag="CNE_BB2p00190"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    <24308..24640
                     /locus_tag="CNE_BB2p00190"
                     /note="UTRA domain; Region: UTRA; cl17743"
                     /db_xref="CDD:266805"
     gene            complement(24753..26195)
                     /locus_tag="CNE_BB2p00200"
                     /db_xref="GeneID:10920112"
     CDS             complement(24753..26195)
                     /locus_tag="CNE_BB2p00200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682687.1"
                     /db_xref="GI:339323794"
                     /db_xref="GeneID:10920112"
                     /translation="MKTILRGPWVAGRLPACPAFGLALAAASCGALAQALSPPTAETP
                     AYRFLRYDDDYRYLQDPARRSDPWDPVKYIPLGAHGAFLSLGGEIRERFEDYSAANFG
                     VPGRTADSYLLHRILLHADLHAGDRLRGFFQLGDHLAPGKDIAAPPYEDRLDLQQGFI
                     DWRVPISADVPSDPNLRVGRQEMAFGSQRLISVRDAPNVRRAFDGVRLGGAASDMRID
                     AFATRPVLLKAGNFDDQPNHAQGFWGVYATFPRTFIPASGADLYYLGFENSRALYSIG
                     SGVERRHSVGTRIFGTGGQWDWDWEALAQFGSFGQQTLRAWGFSTDTGYTFAISDWKL
                     RTGIKATVGSGDHDANDGKLGTYGGLFPKLAYFNQAGLLGASNVLDLQPSITLKPMAQ
                     LRFTISWDLIWRETTRDAVYTAAAIPIAGTAGRPGGYTGSQLAFDVFWQVDRHIAINA
                     GLVHVDVAKVLSAVGGHNTLFTYVSAAYTF"
     misc_feature    complement(24783..25949)
                     /locus_tag="CNE_BB2p00200"
                     /note="Alginate export; Region: Alginate_exp; pfam13372"
                     /db_xref="CDD:257699"
     gene            complement(26439..27116)
                     /locus_tag="CNE_BB2p00210"
                     /db_xref="GeneID:10920114"
     CDS             complement(26439..27116)
                     /locus_tag="CNE_BB2p00210"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004682688.1"
                     /db_xref="GI:339323795"
                     /db_xref="GeneID:10920114"
                     /translation="MSSPANFNGKRPVIDPADTAMLLIDHQSGLFQTVGDMPMPELRQ
                     RAAALAKMATLSKLPVITTASVPQGPNGPLIPEIHENAPHAKYVARKGEINAWDNPDF
                     VAAVEATGRKTLIIAGTITSVCMAFPAISAVADGYKVFAVVDASGTYSKMAQEITLAR
                     VVQAGVVPMDTAAVASELQRSWHRDDAQQWAEIYTKIFPAYQLLIESYMKAQDVQKSG
                     EVLDSAR"
     misc_feature    complement(26577..27059)
                     /locus_tag="CNE_BB2p00210"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(26745..26747,26847..26849,27042..27044))
                     /locus_tag="CNE_BB2p00210"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(26886..26888,27024..27026,27033..27035))
                     /locus_tag="CNE_BB2p00210"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(26757..26762)
                     /locus_tag="CNE_BB2p00210"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            complement(27198..28064)
                     /locus_tag="CNE_BB2p00220"
                     /db_xref="GeneID:10920115"
     CDS             complement(27198..28064)
                     /locus_tag="CNE_BB2p00220"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="YP_004682689.1"
                     /db_xref="GI:339323796"
                     /db_xref="GeneID:10920115"
                     /translation="MKRVLGVYSAPRPHWVGDGFPVRSMFSYQGYGKQLSPFLLLDYA
                     GPADFGPAGAPRGVGMHPHRGFETVTIVYKGEVAHRDSTGQGGVIGPGDVQWMTAGAG
                     ILHEEFHSDAFTESGGALEMVQLWVNLPARDKMTRPGYQAILDREIPAVALPGEAGTV
                     RVIAGEYAGHAGPARTFTPMHVWDLRLRQGGLTELPVPSGWNAALIVLRGTVRVNDSA
                     VAGEAQMVLLDSAGTGTCIEASTDAVAILLAGEPIDEPIVGYGPFVMNSQQEIAQALT
                     DLNSGRFMQMAS"
     misc_feature    complement(27216..28064)
                     /locus_tag="CNE_BB2p00220"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    complement(27684..28010)
                     /locus_tag="CNE_BB2p00220"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    complement(27216..27521)
                     /locus_tag="CNE_BB2p00220"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            28197..29102
                     /locus_tag="CNE_BB2p00230"
                     /db_xref="GeneID:10920116"
     CDS             28197..29102
                     /locus_tag="CNE_BB2p00230"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682690.1"
                     /db_xref="GI:339323797"
                     /db_xref="GeneID:10920116"
                     /translation="MQDLNELYYYVQSVEHGGFAPAGRALGMPKSKLSRRIAMLEERL
                     GVRLIHRSTRQFTVTEIGRTYYEHCKAMLVEAEAAQEAIELTRAEPRGVMRVTCPVAL
                     LQVHVGAMLAEFMVRHPHVTIHLEATNRNVDPVAEAVDVAIRVRPPPLQDSDLVIRVL
                     AERKQCLIASSQLIKVLGMPRVPPDLGSWPSLGLGMPRPDHVWKLFGPDGAVADVHHQ
                     PRFVTGDMVALRNAAHAGVGVAQLPVMMVARELAAGSLVRLLPQWAPRAEILHAVFPS
                     RRGLLPSVRLLVDHLADGFAGMMEE"
     misc_feature    28197..29099
                     /locus_tag="CNE_BB2p00230"
                     /note="LysR family transcriptional regulator; Provisional;
                     Region: PRK14997"
                     /db_xref="CDD:184959"
     misc_feature    28206..28385
                     /locus_tag="CNE_BB2p00230"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    28464..29069
                     /locus_tag="CNE_BB2p00230"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_4; cd08473"
                     /db_xref="CDD:176162"
     misc_feature    order(28500..28502,28512..28514,28629..28631,28677..28679,
                     28683..28685,28872..28874,28923..28925,29004..29006)
                     /locus_tag="CNE_BB2p00230"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176162"
     misc_feature    order(28503..28508,28518..28523,28527..28532,28539..28541,
                     28551..28553,28557..28577,28764..28766,28854..28868,
                     28887..28892,28899..28901)
                     /locus_tag="CNE_BB2p00230"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176162"
     gene            29547..29731
                     /locus_tag="CNE_BB2p00240"
                     /note="cyclic nucleotide-regulated small mechanosensitive
                     ion channel"
                     /pseudo
                     /db_xref="GeneID:10920117"
     gene            complement(30746..31582)
                     /locus_tag="CNE_BB2p00270"
                     /db_xref="GeneID:10920118"
     CDS             complement(30746..31582)
                     /locus_tag="CNE_BB2p00270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682691.1"
                     /db_xref="GI:339323798"
                     /db_xref="GeneID:10920118"
                     /translation="MNLGNTSFLDGIAAPGFLFELSTSYYRATRIRDNDGNAAPGSPR
                     VETAAIVPHIAYISPDVTLLGGHLGGEVLLPLVYANIRPGSGTGDHDFAAGDIQFSPF
                     IVQWTGQTLFGMPFFQRFDLLFSAPTGQYDANGMANAGTHLWTVTPYYAFTLMPTGKL
                     EISGRLNYQWNGKNTRPAPALHASSVQPGDALYLNLSASYAISNGLRIGVAGYMLGQI
                     GEDRIDGIRQSDSRERVFGAGPGILIQGDAWQVFLNAYKEWGARNRPQGSKIVLRVLA
                     PF"
     misc_feature    complement(30749..31582)
                     /locus_tag="CNE_BB2p00270"
                     /note="Putative MetA-pathway of phenol degradation;
                     Region: Phenol_MetA_deg; cl01768"
                     /db_xref="CDD:261060"
     gene            complement(31782..32171)
                     /gene="doxX"
                     /locus_tag="CNE_BB2p00280"
                     /db_xref="GeneID:10920119"
     CDS             complement(31782..32171)
                     /gene="doxX"
                     /locus_tag="CNE_BB2p00280"
                     /codon_start=1
                     /transl_table=11
                     /product="protein DoxX"
                     /protein_id="YP_004682692.1"
                     /db_xref="GI:339323799"
                     /db_xref="GeneID:10920119"
                     /translation="MADYYLLSGRVFIAFMFVLSGANKLVFFNHGLDEVRSRNLPFPR
                     VALSLTILVQLSCGLAIMGGYQTAIASFLLAIFTLATAVVFYDFWNQKGAQRTVLFTG
                     FLEHISIIGGFVILMAAGPGNLVLRFS"
     misc_feature    complement(31791..32168)
                     /gene="doxX"
                     /locus_tag="CNE_BB2p00280"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(32287..32925)
                     /locus_tag="CNE_BB2p00290"
                     /db_xref="GeneID:10920120"
     CDS             complement(32287..32925)
                     /locus_tag="CNE_BB2p00290"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004682693.1"
                     /db_xref="GI:339323800"
                     /db_xref="GeneID:10920120"
                     /translation="MASETIRDPASDHLLTPQNSAFVIIDYQPVQVNSIASMDRQLLI
                     NNIVGTSRAAVAYKLPIVHSTVNVKTGLNKPPIPQLQKVLGDFPTYDRTSINSWEDVE
                     FRAAVEATGRKKLIMTALWTEACLTFPALDALKEGYEVYVVADAVGGTSVAAHEAALR
                     RIEQAGGKMISVAQLFCELQRDWSRSETVPAFIDLFIQTGGTAGIQFSYDRT"
     misc_feature    complement(32383..32865)
                     /locus_tag="CNE_BB2p00290"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(32551..32553,32650..32652,32848..32850))
                     /locus_tag="CNE_BB2p00290"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(32689..32691,32830..32832,32839..32841))
                     /locus_tag="CNE_BB2p00290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(32563..32568)
                     /locus_tag="CNE_BB2p00290"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            33169..33465
                     /locus_tag="CNE_BB2p00300"
                     /db_xref="GeneID:10920121"
     CDS             33169..33465
                     /locus_tag="CNE_BB2p00300"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="YP_004682694.1"
                     /db_xref="GI:339323801"
                     /db_xref="GeneID:10920121"
                     /translation="MDDFYVLVVLYAKPGREAELREKLRAVVEPSRGDAGNLRYEMFE
                     QQDDPRRFIFVEHWESPATQEAHHTQTDHIRRFQEEGSDAVESVELFYRMKLVT"
     misc_feature    33184..>33408
                     /locus_tag="CNE_BB2p00300"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            complement(33499..34401)
                     /gene="hlyD"
                     /locus_tag="CNE_BB2p00310"
                     /db_xref="GeneID:10920122"
     CDS             complement(33499..34401)
                     /gene="hlyD"
                     /locus_tag="CNE_BB2p00310"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="YP_004682695.1"
                     /db_xref="GI:339323802"
                     /db_xref="GeneID:10920122"
                     /translation="MTDQEADRNMKPNGPAIVRVLATALLLTAAALLGYSLWQHYMYS
                     PWTRDGRVRADVVNIAADVSGLVSRVPVRDNQEVRKGDLLFVIDQERFRQALAQAEAQ
                     VQARKAELDMRHRQAMRRMNLDSAVVSSESREDISAQEKQARANYDASLAALDTARLN
                     LHRSEVSAPVDGYVTNLNLHAGDYVSAGAARMALIDKHSYWVYGYFEETKLPNVHVGA
                     RAEVRLLSGGKPLEGHVESIARGIADRDNPTTANLLADVNPVFTWIRLAQRIPVRIHL
                     DAPPRDLLLAMGTTCTVTILPERR"
     misc_feature    complement(33511..34302)
                     /gene="hlyD"
                     /locus_tag="CNE_BB2p00310"
                     /note="multidrug resistance protein MdtN; Provisional;
                     Region: PRK10476"
                     /db_xref="CDD:182488"
     misc_feature    complement(34090..34239)
                     /gene="hlyD"
                     /locus_tag="CNE_BB2p00310"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(33625..33909)
                     /gene="hlyD"
                     /locus_tag="CNE_BB2p00310"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(34417..34617)
                     /locus_tag="CNE_BB2p00320"
                     /db_xref="GeneID:10920123"
     CDS             complement(34417..34617)
                     /locus_tag="CNE_BB2p00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682696.1"
                     /db_xref="GI:339323803"
                     /db_xref="GeneID:10920123"
                     /translation="MPREIALSSILMPSLLPVFIGCLLLYLLVDRLLARLGFYRQVWH
                     PALFRVSLFVAMFSGIGLGLWR"
     misc_feature    complement(34438..34611)
                     /locus_tag="CNE_BB2p00320"
                     /note="Protein of unknown function (DUF1656); Region:
                     DUF1656; pfam07869"
                     /db_xref="CDD:254477"
     gene            complement(34636..36114)
                     /gene="fusA"
                     /locus_tag="CNE_BB2p00330"
                     /db_xref="GeneID:10920124"
     CDS             complement(34636..36114)
                     /gene="fusA"
                     /locus_tag="CNE_BB2p00330"
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein FusA"
                     /protein_id="YP_004682697.1"
                     /db_xref="GI:339323804"
                     /db_xref="GeneID:10920124"
                     /translation="MRLEAMPQSCAAVAGRFLLLAGACLALLTGCANTGGIVPASTPV
                     DAATVDPGSALRATQQDAGWPQRAWWTRLGDHSLDALVAHAVAGSPDMRIAQARSELA
                     LSQAKIAGAAIEPNFNAGGAFGRTRFPRLATPQPLGGHTTWNNHLAVDLSYDLDLWGR
                     NRAALQGALDNVQAAAADARMAQLSLETSVVRAYIDLALQYALLDVSQANLARQTRIY
                     DIIRKRASRGLASELELSQTHTPIPALQAQVQQSERAIALVKNQLAVLSGDGPGAGDR
                     LPRPALVLEAPIAVPASLPAELVGHRPDVVAQRWRVEAAAQGMKVAKADFYPNINLVA
                     SIGLASAAFGNFFTFVDRDAIGHNVGAAISLPIFDGGRRQGNYGAATRNYDIAVETYN
                     KTVLAAFQSVADEVISLQSLTQQQAGIQDALRSARQAYGLAERGYRSGFTDYLNVLAA
                     DNELRRQQFSLALVQAARLDAWALLMQALGGGFDSTAVAEQP"
     misc_feature    complement(34669..36030)
                     /gene="fusA"
                     /locus_tag="CNE_BB2p00330"
                     /note="efflux transporter, outer membrane factor (OMF)
                     lipoprotein, NodT family; Region: outer_NodT; TIGR01845"
                     /db_xref="CDD:233595"
     misc_feature    complement(35311..35883)
                     /gene="fusA"
                     /locus_tag="CNE_BB2p00330"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(34675..35214)
                     /gene="fusA"
                     /locus_tag="CNE_BB2p00330"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            complement(36104..38266)
                     /gene="fusC"
                     /locus_tag="CNE_BB2p00340"
                     /db_xref="GeneID:10920125"
     CDS             complement(36104..38266)
                     /gene="fusC"
                     /locus_tag="CNE_BB2p00340"
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein FusC"
                     /protein_id="YP_004682698.1"
                     /db_xref="GI:339323805"
                     /db_xref="GeneID:10920125"
                     /translation="MTAAAKSIAPVRTWLADAASAWWQADRGRLVHASKTVAAVLLAT
                     WLSMRLELASPRTAMVSVVILMMHQHSGMVLARGFYRALGMLVGSFAALLLFFVFPQE
                     RVLFLLGLSMWIGLCVCGATYYRNYQSYGFVLSGYATCIAAVPSIANPYAIFENVVVS
                     LSEVSVGIACAGLVSGLVFPQRVAAMLLAAGQQHIATFTGFIRDALQGRQTAAGLGAL
                     HLRLAGERAQLESLRSAVVFEDPEMRANNALMIRLNHDFLDALARFHTIHQLRARMAK
                     AVDHRAGDALDALFGRLAAVLPPTAGRTRLELAEIGTLHDNLLGLNAALPSHIAAASA
                     TLSDAPPLSTDRFAAGASALRDAVADLLSYTGNFLALRSPGVASAPRPRAQARRRANP
                     ANRAFALASGVRATAAVLASAWLWIVSGWAGGSSGVIAATIAIALYSIMPQPTAIARQ
                     MLIGCALAWLAGLFFNFFLLPHLDGFLLLAVALAPFIALGSYVGTFPPRAAIGLGFGI
                     YFCFLGNLSNPMVFNPAGYLDSGIATLLGIAIASLAFATIVPQGGHWLAEQYLKQLRT
                     MVATDICRAPLGGLRLHFETHIRDFIQFAGSRPAAGRAGQAELLGWAFAALEIGLGMI
                     ALREATAQGSRPAAWESRQENLLAAISALFLAPSPRGFERALQAMEDAIGWTVDHASR
                     PAAEARAILHTMRLSLLDDALPLVVASSTNETGTPDAP"
     misc_feature    complement(36152..38182)
                     /gene="fusC"
                     /locus_tag="CNE_BB2p00340"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     misc_feature    complement(<36644..38182)
                     /gene="fusC"
                     /locus_tag="CNE_BB2p00340"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; cl19401"
                     /db_xref="CDD:267754"
     gene            38521..39480
                     /locus_tag="CNE_BB2p00350"
                     /db_xref="GeneID:10920126"
     CDS             38521..39480
                     /locus_tag="CNE_BB2p00350"
                     /EC_number="1.13.11.24"
                     /codon_start=1
                     /transl_table=11
                     /product="quercetin 2,3-dioxygenase"
                     /protein_id="YP_004682699.1"
                     /db_xref="GI:339323806"
                     /db_xref="GeneID:10920126"
                     /translation="MSNTMAEATASLSSDCAPCPGKPVLERIPTRPAEVGEGLVIHRA
                     LPNRQRRMVGAWCFLDHAGPIEFPDGQGLNVGPHPHIGLQTFTWMIEGEVLHRDSLGY
                     EQLVRPGQVNLMTAGNGIAHAEHSVGTGGRLHAAQLWIALPEDRRHMAPAFQNYPDLP
                     SVTSGGFDITVLAGTAFGQTSPVAVHSPLVGMDLATGQAASTAVPADPAFEYAALTLS
                     GEAVVEGEVLGPDTLLYLGTGRQQIAVRSDGAAELLLIGGVPFGEGIVLWWNFVARNA
                     AEIEAATHDWNSGSSRFGEVAGDVGARLVAPDVTGMHLKPQRR"
     misc_feature    38596..39402
                     /locus_tag="CNE_BB2p00350"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    38632..38940
                     /locus_tag="CNE_BB2p00350"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    39094..39402
                     /locus_tag="CNE_BB2p00350"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            39757..40707
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /db_xref="GeneID:10920127"
     CDS             39757..40707
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /EC_number="1.13.11.2"
                     /codon_start=1
                     /transl_table=11
                     /product="metapyrocatechase XylE"
                     /protein_id="YP_004682700.1"
                     /db_xref="GI:339323807"
                     /db_xref="GeneID:10920127"
                     /translation="MNTNGAQPGTAAAGPRYAVHSIDHYALEVPDLAVAEHFLDAFGL
                     TLRHNAGWLEAYATDGHCWARFHEGEHKRLAYLSFNCYAEDLAGIRQQLADAGAAFVN
                     DAPHGQAGGIWFFDADGNLVQVKAGPKTSPDAKIKAGLESTPAGQRGALVRSQVQKVH
                     PRRLSHVLLFSPNVPNLVAFYRDALGLRLSDRSADIIAFTHAPHGCDHHLLALVKSSA
                     KGWHHAAWDVASVNEVGQGAAQMANAGYTRGWGTGRHVLGSNYFFYVLDPWGSFCEFS
                     ADIDYIPAGHDWPTGDFAPEDSLYQWGPDVPDYFIRNTEA"
     misc_feature    39808..40626
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="catechol 2,3 dioxygenase; Region: catechol_2_3;
                     TIGR03211"
                     /db_xref="CDD:234146"
     misc_feature    39814..40146
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(39826..39828,39838..39840,39910..39912,39949..39951,
                     39955..39957,39982..39984,40093..40095,40117..40119,
                     40123..40125)
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(39826..39828,39982..39984,40123..40125)
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     misc_feature    40237..40635
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(40252..40254,40264..40266,40345..40347,40390..40392,
                     40396..40398,40423..40425,40546..40548,40570..40572,
                     40576..40578)
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(40252..40254,40423..40425,40576..40578)
                     /gene="xylE"
                     /locus_tag="CNE_BB2p00360"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            40815..41678
                     /locus_tag="CNE_BB2p00370"
                     /db_xref="GeneID:10920128"
     CDS             40815..41678
                     /locus_tag="CNE_BB2p00370"
                     /EC_number="4.1.1.68"
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="YP_004682701.1"
                     /db_xref="GI:339323808"
                     /db_xref="GeneID:10920128"
                     /translation="MKLATFLLDGRARVGVVSADGVLALPEAAGNDVCALVAVGTDSE
                     RWRALYAQATPVADADSLTWLPPVGRPPKILCVGLNYADHTKESPYEQPDYPTLFLRV
                     ATSLVGHNGAIVRPLVSDSLDYEGELAVIIGKGGRHIAREEALGHVFGYSIFNDGSVR
                     EYQFKSPQWTVGKNFDATGGFGPFVVTADELPPGAAGLQLETRLNGQMVQSASTSDML
                     YDVASLIAIISEAITLEPGDVIVAGTPSGIGWARKPQLLMRHGDVCEVSIEGIGTLSN
                     PIFDESAPQAR"
     misc_feature    40842..41657
                     /locus_tag="CNE_BB2p00370"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    41031..41648
                     /locus_tag="CNE_BB2p00370"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            41711..43486
                     /gene="tfdB"
                     /locus_tag="CNE_BB2p00380"
                     /db_xref="GeneID:10920129"
     CDS             41711..43486
                     /gene="tfdB"
                     /locus_tag="CNE_BB2p00380"
                     /EC_number="1.14.13.20"
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dichlorophenol 6-monooxygenase TfdB"
                     /protein_id="YP_004682702.1"
                     /db_xref="GI:339323809"
                     /db_xref="GeneID:10920129"
                     /translation="MKTIEVPVLVVGAGPAGLTTTALLATYGVRTLTITKYQGTANSP
                     RAHITNQRTMEVFRDLGIEDRVLALATPNALMSNNVWATSFAGTEIARLQTWGSSEQR
                     KADYATASPSPMCNAPQHLLEPVLLDCARERGAEFLFNTELTQISQTADEIMALLTDR
                     ITGEITQVKARYVVGADGGASTVVPQCGFEMEGQMGLGAAVNCWLEVDLAKFCEHRPG
                     VLYWMTQPGNDYWVGSGTYICVRPWNEWVLLFMYDPARGEPDLSEEAVIRRARATIGD
                     DSLPIRVKAVSKWQINHVAAKDMRKGRVFIAGDAAHRHPPANGLGTNTSIQDAFNLAW
                     KLAHVIRGNADDSLLDTYSAERQPVARRVVDRAMQSVRNMLPIAKALGFEPGQSEAQG
                     WQNVDELFGDTERGRERRRALEEAVRLQNYQFNCHGVEMGQVYASDAVVSDGRPRDPY
                     TRDPDLYYHPSTSPGGVVPHAWLELSKERVSTLDLVGHGRFTLLTGVGGAGWRRIAAD
                     VSAALDIDIEVVSIGGPNCDAHDVYGTWSELRSISDSGAILVRPDRFVGWRRENIDAH
                     AAQALEHAIRDILGRPDQAGRRQAA"
     misc_feature    41711..43432
                     /gene="tfdB"
                     /locus_tag="CNE_BB2p00380"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06126"
                     /db_xref="CDD:235704"
     misc_feature    41723..42811
                     /gene="tfdB"
                     /locus_tag="CNE_BB2p00380"
                     /note="FAD binding domain; Region: FAD_binding_3;
                     pfam01494"
                     /db_xref="CDD:250660"
     gene            43553..44344
                     /locus_tag="CNE_BB2p00390"
                     /db_xref="GeneID:10920130"
     CDS             43553..44344
                     /locus_tag="CNE_BB2p00390"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682703.1"
                     /db_xref="GI:339323810"
                     /db_xref="GeneID:10920130"
                     /translation="MPRTKSATTVAGEAAISSPEAPDLGGRTWASVLEQSVREDIING
                     KLPAGSKLRLKELAERYQAGVIPLREALSRLCTTGFVLAIDQKGFRVAPLSADELLDI
                     TRVRQQIDTSALRDAIEAGDIGWEAEVVAAHHRLTRIPMVLRGKDGSLNPEWEEAHAA
                     FHEVLVSGCRSAWLRRFSIVLRDQTARYRFLSLAVPKAARTRDVAAEHEAIVNAIVAR
                     NAREACRLLGGHFQATTDLVLKYLEQQKTKPATARKPAVATELAT"
     misc_feature    43592..44281
                     /locus_tag="CNE_BB2p00390"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    43649..43825
                     /locus_tag="CNE_BB2p00390"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(43709..43711,43712..43717,43739..43753,43757..43762,
                     43769..43771,43799..43804,43808..43819)
                     /locus_tag="CNE_BB2p00390"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    43853..44251
                     /locus_tag="CNE_BB2p00390"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            44581..45159
                     /locus_tag="CNE_BB2p00400"
                     /db_xref="GeneID:10920131"
     CDS             44581..45159
                     /locus_tag="CNE_BB2p00400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682704.1"
                     /db_xref="GI:339323811"
                     /db_xref="GeneID:10920131"
                     /translation="MPVNKQTKRRGLLQAAAAFPLAACLAMLPVAAGAATFSMQAGYG
                     RDNGHGVEKYEVAGHWEDIVQWQLSSRFSLALDGEVNIANWRALSREPSSQLMEFGVS
                     PIFRLNYDGEYASPYLEASVGFRVLSHTEIADGHRMGSAFQFADMVGVGVAFGKGRRF
                     SVGYRFQHLSNASIKEPNPGTNFSMGYVRYRF"
     misc_feature    44722..45156
                     /locus_tag="CNE_BB2p00400"
                     /note="Lipid A 3-O-deacylase (PagL); Region: PagL;
                     pfam09411"
                     /db_xref="CDD:255346"
     gene            45429..48107
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /db_xref="GeneID:10920132"
     CDS             45429..48107
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component PdhA"
                     /protein_id="YP_004682705.1"
                     /db_xref="GI:339323812"
                     /db_xref="GeneID:10920132"
                     /translation="MAQALPNSRNDDIDAQETTEWLDALDSVIAYEGAGRAHYLIGQL
                     IEHAHHVGIYLPFSANTAYVNTIPLDAQARSPGDQDLEHRIRSYIRWNAIALVLRAAR
                     DTNVGGHIASFASAATLYEVGFNHFWRASSEQRGGDLVFFQGHSSPGFYARAFLEGRL
                     TTEQMDNFRQEVGGKGISSYPHPWLMPDFWQFPTVSMGLAPIMGIYQARFMKYLEDRG
                     FGQHGGRKVWVFCGDGEMDEPESRGALGMAGREKLDNLIFVINCNLQRLDGPVRGNGK
                     IIQELESEFRGAGWNVIKVVWGSKWDALLARDKAGILARRMMECVDGDYQTFKAKDGA
                     YVREHFFNTPELKALVADWSDDDIWALNRGGHDPHKVYAAYHAAATHQGQPTVILAKT
                     IKGYGMGEAGEAQNITHQQKSMRVEALMHFRDRFKLPLSDQQLDELPYLSFEEGSREH
                     TYLHERRKALGGYLPARRRRGPSLPVPALSAFDAQLKASGEGREFSTAMSFVRILNTL
                     LRDKALGRRIVPIVSDESRTFGMEGLFRQIGIWSQQGQTYTPQDATQLSFYKESKDGQ
                     ILQEGINEAGAMADWIAAATSYSTHGEPMIPFFIFYSIFGFQRFGDLAWAAGDQRARG
                     FLLGGTAGRTTLNGEGLQHEDGHSLVWGGTIPNCVSYDPTFAYELAVIIQDGLRRMVQ
                     EQEDVYYYITVMNENYEHPAMPEGAEADILKGMYLFRRGKDDREDGPRVQLLGAGTIF
                     REVIAAAELLEQDWDVQADLWGCPGFTELAREGNAVARWNLLHPGTAPRRSHVEQCLA
                     PTKGPVIAATDYVRVLADQIRPFVPRRYAVLGTDGYGRSDTREQLRHFFEVDRYWITL
                     TALKALADEGALDGAVVQQALHKYGIDPEKPYPLGV"
     misc_feature    45435..48104
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /note="pyruvate dehydrogenase subunit E1; Reviewed;
                     Region: aceE; PRK09405"
                     /db_xref="CDD:236500"
     misc_feature    45663..46814
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of E. coli
                     PDC-like subfamily, TPP-binding module; composed of
                     proteins similar to the E1 component of the Escherichia
                     coli pyruvate dehydrogenase multienzyme complex (PDC). PDC
                     catalyzes the oxidative...; Region: TPP_E1_EcPDC_like;
                     cd02017"
                     /db_xref="CDD:238975"
     misc_feature    order(45738..45746,45933..45944,45963..45968,45972..45974,
                     45978..45980,46005..46007,46011..46019,46137..46148,
                     46155..46157,46164..46166,46176..46178,46224..46232,
                     46242..46244,46266..46268,46275..46280,46287..46289)
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    order(45762..45764,45855..45857,45861..45863,46011..46013,
                     46017..46019,46125..46133,46140..46142,46215..46217,
                     46221..46223,46608..46610)
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    47139..47465
                     /gene="pdhA1"
                     /locus_tag="CNE_BB2p00410"
                     /note="Pyrimidine (PYR) binding domain of thiamine
                     pyrophosphate (TPP)-dependent enzymes; Region:
                     TPP_enzyme_PYR; cl11410"
                     /db_xref="CDD:264357"
     gene            complement(48136..49098)
                     /locus_tag="CNE_BB2p00420"
                     /db_xref="GeneID:10920133"
     CDS             complement(48136..49098)
                     /locus_tag="CNE_BB2p00420"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682706.1"
                     /db_xref="GI:339323813"
                     /db_xref="GeneID:10920133"
                     /translation="MQLRTEEIEAYLLVVELGSVSGAARHMALSKSVVSKRISDLERS
                     LGVTLLQRSTRRVQPTESGRHFYEQARAAMAQLTRAAESISKTSQELCGELRILAPMS
                     FGTLWLSPLISEFAKAHPRLHVVMELDDRLVDTGYERYDVAIRITRLGDSALIARKLA
                     VSRRILCCSPEYAAHAGLPESIDDIARHACLSYSNSPPGQIWAFRGHTPQAAPKIIAP
                     RGVFTANNGEVLRDAALGGHGIAVLPLFIVSRELAAGRLIEVLPDEAPIDDGVFAVYP
                     RTAYTSQKIRTLIQFLQQSLSSPPWEPRCESAAGTLDVKPVLSV"
     misc_feature    complement(48199..49092)
                     /locus_tag="CNE_BB2p00420"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(48907..49077)
                     /locus_tag="CNE_BB2p00420"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(48223..48822)
                     /locus_tag="CNE_BB2p00420"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(48286..48288,48367..48369,48418..48420,
                     48613..48615,48619..48621,48661..48663,48778..48780,
                     48790..48792))
                     /locus_tag="CNE_BB2p00420"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(48391..48393,48400..48405,48424..48438,
                     48532..48534,48715..48735,48739..48741,48751..48753,
                     48760..48765,48769..48774,48784..48789))
                     /locus_tag="CNE_BB2p00420"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(49359..49532)
                     /locus_tag="CNE_BB2p00430"
                     /db_xref="GeneID:10920134"
     CDS             complement(49359..49532)
                     /locus_tag="CNE_BB2p00430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682707.1"
                     /db_xref="GI:339323814"
                     /db_xref="GeneID:10920134"
                     /translation="MAGYATPCLEAHRENALGAQAEIHDRPRYVTGDMIAMPLAAVAG
                     VGVCQLPVMRVWD"
     misc_feature    complement(<49362..>49493)
                     /locus_tag="CNE_BB2p00430"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            complement(49571..50278)
                     /locus_tag="CNE_BB2p00440"
                     /db_xref="GeneID:10920135"
     CDS             complement(49571..50278)
                     /locus_tag="CNE_BB2p00440"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TetR/acrR family"
                     /protein_id="YP_004682708.1"
                     /db_xref="GI:339323815"
                     /db_xref="GeneID:10920135"
                     /translation="MAPASNLFFKAGYCMESQPDSSANAAHRPPLRMTRRGEEKRALI
                     LSIAADMFLEHGYDGVSLDEIVKACGGSKTNVYSYFGGKDGLFVAVVERLCDRFLEKT
                     ETSLDLSRCNAAEGLQKIAHSFLQSLLEERHLAFLRLIFAESRRFPALGNAWYTRGPA
                     ATCAYVAGFLATQQVAGARLSASPEVSARLFHGMVLASVLHRTLATGVRPDDSETDAL
                     VNDAIALIVAEGAPGAA"
     misc_feature    complement(49595..50185)
                     /locus_tag="CNE_BB2p00440"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(50009..50149)
                     /locus_tag="CNE_BB2p00440"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            50491..50811
                     /locus_tag="CNE_BB2p00450"
                     /db_xref="GeneID:10920136"
     CDS             50491..50811
                     /locus_tag="CNE_BB2p00450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682709.1"
                     /db_xref="GI:339323816"
                     /db_xref="GeneID:10920136"
                     /translation="MKTRMIGAVAMLVMASAAQASVRSPTDGARAAQASLPVAEALQR
                     SQTGHMADEQFRKIAVRKADPYLDGAARPVDPATDGALRQVGPFTDGALARIVGVDPF
                     TDGA"
     gene            50963..51760
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /db_xref="GeneID:10920137"
     CDS             50963..51760
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /EC_number="2.3.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase CitA"
                     /protein_id="YP_004682710.1"
                     /db_xref="GI:339323817"
                     /db_xref="GeneID:10920137"
                     /translation="MTDTKPTRPAGRTAIAYVDTHGVSVHGKDLSQEIIGKTGFTEYF
                     LFLLTGRQPDAKLVAITDACLVAIAEHGLVPSVQAARMTLAAAPDALQGAVAAGVLGC
                     GSVILGASETAGQLLGEVLSGKEAGTLAESAHSVVRALRQARRPLPGFGHPTHKLGDP
                     RAHRLLAVARELGVAGDHVAALEAVAAVVPEYYSKPLPLNVSGAIPAVLLDAGYPATA
                     LKGVPMLARVASLIAHLQEERQQPIGFILSDAAEHAITYSAAPAQAS"
     misc_feature    51041..51721
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="Citryl-CoA lyase (CCL), the C-terminal portion of
                     the single-subunit type ATP-citrate lyase (ACL) and the
                     C-terminal portion of the large subunit of the two-subunit
                     type ACL. CCL cleaves citryl-CoA (CiCoA) to acetyl-CoA
                     (AcCoA) and oxaloacetate (OAA); Region: CCL_ACL-C;
                     cd06100"
                     /db_xref="CDD:99854"
     misc_feature    <51077..51688
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    order(51173..51175,51182..51184,51272..51280,51287..51289,
                     51296..51298,51398..51421,51443..51445,51551..51553,
                     51560..51562,51566..51568,51641..51643,51695..51697,
                     51704..51706)
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="active site"
                     /db_xref="CDD:99854"
     misc_feature    order(51173..51175,51182..51184,51278..51280,51416..51421,
                     51443..51445,51641..51643,51704..51706)
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="oxalacetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    order(51173..51175,51182..51184,51275..51280,51398..51403,
                     51407..51421,51443..51445,51560..51562,51641..51643)
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    order(51272..51280,51287..51289,51296..51298,51398..51421,
                     51551..51553,51560..51562,51566..51568,51695..51697)
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    order(51278..51280,51416..51418,51566..51568)
                     /gene="citA"
                     /locus_tag="CNE_BB2p00460"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99854"
     gene            51757..53400
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /db_xref="GeneID:10920138"
     CDS             51757..53400
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase LcfB"
                     /protein_id="YP_004682711.1"
                     /db_xref="GI:339323818"
                     /db_xref="GeneID:10920138"
                     /translation="MKPLIPNAGGAMVAPLEVLRQYRAHDFTLADFLAARVEAHPDKP
                     ALLFEGETWTYRQLDARIARVASWLAQEMQVGAGDRVGVLSANHPSTVVLMFALARIG
                     ATMVPANPDYRLDEALYVFRHAQVCGLVCSPATLETAAAIAAELGGAIWLRANESGSH
                     NVPTLEQSIAAHAGAYADGAGSAADTALIIYTSGTTGFPKGAMHSHRGYVLTAEAFIG
                     RLHLQPDERVMCVMPLFHINALMYSVGGALACGGCLVLLRRFSASSFWRFAAETGATE
                     VNLVAAAGSILARRPREEFVPGHRLSKMFIAPQTKEMVQVMKREFHVPRLIECYGMTE
                     IPGVIANPFNGPHKLGTMGLVSPHPDPAVPVPEARIVDDDGHDVAPGAAGELLIRTPT
                     LMQGYYRDAAQTEAAFRDGWFATGDLVRQDSDGYYVFVARKKDVIRRKGENVSGAELD
                     RIFGEHPAVEEAAAIGVPADLGEEEILLAVQFRPGQSVEPGELLAWARDRLAVHKLPR
                     YVVAVDAIPHTPTHKPAKHKLKADGTLFARATDMAAASH"
     misc_feature    51820..53349
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    51904..53346
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(52321..52323,52330..52347,52351..52356)
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(52330..52332,52675..52680,52738..52755,53005..53007,
                     53041..53043,53050..53052,53083..53085,53323..53325)
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(52330..52332,52450..52455,52600..52602,52606..52611,
                     52618..52620,52675..52680,52738..52755,53005..53007,
                     53041..53043,53050..53052,53074..53085,53266..53268)
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(52450..52452,52606..52611,52618..52620,52675..52677,
                     53074..53082,53248..53250,53266..53268)
                     /gene="lcfB"
                     /locus_tag="CNE_BB2p00470"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            53423..54262
                     /gene="pcaH1"
                     /locus_tag="CNE_BB2p00480"
                     /db_xref="GeneID:10920139"
     CDS             53423..54262
                     /gene="pcaH1"
                     /locus_tag="CNE_BB2p00480"
                     /EC_number="1.13.11.16"
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase beta subunit"
                     /protein_id="YP_004682712.1"
                     /db_xref="GI:339323819"
                     /db_xref="GeneID:10920139"
                     /translation="MNNPDNHTLQRAFDAMCEDAPGADPVLQAQFRVALKHFHAMLDE
                     LKLTDEQLYRIATWMGKVAQQDELIMLCDMMGLTMRALDLARTDDHATPQNVTGPFPK
                     DEIAEGSNPCHIATEDEPGQRLEVRGRVLDAATGKPVPGAMMIVWQPNQFGRYENEDD
                     SQSEDNLRGKLRCEADGSFQVFTVRPGGYIIGREDTEVGVLMKRLGRNRQRAPHIHYR
                     VMQPGYRTLTSQLYFAGDPANPVDCIFSTIDDHIVDALPHPERDGYQLVNLDIVLQPE
                     AAQ"
     misc_feature    53525..54241
                     /gene="pcaH1"
                     /locus_tag="CNE_BB2p00480"
                     /note="Intradiol dioxygenases catalyze the critical
                     ring-cleavage step in the conversion of catecholate
                     derivatives to citric acid cycle intermediates. This
                     family contains catechol 1,2-dioxygenases and
                     protocatechuate 3,4-dioxygenases which are mononuclear...;
                     Region: intradiol_dioxygenase; cl17208"
                     /db_xref="CDD:266557"
     misc_feature    53546..54250
                     /gene="pcaH1"
                     /locus_tag="CNE_BB2p00480"
                     /note="chlorocatechol 1,2-dioxygenase; Region:
                     chlorocat_1_2; TIGR02465"
                     /db_xref="CDD:131518"
     misc_feature    order(53861..53863,53885..53887,53987..53989,54053..54055,
                     54062..54064,54068..54070,54149..54151)
                     /gene="pcaH1"
                     /locus_tag="CNE_BB2p00480"
                     /note="active site"
                     /db_xref="CDD:238241"
     gene            complement(54281..55135)
                     /locus_tag="CNE_BB2p00490"
                     /db_xref="GeneID:10920140"
     CDS             complement(54281..55135)
                     /locus_tag="CNE_BB2p00490"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator IclR family"
                     /protein_id="YP_004682713.1"
                     /db_xref="GI:339323820"
                     /db_xref="GeneID:10920140"
                     /translation="MTSAAKPSAPVDNDAPPKLEEGHRDYVAALARGLAVIQAFTETT
                     PELTLSEVAQATGMTPATARRALLTLQALGYIGANGRRFVLLPKVLSLGAAFLSSMNL
                     RDIVQPFLQEVAERFRDSVSLAILDGDSVVYLAHVPSRRRIAFRASVGYRLPVHCTSL
                     GLALLAHAPKAQQNKILDKAPFQKFTPVTLSDADALRAALARALEQGYAIQDSQLELG
                     VLSIAVPVRDPQQRVIAAINCSTETERTSADELVATRLPALREAAASIEAAIRRAPAL
                     AHSITAAS"
     misc_feature    complement(54359..55069)
                     /locus_tag="CNE_BB2p00490"
                     /note="beta-ketoadipate pathway transcriptional
                     regulators, PcaR/PcaU/PobR family; Region: pcaR_pcaU;
                     TIGR02431"
                     /db_xref="CDD:131484"
     misc_feature    complement(54791..55057)
                     /locus_tag="CNE_BB2p00490"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    complement(54359..54715)
                     /locus_tag="CNE_BB2p00490"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            55219..56106
                     /locus_tag="CNE_BB2p00500"
                     /db_xref="GeneID:10920141"
     CDS             55219..56106
                     /locus_tag="CNE_BB2p00500"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682714.1"
                     /db_xref="GI:339323821"
                     /db_xref="GeneID:10920141"
                     /translation="MRLDPTSLRLFVAVAETGSIAAAAEHAHLAAAAVSKRVSELEQG
                     LGTALLMRSNKGVQPTMAGMELAHLARGVLHNLDDILVRMRDYGGGLRGQVRVMANIS
                     AITQFLPAQLKSFLAEYPLIDVHLEERVSTAIVRAVAENAADIGIFTAGAVGAELETF
                     PYRRDELVVVVPGAHPLAGRHSVTIREAFDYDFVSLHAGSQIHLQLAKAASEAGRVFK
                     PRIHVPGYDALCLMVQAGLGLGILPRSSAGPYQQTLGICTVALDEAWAARQLVIGVRA
                     YEGLSAVARLLVDRLREDE"
     misc_feature    55225..56097
                     /locus_tag="CNE_BB2p00500"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    55240..55407
                     /locus_tag="CNE_BB2p00500"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    55498..56091
                     /locus_tag="CNE_BB2p00500"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_1; cd08421"
                     /db_xref="CDD:176113"
     misc_feature    order(55543..55548,55552..55557,55564..55566,55576..55578,
                     55582..55602,55876..55893,55909..55914,55918..55923)
                     /locus_tag="CNE_BB2p00500"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176113"
     gene            56228..57439
                     /locus_tag="CNE_BB2p00510"
                     /db_xref="GeneID:10920142"
     CDS             56228..57439
                     /locus_tag="CNE_BB2p00510"
                     /EC_number="5.1.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA transferase/carnitine dehydratase"
                     /protein_id="YP_004682715.1"
                     /db_xref="GI:339323822"
                     /db_xref="GeneID:10920142"
                     /translation="MANEANNGTMPLQGVRVIELGSLIAGPYAGGLLAQFGAEVLKIE
                     SPKDGDPLRKWRKLYEGTSLWWYSQSRNKKSLTLDLRSAQGQEIVRKLVAEADIVIEN
                     FRPGTLEKWGLGWEDLRKVNPALVMVRISGYGQTGPYKDRPGFAAIAESMGGLRYVSG
                     YPDRPPVRSGVSIGDTLASLYGVIGALLAMHHLRANQGEGQFVDVALYESVFAVMESL
                     VPEYAKFGHVRERSGASLPGISPSNTYPCQDGQYVIIAGNGDAIFRRFMAAIGRDDLG
                     EDPRLAHNDGRVQHNAMLDDAITAWTSAHALDTVLATLEAAAVPCGKIYTAAEISSDA
                     HYRARDMIEPHHLPDGSPLELSGIVPKLSGTPGRTRWIGPELGQHTEEILAGIGIAGD
                     ELRALRAAGVV"
     misc_feature    56258..57436
                     /locus_tag="CNE_BB2p00510"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            57469..58413
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /db_xref="GeneID:10920143"
     CDS             57469..58413
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /EC_number="4.1.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase MvaB"
                     /protein_id="YP_004682716.1"
                     /db_xref="GI:339323823"
                     /db_xref="GeneID:10920143"
                     /translation="MWLPNAPRRVSINEVSVRDGFQIEPEFVPTEEKIALIDQLSNTG
                     LARIEITSFVSPKAIPNLRDAEAVARRIRRNPAVVYTALVPNVRGCERALDCALDEIN
                     LVMSASETHNLANMRMRCEQSLAQFAEVMQLARAGGLRASGCVATAFGCPFEGAIAPE
                     RVKWAAGRYLDLGMDSITLADTTGMADPRQVSALAESFLRWFPGVPLTLHFHNTRGMG
                     LANVMAGLAAGVDSFDASLGGLGGCPFAPGATGNISTEDLVHMLEAAGIDTGVDLDRL
                     LGAARGLPGLVGHDISGQVVKAGKSTDLHPVPEWVGAR"
     misc_feature    57502..58323
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /note="3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM
                     barrel domain; Region: DRE_TIM_HMGL; cd07938"
                     /db_xref="CDD:163676"
     misc_feature    order(57520..57525,57532..57534,57622..57624,57628..57630,
                     57778..57780,58096..58098,58102..58104,58222..58224)
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /note="active site"
                     /db_xref="CDD:163676"
     misc_feature    order(57520..57525,57613..57615)
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163676"
     misc_feature    order(57523..57525,58096..58098,58102..58104,58222..58224)
                     /gene="mvaB"
                     /locus_tag="CNE_BB2p00520"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163676"
     gene            58444..59859
                     /gene="leuC1"
                     /locus_tag="CNE_BB2p00530"
                     /db_xref="GeneID:10920144"
     CDS             58444..59859
                     /gene="leuC1"
                     /locus_tag="CNE_BB2p00530"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_004682717.1"
                     /db_xref="GI:339323824"
                     /db_xref="GeneID:10920144"
                     /translation="MTEPDRPASLLDKLWASHVIHQEPDGPALIYIDRHLVNEVTSPQ
                     AFEGLRLNARKVWRAASVLATADHNVPTTARKLGIADPVSRAQVEALDQNCADTGIVN
                     FGMDDPRQGILHVVGPERGATLPGMSIACGDSHTSTHGAFAAFAFGIGTSEVEQVLAA
                     QCLWMKKPKSMLVRVEGELPRGVAAKDIALALIGRIGTAGATGHVIEFAGSTIRGLSM
                     EARMTVCNMAIEAGARAGMVAVDETTLAYLDGRPQAPAGAMWDAATGYWRTLRSDPGA
                     TFDAVVELDATAIRPHVTWGTSPEMVVAIGERIPDPRDERDPVQRKSIEQALDYMGLL
                     PNTPIEAVALDKVFIGSCTNARLEDLRAAAAVLRGRHVSPRIRQALVVPGSGLVKSQA
                     EAEGLDQVFIAAGFEWREPGCSMCLGMNDDRLSAGERCASTSNRNFEGRQGPGGRTHL
                     VSPQMAAAAAVAGHFIDVRSL"
     misc_feature    58543..59838
                     /gene="leuC1"
                     /locus_tag="CNE_BB2p00530"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    order(58555..58557,58564..58566,58840..58845,59692..59694,
                     59749..59751,59764..59766)
                     /gene="leuC1"
                     /locus_tag="CNE_BB2p00530"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    order(58846..58848,59497..59499,59680..59682,59689..59694,
                     59746..59748)
                     /gene="leuC1"
                     /locus_tag="CNE_BB2p00530"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            59881..60519
                     /gene="leuD1"
                     /locus_tag="CNE_BB2p00540"
                     /db_xref="GeneID:10920145"
     CDS             59881..60519
                     /gene="leuD1"
                     /locus_tag="CNE_BB2p00540"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="YP_004682718.1"
                     /db_xref="GI:339323825"
                     /db_xref="GeneID:10920145"
                     /translation="MRAFTTLDGLVAPLDRANVDTDAILPKQFLKSIRRSGFGPYLFD
                     DWRYLDHGEPGQDCSSRPLNPDFVLNQPRYRGVSILLARENFGCGSSREHAPWALEDF
                     GLRALIAPSFADIFYNNCLKNGLLPIVAAPDVVERLFAETAATPGYRLQVDLAALQVV
                     TPSGEAIAFTLDPFKQHCLLNGLDDIALALRHAGQIQDYEQARRQREPWLFD"
     misc_feature    59920..60342
                     /gene="leuD1"
                     /locus_tag="CNE_BB2p00540"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    60148..60156
                     /gene="leuD1"
                     /locus_tag="CNE_BB2p00540"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            60587..61579
                     /locus_tag="CNE_BB2p00550"
                     /db_xref="GeneID:10920146"
     CDS             60587..61579
                     /locus_tag="CNE_BB2p00550"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004682719.1"
                     /db_xref="GI:339323826"
                     /db_xref="GeneID:10920146"
                     /translation="MSWQFHTTHALRAAAFGLACLAGTDAALAQTYPTQPIRMVVPYA
                     PGGTTDIIARQLAQRMSEKLGQPVVVENKSGANTVIGADAVAKAQPDGYTLLLTNDAT
                     FVLNPVVLPSVSYNVARDFAPVATIGYVPLVMAVSGSLPVDSVKDLAAYAKGRPQALS
                     YGSFGSGSQPHLMGALFNKLAGTDLVHVPYKGSAPAVADVVGGQILMTFPALPTIRSF
                     VAAKKLKVLAVSGDKRTRALPQVPTFAEAGYKDMDISAVYGVLAPAKVPRAVVDKLNA
                     TIREILDDKDFVEKHFAAQGMVPMKLSPAQFSQYIETQTRQTRKLVELSGVRVE"
     misc_feature    60740..61564
                     /locus_tag="CNE_BB2p00550"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            61588..62505
                     /gene="mmsB"
                     /locus_tag="CNE_BB2p00560"
                     /db_xref="GeneID:10920147"
     CDS             61588..62505
                     /gene="mmsB"
                     /locus_tag="CNE_BB2p00560"
                     /EC_number="1.1.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase MmsB"
                     /protein_id="YP_004682720.1"
                     /db_xref="GI:339323827"
                     /db_xref="GeneID:10920147"
                     /translation="MTSTNNARAVHAPRLGWIGVGAMGRPMCLNLLKAGYRLTVFDRV
                     PAQCEAVAAAGATVAPAAQALVADSDVVFSTIFDDGGLRDLFLAPGGVAGAATADKVF
                     VDMSTVSPDASAEVSAALAQRGAAFLRAPVSGTVSLATSAQLSCFVSGPRPAFDAVQP
                     ALACLTARQSYVGGADEARVIKLMINMMVFMSTAVIGEGLVFGARAGLDRALMVDAIN
                     DSIVGSAHYRTKAEQLKQRDYAAVGPISLVVKDLDLALAVARDNAVALPMSSLVRQYL
                     ALMQQRRQDHLDIAALADVLEWAGVPGAV"
     misc_feature    61627..62478
                     /gene="mmsB"
                     /locus_tag="CNE_BB2p00560"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    61627..62109
                     /gene="mmsB"
                     /locus_tag="CNE_BB2p00560"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    62125..62475
                     /gene="mmsB"
                     /locus_tag="CNE_BB2p00560"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            62542..63722
                     /locus_tag="CNE_BB2p00570"
                     /note="ABC transport system ATP-binding protein HAAT
                     family"
                     /pseudo
                     /db_xref="GeneID:10920148"
     gene            63719..64102
                     /locus_tag="CNE_BB2p00590"
                     /db_xref="GeneID:10920149"
     CDS             63719..64102
                     /locus_tag="CNE_BB2p00590"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004682721.1"
                     /db_xref="GI:339323828"
                     /db_xref="GeneID:10920149"
                     /translation="MTVLENLMAGCHKATHAGVLRAMLRTPASRRELAAMHDAALACA
                     GKFGLERLLQHRAGTLPAGQRRIVELARACIGNPGLLLLDEPSSGLNSEEIACGAPPM
                     GPGRHVLHYPLPGPRRRAAAPAGKP"
     misc_feature    <63719..>64006
                     /locus_tag="CNE_BB2p00590"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    63896..63925
                     /locus_tag="CNE_BB2p00590"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    63956..63973
                     /locus_tag="CNE_BB2p00590"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    63980..63991
                     /locus_tag="CNE_BB2p00590"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     gene            64144..64359
                     /locus_tag="CNE_BB2p00600"
                     /db_xref="GeneID:10920150"
     CDS             64144..64359
                     /locus_tag="CNE_BB2p00600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682722.1"
                     /db_xref="GI:339323829"
                     /db_xref="GeneID:10920150"
                     /translation="MRRCRLPDLHVEGRRLRARALLQHHELKTLVADWSDDDIQALNR
                     AVLVQPSGLLASSPPKCRIASRRPVSR"
     misc_feature    <64174..>64275
                     /locus_tag="CNE_BB2p00600"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     gene            complement(64351..64533)
                     /locus_tag="CNE_BB2p00610"
                     /db_xref="GeneID:10920151"
     CDS             complement(64351..64533)
                     /locus_tag="CNE_BB2p00610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682723.1"
                     /db_xref="GI:339323830"
                     /db_xref="GeneID:10920151"
                     /translation="MAGGASVLIQTLLVCLARGSDLDLSSEIQGIRFGRSVVMILELI
                     FMKGEIQLADLKDQLT"
     gene            complement(64589..65662)
                     /locus_tag="CNE_BB2p00620"
                     /db_xref="GeneID:10920152"
     CDS             complement(64589..65662)
                     /locus_tag="CNE_BB2p00620"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682724.1"
                     /db_xref="GI:339323831"
                     /db_xref="GeneID:10920152"
                     /translation="MRQDQSGIPRAARHRVTRASHISPRQAVETRRQRPRINDFDTAT
                     SSLLMDIKQLRALLAVAETGSTTKAAERLHIVQPAVSRHIRLLEEDLGVELFERERHG
                     MLLTDAGKTLAEYGRRALRELDRARAEIQPAAGLVSGTADIGLLPSCGELLAPELVAT
                     LRDRHPQLGVRLTVGYAGHLRQWLESGDVDAALMYDDKSVTGLQVQALLDEQLYLVGR
                     PSTVPQAGPLSIMDLEGLALVLPNPPHGLRNVVEHAFAVSGIDLVIAAETNSLSVQKS
                     LVAKGFAHTILPSSAISDDLARGTLAAAPIASPALSRRILLARLATRTQSTAASCATA
                     ALVSLMKRLVQDGVWRGATWIGA"
     misc_feature    complement(64625..65518)
                     /locus_tag="CNE_BB2p00620"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(65333..65512)
                     /locus_tag="CNE_BB2p00620"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(64694..65236)
                     /locus_tag="CNE_BB2p00620"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(64823..64828,64832..64837,64853..64870,
                     65141..65161,65165..65167,65177..65179,65186..65191,
                     65195..65200))
                     /locus_tag="CNE_BB2p00620"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            65747..66142
                     /locus_tag="CNE_BB2p00630"
                     /db_xref="GeneID:10920153"
     CDS             65747..66142
                     /locus_tag="CNE_BB2p00630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682725.1"
                     /db_xref="GI:339323832"
                     /db_xref="GeneID:10920153"
                     /translation="MNEKTSADIAAVMTADDARYAAMLAGDVAALDALLADSLVYTHA
                     TARTEDKAAYLKAVSSGLVKYVELKRSEAVVQVYGPTAVMHGQLSLSVLREGSRKGMN
                     GLFQSVWVRSDNQWQMAAWASVPQAFTSA"
     misc_feature    65780..66100
                     /locus_tag="CNE_BB2p00630"
                     /note="Domain of unknown function (DUF4440); Region:
                     DUF4440; pfam14534"
                     /db_xref="CDD:258674"
     gene            66221..66520
                     /locus_tag="CNE_BB2p00640"
                     /db_xref="GeneID:10920154"
     CDS             66221..66520
                     /locus_tag="CNE_BB2p00640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682726.1"
                     /db_xref="GI:339323833"
                     /db_xref="GeneID:10920154"
                     /translation="MSEKNVVLAVNCRIRSDKVKELMAELLANAEASRAEPGCLHFDV
                     SVDKDDPTKIMYYEVYRDQAAIDSHAQTAHHKRWVTEGAPLLEVRQPVRLSRTAP"
     misc_feature    66236..66481
                     /locus_tag="CNE_BB2p00640"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            66615..66917
                     /locus_tag="CNE_BB2p00650"
                     /db_xref="GeneID:10920155"
     CDS             66615..66917
                     /locus_tag="CNE_BB2p00650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682727.1"
                     /db_xref="GI:339323834"
                     /db_xref="GeneID:10920155"
                     /translation="MSERKQVVVVACQPKAGKRQQLLDELEKNRMAALQIEAGCLQFD
                     VTTAEDSDERIVVYEVYRDLAALEAHQQTPHFKRFLQEGIPLFAEHDLAIYERVAP"
     misc_feature    66633..>66860
                     /locus_tag="CNE_BB2p00650"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            67031..68422
                     /locus_tag="CNE_BB2p00660"
                     /db_xref="GeneID:10920156"
     CDS             67031..68422
                     /locus_tag="CNE_BB2p00660"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004682728.1"
                     /db_xref="GI:339323835"
                     /db_xref="GeneID:10920156"
                     /translation="MINSDSTISTSLPAQIGKEEEDKVFRRVTRGILPLLFICSMIAL
                     FDRFIVGFAKLQITEAFGLSAAAYGFGAGIFSLGYLLFEVPSNVILARVGAKKWIARI
                     MVSWGIVTVGTILVRTPEQFYMARFLLGLMEAGFYPGIVYYLSGWFPRARFGRVMALL
                     LLVFPISNLFIGPLSGWILESMSGTAGLAGWQWLFVVMGIPAILMGFVFFLLVADKPQ
                     DAKWLSAHEKRIVLDAIARDRASRHESGGWFLAFKDWRVWALGAIMAGGYLGLYGIVF
                     WLPTMVQSAGVSGFRNIGLIASIPWIGTVLVTLVLGYSSDYFQERRGHFCFAVLLGAL
                     GFVISVQSSTNIYVTIAGLSVACAFLFACFPPAWALASTLLVGQSAACGLALVNTVAS
                     FGSFIGPYLMGIGQERTGGLTAPLMVLAAICSVSALAIWLIPAHAPDQSGAGSRALKD
                     AKTGGSVADSMAQ"
     misc_feature    67127..68332
                     /locus_tag="CNE_BB2p00660"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    67142..68329
                     /locus_tag="CNE_BB2p00660"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    order(67169..67171,67178..67186,67190..67195,67244..67246,
                     67253..67258,67265..67267,67277..67282,67286..67291,
                     67427..67432,67439..67444,67451..67456,67463..67465,
                     67499..67504,67511..67516,67532..67534,67832..67834,
                     67841..67846,67853..67858,67865..67867,67907..67909,
                     67919..67921,67931..67933,67940..67942,67952..67954,
                     68099..68101,68108..68113,68120..68122,68132..68137,
                     68144..68146,68177..68182,68189..68194,68201..68206,
                     68213..68215)
                     /locus_tag="CNE_BB2p00660"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            68488..68919
                     /locus_tag="CNE_BB2p00670"
                     /db_xref="GeneID:10920157"
     CDS             68488..68919
                     /locus_tag="CNE_BB2p00670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682729.1"
                     /db_xref="GI:339323836"
                     /db_xref="GeneID:10920157"
                     /translation="MSAFVRWPGRSDMKDETKRKITSVLIADDQRHAAMIGGDMAGLD
                     RLLGGDLVYIHGSARQDDKQQYLASIASGAVKYLDIKRTAAAVQVYGDTAVVHGHIAI
                     QGMSSGEKRLIDSLFQSVWVLASFGWQMVGWASIPTGKAQA"
     misc_feature    68566..68877
                     /locus_tag="CNE_BB2p00670"
                     /note="Domain of unknown function (DUF4440); Region:
                     DUF4440; pfam14534"
                     /db_xref="CDD:258674"
     gene            68932..69888
                     /locus_tag="CNE_BB2p00680"
                     /db_xref="GeneID:10920158"
     CDS             68932..69888
                     /locus_tag="CNE_BB2p00680"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate (FAA) hydrolase"
                     /protein_id="YP_004682730.1"
                     /db_xref="GI:339323837"
                     /db_xref="GeneID:10920158"
                     /translation="MKFVTIDCGEKGHPGLLMSDGNILDLILLRRHLGVAKLMPADVR
                     GILEGGAPALALADQCRRAVEEMSDHASAQLSETGALVSFHGTPLLAPIPEPRLLLAA
                     SGNYGRHMREYPDVPLPENPTAFIKPADTLTGHEKPILIPPQFPDQVDFEGEFAFVFG
                     RTCHNVDEASAMQYVAGYTIVNDVSARNWVAEVFSSTERFQSIRAWDRNILGKNLPSF
                     SPCGPILTTADEIADPHDLAITTRVNGKVMQDSGTSDLICRIPRLISYFSKWYRFQPG
                     DIFSTGTPEGVGAGRTPPVYLKRGDRIEIEIAGLGTLANPVA"
     misc_feature    69064..69882
                     /locus_tag="CNE_BB2p00680"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    69244..69885
                     /locus_tag="CNE_BB2p00680"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            69964..70359
                     /locus_tag="CNE_BB2p00690"
                     /db_xref="GeneID:10920159"
     CDS             69964..70359
                     /locus_tag="CNE_BB2p00690"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin 2 domain-containing protein"
                     /protein_id="YP_004682731.1"
                     /db_xref="GI:339323838"
                     /db_xref="GeneID:10920159"
                     /translation="MEDVEKLTILRGEDLNWESDGRRGFFEYCDLGMRKATSGRYLVH
                     LIRATASMESPIGGHRHIVDLQVVYMLKGWMKLWHEGHGEVTLKAGDCMYQPGGLTHG
                     ALDWSADFECLEVISPGNFSTLESETEAA"
     misc_feature    70138..>70269
                     /locus_tag="CNE_BB2p00690"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            70418..71353
                     /locus_tag="CNE_BB2p00700"
                     /db_xref="GeneID:10920160"
     CDS             70418..71353
                     /locus_tag="CNE_BB2p00700"
                     /codon_start=1
                     /transl_table=11
                     /product="catechol 2,3-dioxygenase-like protein"
                     /protein_id="YP_004682732.1"
                     /db_xref="GI:339323839"
                     /db_xref="GeneID:10920160"
                     /translation="MSIIKATGVAYGRLRAPDLDRMEAFLLDFGMVRVARNENTLYMR
                     GTGPAQYIHVTEKGSPAFLGMAYRAGSEADLEKLTRVPGASAVEPIDAPGGGKRVRLR
                     DPDGYLIEVVHGIAPLPELPITHRHPEQGRTVGVLDRIHMGPARVRSFGHAVIFTPRL
                     QETLEWYWHVLGLLPSEEVYEGSPDNVLGSFNRCDCGDEFVDHHVAMFFSNATAGLNH
                     LAFEVVDLDDVFTGHEHLQARGGYEPLYGVGRHLLGNQVFDYWGGPWGMVHEHYAHGD
                     LLNASSGRKRVDIAQGFVSPWGGEPSEALLNRVVP"
     misc_feature    70433..70768
                     /locus_tag="CNE_BB2p00700"
                     /note="N-terminal domain of 2,4,5-trihydroxytoluene (THT)
                     oxygenase; Region: THT_Oxygenase_N; cd07267"
                     /db_xref="CDD:176688"
     misc_feature    70865..71320
                     /locus_tag="CNE_BB2p00700"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(70871..70873,70883..70885,70982..70984,71036..71038,
                     71042..71044,71069..71071,71195..71197,71219..71221,
                     71225..71227)
                     /locus_tag="CNE_BB2p00700"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(70871..70873,71069..71071,71225..71227)
                     /locus_tag="CNE_BB2p00700"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            71385..72092
                     /locus_tag="CNE_BB2p00710"
                     /db_xref="GeneID:10920161"
     CDS             71385..72092
                     /locus_tag="CNE_BB2p00710"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase"
                     /protein_id="YP_004682733.1"
                     /db_xref="GI:339323840"
                     /db_xref="GeneID:10920161"
                     /translation="MNTSLEFDPQSLVLPRVPIRGSTQHYHVRRIFCVALNYADHARE
                     MGREVSPEPPFYFTKSPFAITHTDSVVPYPPATANYHHEIELVAAIGKPAFRVSPAEA
                     WDCVFGYACGLDMTRRDLQLAARDKGRPWEVGKDFEESAIVSEIVPVSAIGHPQSGRI
                     AVSVNGETKQDSDISMFIWNVAELVSDLSKYYRLGPGDLIYTGTPHGVGPVRAGDSLH
                     GVVAGVASIDLRIGPAA"
     misc_feature    71394..72086
                     /locus_tag="CNE_BB2p00710"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    71472..72077
                     /locus_tag="CNE_BB2p00710"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            72177..73976
                     /locus_tag="CNE_BB2p00720"
                     /db_xref="GeneID:10920162"
     CDS             72177..73976
                     /locus_tag="CNE_BB2p00720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682734.1"
                     /db_xref="GI:339323841"
                     /db_xref="GeneID:10920162"
                     /translation="MNEQGESGRVGKWPPGDAAGQENRAGNAASEASARSAYSQAYRS
                     PEVGGNRGARLLLKGGTVLTLDEKVGDFEQADVLVEGKKIVAIAPHLEAAGAQVIDCS
                     GTIVMPGFISTHQHQYQTLMRSALSDGIHIRAIPANSQQPVAKWPGEFYTTTIQEVWT
                     PGFMPNPPVPGQPPIWDLGRPPMDPEDCYIAELVSSLSQITQGVTTITDTSQSSHTPD
                     HTDAMIQALFDSGQRAVYAYGWGNDRSAQFPEQSYEYPGRSGDTSFGLGRLAKTYFSS
                     KDQLVTLGAMLDWHPVVDPRTREKQNYTGWQLAREFGAWINNHAAHGAVVEGIAEDPR
                     NGTDWSDVTLVHCTLWQDEPVAQIGVDNVRSRAWQLVADRGAHVSISPLVEMQMRHGM
                     PPFQLALNYGILPSLSPDTETNMTTNPFSMMRSAFTLQRALANELVFPLSDPQGLKVP
                     QLVTSRQVIEMMTIAGAAGSGLLHKVGTLTPGKEADIVVLDANTLNTAPMNNVPGTVV
                     TLMESRNVRDVVIAGKIVYRDGKLVGWDVQKLLRDVTRARDRVLARINGPALAGALPA
                     GLNSHAEPYRPNFLGSTSYIGQNATAPAYVLRP"
     misc_feature    72330..73853
                     /locus_tag="CNE_BB2p00720"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08204"
                     /db_xref="CDD:181288"
     misc_feature    72339..73775
                     /locus_tag="CNE_BB2p00720"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(72516..72518,72522..72524,73131..73133,73212..73214,
                     73404..73406)
                     /locus_tag="CNE_BB2p00720"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            74109..74630
                     /locus_tag="CNE_BB2p00730"
                     /db_xref="GeneID:10920163"
     CDS             74109..74630
                     /locus_tag="CNE_BB2p00730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682735.1"
                     /db_xref="GI:339323842"
                     /db_xref="GeneID:10920163"
                     /translation="MKKEEDGLSALGRLLASAGAALALAGCAAAPTMVELQEVRGISA
                     QTLQARLGEPTDKVRLHDGRSRWLYSGQPLGLFVYAADFDTDGALVDYRQMLTMEELQ
                     QARPGAWAKQDVVARFGKPRLPIQYYALQKREVWSYRFQYVTQVAIFHFQFDAGGVLR
                     ATQMSINCFEDMM"
     gene            74741..75658
                     /locus_tag="CNE_BB2p00740"
                     /db_xref="GeneID:10920164"
     CDS             74741..75658
                     /locus_tag="CNE_BB2p00740"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682736.1"
                     /db_xref="GI:339323843"
                     /db_xref="GeneID:10920164"
                     /translation="MKWFVSFLLFVLCSTAWGQSLTLYGVIDIAIARNPGKGAWAMQN
                     GSGNRFGLRGTEDLGGGMQAFFNVENRFAGDTGAMRDPTRLFNDRSMVGILGRFGRFW
                     VGREYTPASWNVQIPADPLYNSTLMSMFLISTGGIGRVYNDKSVNYEFDVDGLTFSGQ
                     VAEDEGNKVPHRPVSFSVSYRAGSVLAAYGYDRPGGDRAIWHMVTGVYETQAFTLRAS
                     MGGGMTDTGNRRVSLILGATIPIRNSQLHISHGKLRDTTSDRTLMEKTGIAYYYSLSK
                     RTSLYADIVHDSNARPKHFGGEIGIKHRF"
     misc_feature    74798..75607
                     /locus_tag="CNE_BB2p00740"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(74801..74803,74819..74821,74825..74833,74900..74914,
                     74930..74932,74936..74944,74948..74950,74954..74965,
                     74999..75004,75008..75022,75047..75055,75161..75163,
                     75167..75172,75560..75565,75572..75574)
                     /locus_tag="CNE_BB2p00740"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(74816..74818,74885..74887,75002..75004,75095..75097,
                     75161..75163)
                     /locus_tag="CNE_BB2p00740"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(75691..76422)
                     /locus_tag="CNE_BB2p00750"
                     /db_xref="GeneID:10920165"
     CDS             complement(75691..76422)
                     /locus_tag="CNE_BB2p00750"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682737.1"
                     /db_xref="GI:339323844"
                     /db_xref="GeneID:10920165"
                     /translation="METTHFSRKLPLWYQACESIRAEIYNRLRTSELRLPPESQLAEE
                     HGVSLITVRQALTVLESEGLITRTRRRGTVINPLEAQPRKEMKVLGTLATVFNHDSAA
                     ELDLLEKLLVVTPEDLKATFRDATHLTYMRRLRHDKNGPINYAVNYMLPEFGENITEA
                     DMQKMPIPRILRDKFNVNVMRIDYSASAMEASADIASHLRVPPKSAILNLVATVFDHT
                     ERVVDVGRIYCPAGKFSFDISIDMS"
     misc_feature    complement(75715..76398)
                     /locus_tag="CNE_BB2p00750"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    complement(76195..76392)
                     /locus_tag="CNE_BB2p00750"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(76204..76215,76219..76224,76252..76254,
                     76261..76266,76270..76284,76306..76311,76315..76317,
                     76384..76386,76390..76392))
                     /locus_tag="CNE_BB2p00750"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(75718..76107)
                     /locus_tag="CNE_BB2p00750"
                     /note="UTRA domain; Region: UTRA; cl17743"
                     /db_xref="CDD:266805"
     gene            76719..77021
                     /locus_tag="CNE_BB2p00760"
                     /db_xref="GeneID:10920166"
     CDS             76719..77021
                     /locus_tag="CNE_BB2p00760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682738.1"
                     /db_xref="GI:339323845"
                     /db_xref="GeneID:10920166"
                     /translation="MSKGNVVLVVNCRIKPGKVEELMAALNANAEAARTTEPGCLQFD
                     VLVDPEDPTRIMYYEVYRDQAAIEAHAQTAHHKTWYTVGPPMLDVRERSDFIRVAP"
     misc_feature    76734..76979
                     /locus_tag="CNE_BB2p00760"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            77112..79646
                     /locus_tag="CNE_BB2p00770"
                     /db_xref="GeneID:10920167"
     CDS             77112..79646
                     /locus_tag="CNE_BB2p00770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682739.1"
                     /db_xref="GI:339323846"
                     /db_xref="GeneID:10920167"
                     /translation="MRPMASSGTQGASAGRRSVSKDQDIRAWYPAACQRAQQMLQAQN
                     WDHARQLFEAIDARLPPARAFERAVVLERIGQCLLAASRFDAAMPKLHAALTLAQRLA
                     PARAVGRLVYLLHAALGDGFRALGDVEQARQSYEAALAAARNAGDAGFVAQAWHRLGK
                     FDASLQRDAEASLSYAQAASAFRALGDLARAAQVLGEKGACLARAARPAEAITCYREA
                     LDLDARAVPSRRQLQHTCALARLLVGSAPAADIRGLVQHALDATSVLDPDAPEIWHAF
                     GVLADMAGIQADAASDAATASALRAEYLLFQGLHLRVPQLFATLASLGEGKSFGAAVV
                     LGRLGHSLWLAHRLEQSVRFLEQALATLAQAPEGASRMGLAAMLQRDLGDALLALDRP
                     AAACHAYEAGLAACKATQDVAGQSALRDRLADAARGAGAPAATAEAAVPAPGPMPESA
                     GFRLTMIDETAVSYVFDSGLLIDGVPESRQATWTPAGGASDGALCPTLVPFARSWADG
                     DSTTRFALRCEEPAFEPQPGCVLMRATWREVAVAGAVAVLAGLLRAMDGEHTVAQLLN
                     RLPPPDRCVGDALLRALADAGVIDLSGRAAGRLLHTLTKKGVLPGGGLDRDAVLHLAT
                     DGGHRAYPGAPRTTLGRSIPAELEAFHAITRARRSQRAYTGLPVARQPFDALLQIACG
                     ATGILTGASRDATLRAYPSSGGLYAVEIYPVILNVEGLPAAIYHLCPDEGELECVRPL
                     LRERLIEAMLPAEREMISGCAALICLTGYFPRHECKYGEGGYRMLVAESGHLSQNLIL
                     AATALGLSARPFGGVFDRLVNEVLGLEPSKEQFLLAVALGRVTPTP"
     misc_feature    77562..77777
                     /locus_tag="CNE_BB2p00770"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    78105..78335
                     /locus_tag="CNE_BB2p00770"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    79080..79628
                     /locus_tag="CNE_BB2p00770"
                     /note="This family is the oxydase domain of NRPS
                     (non-ribosomal peptide synthetase) and other proteins that
                     modify polypeptides by cyclizing a thioester to form a
                     ring. These include epoB, part of the epothilone
                     biosynthesis pathway; tubD, part of the tubulysin...;
                     Region: mcbC-like_oxidoreductase; cd02142"
                     /db_xref="CDD:239056"
     misc_feature    order(79080..79082,79086..79088,79092..79094,79542..79547,
                     79608..79610)
                     /locus_tag="CNE_BB2p00770"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239056"
     misc_feature    order(79092..79094,79206..79208)
                     /locus_tag="CNE_BB2p00770"
                     /note="NADPH bind site [chemical binding]; other site"
                     /db_xref="CDD:239056"
     gene            80088..80240
                     /locus_tag="CNE_BB2p00780"
                     /db_xref="GeneID:10920168"
     CDS             80088..80240
                     /locus_tag="CNE_BB2p00780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682740.1"
                     /db_xref="GI:339323847"
                     /db_xref="GeneID:10920168"
                     /translation="MGLRTSADTALRELRRAPGRKRKPRPRVVGIDDWAIARGHQYGT
                     IIVDLE"
     gene            80256..80408
                     /locus_tag="CNE_BB2p00790"
                     /db_xref="GeneID:10920169"
     CDS             80256..80408
                     /locus_tag="CNE_BB2p00790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682741.1"
                     /db_xref="GI:339323848"
                     /db_xref="GeneID:10920169"
                     /translation="MFAGREATAVTAWMRARPSIEIVARDRAGAYSEAVDIALPAAKR
                     VSDRWL"
     gene            80559..81545
                     /locus_tag="CNE_BB2p00800"
                     /db_xref="GeneID:10920170"
     CDS             80559..81545
                     /locus_tag="CNE_BB2p00800"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004682742.1"
                     /db_xref="GI:339323849"
                     /db_xref="GeneID:10920170"
                     /translation="MKGIKETTFRLLCAGGLAPALLISSAVWASGYPVKPVTLIVPQA
                     PGGANDAVARIVAQRLGAVLGQPIVVDNRPGAGGNIGIQVAAKAPHDGYTLLLTVGSS
                     FTINPSLYRKIPFDPVKDFEPITLMATAPYLLVTNPAIQARSVQDLIGLARSKPGKLD
                     YASAGNGTLNHLLGEMLKAKAGIDITHVPYKSAAAAATDVVAGQVPITFGSLPGVMPF
                     VKTGQLRVLGVATEKRSRLIPEVPTIGEAIPGYSAISWYGLLAPAGTPKEILAQLHAD
                     ATKVLNSKDVQDKLAAQGAEAASNTPEQFRALIKEDLVKWAKVVKDSGAQVD"
     misc_feature    80712..81533
                     /locus_tag="CNE_BB2p00800"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            81829..82242
                     /locus_tag="CNE_BB2p00810"
                     /db_xref="GeneID:10920171"
     CDS             81829..82242
                     /locus_tag="CNE_BB2p00810"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="YP_004682743.1"
                     /db_xref="GI:339323850"
                     /db_xref="GeneID:10920171"
                     /translation="MTARVTINANTTSTPYTVTISDGQGHQWLADEPAEVGGADAGPS
                     PGHLTLSSLGACTLITLQMFAARKEWPLMGVAVELELNPDGKPAAGGTVIRRNISLTG
                     ALNAEQQERLLQVADACPMHKLLTGEVRIDTLLVP"
     misc_feature    81829..82227
                     /locus_tag="CNE_BB2p00810"
                     /note="Predicted redox protein, regulator of disulfide
                     bond formation [Posttranslational modification, protein
                     turnover, chaperones]; Region: COG1765"
                     /db_xref="CDD:224679"
     gene            82242..83084
                     /locus_tag="CNE_BB2p00820"
                     /db_xref="GeneID:10920172"
     CDS             82242..83084
                     /locus_tag="CNE_BB2p00820"
                     /codon_start=1
                     /transl_table=11
                     /product="VacJ-like lipoprotein"
                     /protein_id="YP_004682744.1"
                     /db_xref="GI:339323851"
                     /db_xref="GeneID:10920172"
                     /translation="MQTTRLLTAAAAAALLAGCATGPTANPRDPLEPFNREVSRINED
                     FDKGVLRPVAQLYADYIPTPAQRAVENFFSNVSDVYSAGNNLLQGKPSRAAEDTMRVA
                     VNSVLGLGGLIDIATPAGLPKYKEDFGQTLGLWGVPAGPYLVLPLFGPSTVRDTGGML
                     VDRQFDPSAYIYPVSLRNSLVGVRIVAGRAQLLGATSLIEQAALDKYAFMRDAYLQRR
                     EYQIYDGNPPSRQDEAEAEAAPAAAPAESGKPAEETPAEVKQGSPSLPVPTTIVPPAI
                     RFGR"
     misc_feature    82308..82919
                     /locus_tag="CNE_BB2p00820"
                     /note="VacJ like lipoprotein; Region: VacJ; cl01073"
                     /db_xref="CDD:242285"
     gene            complement(83139..84125)
                     /locus_tag="CNE_BB2p00830"
                     /db_xref="GeneID:10920173"
     CDS             complement(83139..84125)
                     /locus_tag="CNE_BB2p00830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682745.1"
                     /db_xref="GI:339323852"
                     /db_xref="GeneID:10920173"
                     /translation="MTPRRLHLNSHSNAARNVMKKRAAVAGRKSGPFACRELELDDPR
                     PDEVLVRAELRHQLHPSRRPCKPLWQSLAAAWLAVGGLLGTASHRAYAGQICDAPYIH
                     DGGRIRFEADGLTPMTTLAFFRNVNDLERDLCSLDLDIYSKSALRRLMGPPVETVQRH
                     RLVIDERSGQPVVRSLNARVQAHGQYTELVGEMSTNSNGLLLYPPALVEGQVLPAETF
                     LSRYDFRIVDRHTGTKVSDFVGSNVRLTLSERTVGPLQRLKIATGTLLCWPIRYTKFV
                     DPGRFRLVDTDIELEPTVLDMIDWYCPARRFVMRQEVRYGNQHQVVDVVEIE"
     misc_feature    complement(<83931..84071)
                     /locus_tag="CNE_BB2p00830"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     gene            84385..84747
                     /locus_tag="CNE_BB2p00840"
                     /db_xref="GeneID:10920174"
     CDS             84385..84747
                     /locus_tag="CNE_BB2p00840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682746.1"
                     /db_xref="GI:339323853"
                     /db_xref="GeneID:10920174"
                     /translation="MMLKKVLKTVLVATVATAGAVSPAFAQSNKSDSNSVHTNGGRSG
                     AADPYTDGAKVGKADPYTDGTKSGKFDPYTDGARKSTKSNLKPSESAAKVGDPRSPYT
                     DGAKSGKADPFTDGAKKR"
     gene            85100..85663
                     /locus_tag="CNE_BB2p00850"
                     /db_xref="GeneID:10920175"
     CDS             85100..85663
                     /locus_tag="CNE_BB2p00850"
                     /EC_number="1.6.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="YP_004682747.1"
                     /db_xref="GI:339323854"
                     /db_xref="GeneID:10920175"
                     /translation="MIKILGISGSLRAQSYNTALLRAARAEADAHVRLDIGTLHGIPL
                     YDADLEAREGLPAAVVALREQVMASDGLILATPEYNNGIPGVFKNAIDWLSRPASDIP
                     AVFGNRPVAVLGASAGGFGTVLAQNDWLPVLKTLGTRHYSGSRLLVARAGQVFDAQGE
                     LTDVGMRARLKEFLAGFVAFVEGARAV"
     misc_feature    85106..85660
                     /locus_tag="CNE_BB2p00850"
                     /note="Predicted flavoprotein [General function prediction
                     only]; Region: COG0431"
                     /db_xref="CDD:223508"
     gene            complement(85670..86248)
                     /locus_tag="CNE_BB2p00860"
                     /db_xref="GeneID:10920176"
     CDS             complement(85670..86248)
                     /locus_tag="CNE_BB2p00860"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MarR family"
                     /protein_id="YP_004682748.1"
                     /db_xref="GI:339323855"
                     /db_xref="GeneID:10920176"
                     /translation="MYDNQRASHIHWGKRQGRVDPNGRTNPRKSKMDEFNLDELIYNK
                     PGHLIRRLHQIATSVFHEETDGFDTTPVQYAALAAVRAYPGIDQLRLANAIGFDRTTI
                     AGVVERLEGKGLISRSPGIADRRTKLLSLTATGAALLQGIYPGTERAQARTLAGLDQA
                     ERALFVAMLQRVVAANNETSRVPVSPPPARVA"
     misc_feature    complement(85733..86101)
                     /locus_tag="CNE_BB2p00860"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(85763..86065)
                     /locus_tag="CNE_BB2p00860"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            86275..87357
                     /locus_tag="CNE_BB2p00870"
                     /db_xref="GeneID:10920177"
     CDS             86275..87357
                     /locus_tag="CNE_BB2p00870"
                     /codon_start=1
                     /transl_table=11
                     /product="gentisate 1,2-dioxygenase"
                     /protein_id="YP_004682749.1"
                     /db_xref="GI:339323856"
                     /db_xref="GeneID:10920177"
                     /translation="MQMINQTIPSNTEDRHAGETASLPEEFRAALRDHALAPLWDFLK
                     AALPHGRPAGVTRPHRWRYADVRPLLLEAGRLVPVAQAERRVIVLSDPGRGPNAMSAT
                     GTLYAGIQLLLPGETAPTHRHSPSAARIVIEGRGGFTVVNGQRCEMERGDIILTPGGQ
                     WHDHGHDGEGPVTWLDVLDLPVFTAAESAYAEGGHDGCNAEEPLMTLTSELLRQGLRP
                     PRAWRCENPYPMLRYPWQTARAALERLAAATGQACAELAYVNPENGQDCLPVLGFTAM
                     MIGPDQHWQAVPTSASTVFHVVEGSGESRVDDHVFDWSAGDTFSATTFASVSHRATPG
                     QPAFLIRVDDAPLQKKLGFFQERQLA"
     misc_feature    86347..87342
                     /locus_tag="CNE_BB2p00870"
                     /note="Gentisate 1,2-dioxygenase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG3435"
                     /db_xref="CDD:225969"
     misc_feature    86596..86805
                     /locus_tag="CNE_BB2p00870"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            87392..88258
                     /locus_tag="CNE_BB2p00880"
                     /db_xref="GeneID:10920178"
     CDS             87392..88258
                     /locus_tag="CNE_BB2p00880"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="YP_004682750.1"
                     /db_xref="GI:339323857"
                     /db_xref="GeneID:10920178"
                     /translation="MRFCRFQDDRGERLGIVEDHFVADISPVVEMLPSHRWPFPPGDP
                     LVAHLQLIREHAPRLLDAAPRRALSAVRLLSPVANPSKLAAAPVNYLSHLAEAQADPA
                     TFHAHQLQRIQEVGLFLKASSSLAGPGEGVALRHTDRRNDHELELAVVIGRTADRVSV
                     ERAMDYVAGYAIGLDMTVRGPQERSLRKSIDSYSVLGPWLVTADEIADPANLELELRV
                     NGELRQRANTRDLVVGIPQLIAWASSYYTLHPGDVIYTGTPDGVGPVVPGDLIEASIE
                     GIGAMRVPVRAA"
     misc_feature    87494..88255
                     /locus_tag="CNE_BB2p00880"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    87635..88249
                     /locus_tag="CNE_BB2p00880"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            88281..89492
                     /gene="xlnD"
                     /locus_tag="CNE_BB2p00890"
                     /db_xref="GeneID:10920179"
     CDS             88281..89492
                     /gene="xlnD"
                     /locus_tag="CNE_BB2p00890"
                     /EC_number="1.14.13.24"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybenzoate 6-hydroxylase XlnD"
                     /protein_id="YP_004682751.1"
                     /db_xref="GI:339323858"
                     /db_xref="GeneID:10920179"
                     /translation="MNDSNKIQTLIVGGGIGGLATALALAQSGRTAHVLERAAQFSEV
                     GAGLQLAPNASRMLDRLGVLDAVWQSAVFPRQLVWMDAMSGRRLTALDLGASFRHAYG
                     YPYLVMHRSDLLAALLAACQRDARITLETSRDVVAVQDMGDGAEVRCADGSVYRCQAL
                     IGADGLHSTVRRMIADDGAPVCSEYVAYRGTLPIENMPEHAGLDNVVMWTGHAMHLVQ
                     YPVRRGELYNQVAVFRSDRFDPSTDDWGTVDELEARFANACAPVRDAISLIHTNRRWP
                     MYDRDPIADWTRNRIALLGDAAHPMLQYLAQGAAQAIEDAGTLADALTRHASDVPGGL
                     LAYQEARRLRTARVQLTARWFGDFIHLGHMGAEVRNALLSAREDDSFAPVDWLYAPRA
                     IATDAAMTGRV"
     misc_feature    88308..89462
                     /gene="xlnD"
                     /locus_tag="CNE_BB2p00890"
                     /note="Squalene epoxidase; Region: SE; cl17314"
                     /db_xref="CDD:266623"
     misc_feature    88335..89456
                     /gene="xlnD"
                     /locus_tag="CNE_BB2p00890"
                     /note="salicylate hydroxylase; Provisional; Region:
                     PRK08163"
                     /db_xref="CDD:181262"
     gene            89497..90837
                     /gene="pcaK1"
                     /locus_tag="CNE_BB2p00900"
                     /db_xref="GeneID:10920180"
     CDS             89497..90837
                     /gene="pcaK1"
                     /locus_tag="CNE_BB2p00900"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate transporter PcaK"
                     /protein_id="YP_004682752.1"
                     /db_xref="GI:339323859"
                     /db_xref="GeneID:10920180"
                     /translation="MSAMNDTLAAPQPAVGAMLRGRPMSRYQRIVIGICIAINVLDGF
                     DALASAFTAPAVAAQWQLPAALLGMLLSASVAGMALGSVLIAPLGDKLGRRPIVLGCL
                     AMIGTAMLASAFAANVWQLAGLRLVTGLGVGGIIAGINTLVAEYASDRRRDLALSMTT
                     VGYAVGAICGGAASGLLVGSYGWRSVFLVGGLLSVLMVPVAFAWLPESLDFLAGKQPG
                     NALARLNQVLHKAGVAPLQTLPPQGEQARQGSAWRSLFHPDFRRLTLLACACYLLVML
                     TNYFLLSWMPKLLVDMGMSMEQGISGAVIMNLSGVAGGIALGWSAGRYGLRAMSVIYL
                     CLCFLSVAWFGSLSAAPGHVLAVSAVIGFLITGAVASLNALSPRVFPPAVRATGTGLA
                     LGFGRLGGTAGPWLAGVLIQAGWSRTQFSIVLATPLLAAAVLFTLALAKERSTA"
     misc_feature    89539..90729
                     /gene="pcaK1"
                     /locus_tag="CNE_BB2p00900"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    89590..90810
                     /gene="pcaK1"
                     /locus_tag="CNE_BB2p00900"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(89632..89634,89641..89649,89653..89658,89707..89709,
                     89716..89721,89728..89730,89740..89745,89749..89754,
                     89890..89895,89902..89907,89914..89919,89926..89928,
                     89962..89967,89974..89979,89995..89997,90319..90321,
                     90328..90333,90340..90345,90352..90354,90391..90393,
                     90403..90405,90415..90417,90424..90426,90436..90438,
                     90580..90582,90589..90594,90601..90603,90613..90618,
                     90625..90627,90658..90663,90670..90675,90682..90687,
                     90694..90696)
                     /gene="pcaK1"
                     /locus_tag="CNE_BB2p00900"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            90965..91960
                     /locus_tag="CNE_BB2p00910"
                     /db_xref="GeneID:10920181"
     CDS             90965..91960
                     /locus_tag="CNE_BB2p00910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682753.1"
                     /db_xref="GI:339323860"
                     /db_xref="GeneID:10920181"
                     /translation="MQEGISLWEAAKREMDDYQFVAGAELQPKWEVPSEIAINVAVSG
                     RFSDSQEEGHPTSIEAYVDAASEVIEAGACGVHIDFSMVTDRQGRRLDRDVPPVEAYG
                     AVLRPLRDRFGHEFVANLNVLNGSTFDICMSPARAGLAEVAPCAAGHPDAFMVPAVRT
                     LEEHGVKPEIVIHSSGEIELAKRKLIDTGILKGPYNWIILYGLPFNVGRTLISGTWAS
                     NAQDMARHMFMMVDQIRQIDPASVITVCAAGRSTLYMTTLATMMGLNIRVGTEDTPWK
                     YPNSDVRLRDNLEMFRMARDIAELHGRRPASADAYRRMIGKPARAGMATAAQVPA"
     misc_feature    91076..91912
                     /locus_tag="CNE_BB2p00910"
                     /note="Prokaryotic protein of unknown function (DUF849);
                     Region: DUF849; cl15827"
                     /db_xref="CDD:265796"
     gene            91957..92682
                     /locus_tag="CNE_BB2p00920"
                     /db_xref="GeneID:10920182"
     CDS             91957..92682
                     /locus_tag="CNE_BB2p00920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682754.1"
                     /db_xref="GI:339323861"
                     /db_xref="GeneID:10920182"
                     /translation="MTSRPLDGFRSGAPDPAVWQVLEMPMPDGGMWRYEEPGARVQAE
                     GGVLEMQVDRFTRQHARIPMFDNPKHFLVMREALTIAEGGVLTIGCEMACENHNGNPD
                     DLFDGFAGFNVCDLANGMVFDFIISGTQIGVVHERLPIPGVTPAGGDWLHVVQSPLLA
                     QNHPGEFHRYEITIDRSARTCTWHVDDRRMYAVRNIAVDIGSVVVALGLFTLKPAVAG
                     VGSVSNHGQGASGRWRNLWVRAA"
     gene            92723..93715
                     /gene="phtD"
                     /locus_tag="CNE_BB2p00930"
                     /db_xref="GeneID:10920183"
     CDS             92723..93715
                     /gene="phtD"
                     /locus_tag="CNE_BB2p00930"
                     /EC_number="4.1.1.55"
                     /codon_start=1
                     /transl_table=11
                     /product="4,5-dihydroxyphthalate decarboxylase PhtD"
                     /protein_id="YP_004682755.1"
                     /db_xref="GI:339323862"
                     /db_xref="GeneID:10920183"
                     /translation="MSKLNLSLAIGDYDRTRALLDGRVPIDGVDPVFLALDPEEIFFR
                     AFRHAEFDICELSLSSFTVKTARESCPYVGVPVFLSRAFRHTAIYIRTDRGIREPADL
                     RGKRVGVPEYQLTACVWVRAMLEEDYGVRPSELQWIRGGQEQPGRVEKIELALPADVR
                     LESAPDGATLNAMLAAGEIDALIAPRPPSCWVQGHPGVGRLFSDPVQAASDYFRRTGI
                     FPIMHLLGVRRELVHAHPWLPGALLKAFERAKAVAMSSLAEIAASAITLPLAQETMQS
                     MQGLMGQDYWSYGAAQNLHTLDAFLQYHHAQGLSPRRVRVEELLHPSTLEVHRV"
     misc_feature    <92942..>93274
                     /gene="phtD"
                     /locus_tag="CNE_BB2p00930"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     misc_feature    <93191..93469
                     /gene="phtD"
                     /locus_tag="CNE_BB2p00930"
                     /note="NMT1-like family; Region: NMT1_2; cl17432"
                     /db_xref="CDD:266680"
     gene            complement(93733..94260)
                     /locus_tag="CNE_BB2p00940"
                     /db_xref="GeneID:10920184"
     CDS             complement(93733..94260)
                     /locus_tag="CNE_BB2p00940"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004682756.1"
                     /db_xref="GI:339323863"
                     /db_xref="GeneID:10920184"
                     /translation="MATSRTKPTTKASKPEPAGAHPPVFDVGGRSIAWHVRDLHRLFT
                     SHLQALMTDEGASVGHWYYLRVLSEQTGLTQLELSRRVGLAATTSVPALDSMEKQGLV
                     KRVRDTEDRRRSFVFITEQGRALVERLMPAITALLEHAVDGVSERELKSFLKVMVRIQ
                     ENLLTAAPSLSEVND"
     misc_feature    complement(93787..94152)
                     /locus_tag="CNE_BB2p00940"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(93814..94104)
                     /locus_tag="CNE_BB2p00940"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            94401..95477
                     /locus_tag="CNE_BB2p00950"
                     /db_xref="GeneID:10920185"
     CDS             94401..95477
                     /locus_tag="CNE_BB2p00950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682757.1"
                     /db_xref="GI:339323864"
                     /db_xref="GeneID:10920185"
                     /translation="MKDNRFGPAPGDGAVAGQGELWTRDGFNGTCSMVLRPHYAPAYL
                     SAHGPHAPRHFQLDKLAMSHGDDALAMPVPVASSRKGVQLSAALQDQEAPIVVRNVEA
                     DELHFVHRGEVRFETDCGVLDAQAGDFVCIPRSVAYRTTPQGGPAWRFIVESPSPLRL
                     NPQTPSGMINFARDVHYARVEPQQDDHAPTEVTLVLKAEDGPTVFRLAQDPLRAVAHV
                     YGNVPVWKVNLANVQVGTYLPHGGPPFQFITSDDGEIMIYTLCARTTQRPPIHVNADF
                     DEVILYHAGPGAWGDVSEPGTVSWVPKGVIHQGPSEDVPQGYQAWLLETRPTLRLTPV
                     ALEASALLDTREYGIHPSELAMQR"
     misc_feature    94470..95429
                     /locus_tag="CNE_BB2p00950"
                     /note="homogentisate 1,2-dioxygenase; Region: HgmA;
                     cl17306"
                     /db_xref="CDD:266617"
     gene            95545..97194
                     /locus_tag="CNE_BB2p00960"
                     /db_xref="GeneID:10920186"
     CDS             95545..97194
                     /locus_tag="CNE_BB2p00960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682758.1"
                     /db_xref="GI:339323865"
                     /db_xref="GeneID:10920186"
                     /translation="MNANTFQARAAGALALALCAQPAPPAHAFQIPTDNEDLTIRWDN
                     TIKYSVAQRLKDRSPTLTADANADDGDRNFRRWGLISNRVDLLSEFDVSYRNFGVRVS
                     GAAWYDDVYNRGNDNDSVATANAASVPHDRFPGGTRTINGRNVELLDAFAFGKVEVSG
                     MPVSVRLGQHSVLYGESLFFGNNGIAAAQSPIDLVKLLSVPNTQFKELIRPVPQVSGQ
                     VQVTPNLAVGGYYQFDWERNRLPGVGSYFSAVDILDAGGERILAGPGAYFSRTGDIKA
                     KSSGQGGVQLRYRPRGLDAEFGLYAANFHAKDPVVYTSFAGQDLAAGKLGQYQLVFPE
                     DIKVIGTSFSTTLGTANVAGELSYRHNMPLVARGGSVFVPPGMSANNAGNPLYPVGDT
                     LHGQISWINLLSPTALWEGGSIVGEIAWNRRLGVSRNGGALDPNATRDAGAIRMVFQP
                     AYYQVINGLDINVPIGIGYGLFGKSSVLNPGFGVHRGGDLSVGVNGVYEQVWNIGLNY
                     THYFGPAATVLTPPNAASQAYSYGQTFKDRDFVSLTIQRAF"
     misc_feature    95653..97191
                     /locus_tag="CNE_BB2p00960"
                     /note="Protein of unknown function (DUF1302); Region:
                     DUF1302; pfam06980"
                     /db_xref="CDD:254001"
     gene            97212..98594
                     /locus_tag="CNE_BB2p00970"
                     /db_xref="GeneID:10920187"
     CDS             97212..98594
                     /locus_tag="CNE_BB2p00970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682759.1"
                     /db_xref="GI:339323866"
                     /db_xref="GeneID:10920187"
                     /translation="MKPFSIVTIVTPWLAAAMLAAQPAQAMVSAQEAAALKSTLTPFG
                     AERAGNKDGSIPAWTGGHTQMPPNYKSGDPPPDLFAADKPLLKIDAKNAAQYADKLSE
                     GVKGLLKKYPDTFRLDVYPTRRTAAAPQWVYDNTFQNATRARTTDNGLWVEGAYGGIP
                     FPIPKNGNEAMWNHKLQWTGETVSSYFVNYVGTPDGKLIMATKGYNKSQYPYYEKGGA
                     MDKFTGESQQLRIFTTEPPLKAGSQFLLVDAVNRPRQAWEYLTGQRRVRKAPTLGYDT
                     PDDINSGQSYFDEAFVFLGELDRYNWKLVGKKEIYIPYNNNKVYQKGLSLEQLLLPHH
                     ANPDSMRWELHRVWVVEAELAPGKRHVVPKRRLYLDEDTWAAVLGEGWDAQGQLWRVQ
                     VAMPYVVPEGPFVNATSSWCIYNLLSGAYLAAAFPDYGSPGFRYHYKLLDRIPSSYFS
                     PEALAGEGVR"
     misc_feature    97473..98579
                     /locus_tag="CNE_BB2p00970"
                     /note="Protein of unknown function (DUF1329); Region:
                     DUF1329; pfam07044"
                     /db_xref="CDD:254034"
     gene            98605..99690
                     /locus_tag="CNE_BB2p00980"
                     /db_xref="GeneID:10920188"
     CDS             98605..99690
                     /locus_tag="CNE_BB2p00980"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_004682760.1"
                     /db_xref="GI:339323867"
                     /db_xref="GeneID:10920188"
                     /translation="MVHVETNAMFACMKTPRRRGAGRLALLLAGAATAAALVQGAAAA
                     EPVRAFRHDAALVGVASAGTRLVAVGERGTVVLSDDGSRNWRHASAPTDVTLTSVHFA
                     TPREGWATGHAGTVLHTADGGLTWSRQLDGEAAARLMLAAAGKDPARRAEAQQLVEDG
                     PDKPFLDLYTADASTALVVGAFNLAFRTTDGGRRWVPWQDRIPNPKSLHLYGIAGAGR
                     DLYIAGEQGLLLRSADAGETFRPLASPYRGTFFGVLVQTDGGVIVYGLRGNAFRSTDQ
                     GANWSRLALGTTAAITGGVALADGRTALATQAGELFVSEPVRPEAFVRVVPDHTQPFA
                     GAAQQGDRIVLVGARGSSAAPATAGRQ"
     misc_feature    98809..>99189
                     /locus_tag="CNE_BB2p00980"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     misc_feature    99067..>99477
                     /locus_tag="CNE_BB2p00980"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     gene            99712..102153
                     /locus_tag="CNE_BB2p00990"
                     /db_xref="GeneID:10920189"
     CDS             99712..102153
                     /locus_tag="CNE_BB2p00990"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_004682761.1"
                     /db_xref="GI:339323868"
                     /db_xref="GeneID:10920189"
                     /translation="MHQKQSKAGQADWQVVPHIQDFDAGSGSVVERLIFNHRAWIVAL
                     CVIVTMLLGWQAMRVRLNADFEKMIPAAHPYIQNYLQSKADLSGQGNSVRVAVETREG
                     TIFDAGYLDRLKTINDELFLIPGVDRAYQKSLWTANTRWLGVTEEGLEGGTVIPDDYD
                     GSTRTVEQVRRNVERSGEIGQLVAGNYRSSIIFLPLLERDPGDGQALDYKRFSDALEA
                     VRQKYETRDIRIHVTGFAKVMGDLITGIGEVMVFFALAVVIAAAAVLWYTRCLRSMLL
                     VVLTSLLAVFWQLGLLPLLGYALDPYSVLVPFLVFAIGMSHGAQKMNGIMQDIGRGMH
                     RLVAARYTFRRLFMAGLSALLCDAVGFAVLLVIRIPVIQELAVVASLGVAILIFTNLV
                     LLPVLLSYTGVDAKAATRALRSQDTPAQAGGPWRFLERFTTARWALAALLPAAVLGLG
                     GYLVSQHLQVGDLDEGAPELRADSRYNRDDRFMTANYAASSDLLVVMVRTPDGHCADY
                     ATLRQVDALEWQLRQLPGVEGTNSLALLARRVVAGMAEGSPKWYELVQNQATLNTAAN
                     RSPRESFNQACNLLSLYVYLQDHRAETLARVVSAVEAFATTHDSQHARFMLAAGSAGI
                     EAATNIVVRQASREMLFWVYGAVIVLCMLTFRSWRAAVCAVVPLVLTSVLAEALMVAL
                     GLGVKVATLPVIALGVGIGVDYALYIMTIVLAELRAGASLPQAYRRALRFTGKVVMLT
                     GVTLAIAVATWTLSPIKFQADMGVLLAFMFLWNMLGALILLPALAWVLLPEGRAGRSP
                     VPVDAIADGASGARH"
     misc_feature    99799..102099
                     /locus_tag="CNE_BB2p00990"
                     /note="Predicted exporters of the RND superfamily [General
                     function prediction only]; Region: COG1033"
                     /db_xref="CDD:223964"
     misc_feature    <100300..101016
                     /locus_tag="CNE_BB2p00990"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <101644..102093
                     /locus_tag="CNE_BB2p00990"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            102189..103100
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /db_xref="GeneID:10920190"
     CDS             102189..103100
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /EC_number="1.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H azoreductase AzoB"
                     /protein_id="YP_004682762.1"
                     /db_xref="GI:339323869"
                     /db_xref="GeneID:10920190"
                     /translation="MKVMVTGGTGTTGSQVVRELLARGVQVKILTRSAERAKAISPRV
                     EAVVGDLLSPSDLRPAFEDIDALFLLLAGVPSEAHEGLTAVALARAAGVKRIVYLSVH
                     QTARPPRHVPHIGSKLLIESVIRDCGVPYTFLRPNVFMQNDYWYRDALLGHAIYPQPL
                     GDLGASLCDVRDIAEAAAIVLTTDGHDGQAYTIAGPEPFTGKRAAALWSAVLGKAIAY
                     GGHDMERWEQQQLTHGAPQWFALDLKMMFTAWQTDGLVATDEELGRLASLLGHSPRCY
                     EDFVAETASGWPVGQSQIAAFEGRTFS"
     misc_feature    102219..102770
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /note="NAD dependent epimerase/dehydratase family; Region:
                     Epimerase; pfam01370"
                     /db_xref="CDD:250566"
     misc_feature    102228..103016
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(102279..102287,102396..102401,102483..102491,
                     102525..102527,102537..102539,102594..102605)
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(102417..102419,102489..102491,102525..102527,
                     102537..102539)
                     /gene="azoB"
                     /locus_tag="CNE_BB2p01000"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            103125..103847
                     /locus_tag="CNE_BB2p01010"
                     /db_xref="GeneID:10920191"
     CDS             103125..103847
                     /locus_tag="CNE_BB2p01010"
                     /codon_start=1
                     /transl_table=11
                     /product="PE-PGRS family protein"
                     /protein_id="YP_004682763.1"
                     /db_xref="GI:339323870"
                     /db_xref="GeneID:10920191"
                     /translation="MPTTILDPFHSGKPAPETWRTLELPTGDGATWTFRDPGLRMKAS
                     DGVLQASIQTFRIRHDQVQMFDNPKLLMVMQKPVPLSETDVTTISWEMACENHNGNSD
                     DLLDGFAVLSLGDFKTGMVFDFIMSGKCIGVVYERLALPGIVPTGEDWIHVVQSPLMA
                     QSRPGEFHRYEIRFDRRARACEWWLDGKRMYAVADIPVEVHSVTPGVGLMTLKPLEAG
                     KSSVSNHGQGATGRWRNLAVHG"
     gene            104262..104822
                     /locus_tag="CNE_BB2p01020"
                     /db_xref="GeneID:10920192"
     CDS             104262..104822
                     /locus_tag="CNE_BB2p01020"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004682764.1"
                     /db_xref="GI:339323871"
                     /db_xref="GeneID:10920192"
                     /translation="MELGLKGRVAVITGASKGVGKGVARALAAEGVNIVLVARGREAL
                     VQAAEDIEETFSVHALPVEADVTDTASVRAAAETVREHFGAAHILVNNAGAAIKRQDR
                     EITWDDSDWINQVQIKSVGALRMIREFLPLMPHDGTGRIINIAGASGSMAWMPALTYG
                     LNNAALMHVTGYLAADLADAWPWCAC"
     misc_feature    104283..104795
                     /locus_tag="CNE_BB2p01020"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    104289..>104795
                     /locus_tag="CNE_BB2p01020"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(104301..104303,104307..104318,104373..104381,
                     104451..104459,104535..104543,104610..104612,
                     104691..104699,104736..104738,104748..104750)
                     /locus_tag="CNE_BB2p01020"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(104613..104615,104697..104699,104736..104738,
                     104748..104750)
                     /locus_tag="CNE_BB2p01020"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            104857..105759
                     /gene="pdhA2"
                     /locus_tag="CNE_BB2p01030"
                     /db_xref="GeneID:10920193"
     CDS             104857..105759
                     /gene="pdhA2"
                     /locus_tag="CNE_BB2p01030"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component PdhA"
                     /protein_id="YP_004682765.1"
                     /db_xref="GI:339323872"
                     /db_xref="GeneID:10920193"
                     /translation="MVPIVADEARTFGMASLFRQVGIYSSQGQLYEPEDAGSMLYYRE
                     DVRGQILEEGITEAGAMSSWIAAGTAYSTHGTAMLPLYIYYSMFGFQRIGDLIWAAGD
                     QRARGFLVGATAGRTTLSGEGLQHQDGTGHVIAATIPNCRAYDPAYAYELAVIVDEGM
                     RAMMERQEDVFYYLTVMNENYAQPSMPAGVERDIVRGMYRLAQVEGGGRGKVRLLGSG
                     AILREVEAAAQMLAEHWQVDSEVFSVTSFSELERDAREVVRQRLHHPQAEVSPAHVET
                     LLAGNAPVVAPTDYVRAYPQLIAP"
     misc_feature    105016..105381
                     /gene="pdhA2"
                     /locus_tag="CNE_BB2p01030"
                     /note="Pyrimidine (PYR) binding domain of thiamine
                     pyrophosphate (TPP)-dependent enzymes; Region:
                     TPP_enzyme_PYR; cl11410"
                     /db_xref="CDD:264357"
     gene            105760..105975
                     /gene="pdhA3"
                     /locus_tag="CNE_BB2p01040"
                     /db_xref="GeneID:10920194"
     CDS             105760..105975
                     /gene="pdhA3"
                     /locus_tag="CNE_BB2p01040"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component PdhA"
                     /protein_id="YP_004682766.1"
                     /db_xref="GI:339323873"
                     /db_xref="GeneID:10920194"
                     /translation="MQAPYSVLGTDGYGRSDNRPTLRRFFEVDRVYVCVAALRALAAQ
                     GTVPTSLVAEALARYDIDVSKKAPSSI"
     misc_feature    <105769..105966
                     /gene="pdhA3"
                     /locus_tag="CNE_BB2p01040"
                     /note="pyruvate dehydrogenase subunit E1; Reviewed;
                     Region: aceE; PRK09405"
                     /db_xref="CDD:236500"
     gene            106372..106716
                     /locus_tag="CNE_BB2p01050"
                     /db_xref="GeneID:10920195"
     CDS             106372..106716
                     /locus_tag="CNE_BB2p01050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682767.1"
                     /db_xref="GI:339323874"
                     /db_xref="GeneID:10920195"
                     /translation="MRATIRTIHQLGGATRAGEGIPIDQAARHCGVSIGMLSKLENRK
                     GVNLEHALRVLDELGLAMLVVPKAHAPWLEEAAAHASKTGELAAWDKRAPRCRGAEMA
                     CCAPSLSRLSMP"
     misc_feature    106396..106557
                     /locus_tag="CNE_BB2p01050"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cl17200"
                     /db_xref="CDD:266550"
     gene            complement(106724..107320)
                     /locus_tag="CNE_BB2p01060"
                     /db_xref="GeneID:10920196"
     CDS             complement(106724..107320)
                     /locus_tag="CNE_BB2p01060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682768.1"
                     /db_xref="GI:339323875"
                     /db_xref="GeneID:10920196"
                     /translation="MAFAHLYEPHLRLSAGYAAAKIAPRDLPLNTMGFEQLAALKAQL
                     AAQAKAEKAAKAAEVPKRATPPRARDAAPANSAKPVDPVVHTIARLQRRFPQAFPKNP
                     APKVPLKIGLFEDLLPHAQKLALTEAELREAIKTWCRGARYWACLIEGASRMDLAGQE
                     AGQVRPEDAKRAQQLQARRSPGAPSKSAKASHPVDAAR"
     misc_feature    complement(order(106766..106768,106781..106783,
                     106862..106864,106934..106939,106994..106996,
                     107114..107116))
                     /locus_tag="CNE_BB2p01060"
                     /note="putative RNA binding sites [nucleotide binding];
                     other site"
                     /db_xref="CDD:238145"
     misc_feature    complement(106784..107089)
                     /locus_tag="CNE_BB2p01060"
                     /note="ProQ/FINO family; Region: ProQ; pfam04352"
                     /db_xref="CDD:252542"
     gene            107565..107798
                     /locus_tag="CNE_BB2p01070"
                     /note="integrase/recombinase"
                     /pseudo
                     /db_xref="GeneID:10920197"
     gene            complement(108598..109953)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /db_xref="GeneID:10920198"
     CDS             complement(108598..109953)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /EC_number="6.3.4.14"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase AccC"
                     /protein_id="YP_004682769.1"
                     /db_xref="GI:339323876"
                     /db_xref="GeneID:10920198"
                     /translation="MQTVLIANRGAVAARVQRTLRRMGLRSVVVYSEADRDLPYVAEA
                     DAAYCIGPSPAAQSYLNEGALFDAMRRSGADAVHPGYGFLSENAGFASRVEAAGLTFI
                     GPSPRWIDAMGHKTRARDLMAKHGMPMCRSSGIVDDDPAAIRAAGAAVGYPVLVKPAG
                     GGGGIGMIAAHDDAELVDAVGRARALAQRSFGNGDVYLEQLFQRPRHIEFQIVGDRHG
                     NVQHLLERDCSVQRRHQKVIEEACAPGLPPGEADEIAARVARLLGKLGYDVIGTVEML
                     RSADGSYSFLEMNTRLQVEHAVTEAITGLDLVEAQIRLAAGETLRDVLPSPVRASGHA
                     IELRIYAEDPVRFFPSPGTLQTFRLPSGTGIRVETGYAEGNTVSPYYDPMIAKLIINA
                     ADRQAAIEIAERALAVTEIIGVKTNIPLLQRMLAFPAWRVGELHTGLVQDLLACGEAR
                     M"
     misc_feature    complement(108622..109950)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK06111"
                     /db_xref="CDD:180406"
     misc_feature    complement(109633..109950)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(108991..109611)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(108634..108948)
                     /gene="accC"
                     /locus_tag="CNE_BB2p01100"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(109973..111505)
                     /locus_tag="CNE_BB2p01110"
                     /db_xref="GeneID:10920199"
     CDS             complement(109973..111505)
                     /locus_tag="CNE_BB2p01110"
                     /EC_number="2.1.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA carboxyltransferase 12S
                     subunit"
                     /protein_id="YP_004682770.1"
                     /db_xref="GI:339323877"
                     /db_xref="GeneID:10920199"
                     /translation="MAFETLISELAERESRARQMGGPEKLAKRKADGVLNARERIDYL
                     ADPGSFLESGLLATSYRPDDRDRSPADGKIAGYARIDGRDVALVSNDFTVLGASSSTV
                     NGNKIGHMKTVATRRGLPMVFLGESTGARMPDTMGARGIGSGDRPTQYMRTRETPWTS
                     AVLGHCYGSSSWYAALADFAVMRKGAVMAVSSVKLTSIAIGEEVDPEALGGWETLTGV
                     SGLVDMAVDSDEEALDAVKRFLSYLPSHHNEAPPVYPVPPGSGAQAHRILDIVPESRT
                     RVYDVRKVIPLIVDLDSMFEVKARYGKSVVTALARIDGRSVGIIANNPIAKGGAIDVD
                     ACNKATSFMVMCDSFNIPLVFLTDQPGFLIGIEGERRGAVGRVMNWMNALSLVTVPKI
                     AIIMRKTYGQAVLNMGGAGNADELIAWVSAEVNFMDPRSGVTIVHGVRQQDDPERYAT
                     LLQGMERDTSAWDMGAAYAAHMVINPVDTRATLTRLLEVHRMRLTGGVGQHLMRAWPT
                     SY"
     misc_feature    complement(110039..111505)
                     /locus_tag="CNE_BB2p01110"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    complement(110735..111403)
                     /locus_tag="CNE_BB2p01110"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    complement(<110267..>110599)
                     /locus_tag="CNE_BB2p01110"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            complement(111522..112553)
                     /locus_tag="CNE_BB2p01120"
                     /db_xref="GeneID:10920200"
     CDS             complement(111522..112553)
                     /locus_tag="CNE_BB2p01120"
                     /codon_start=1
                     /transl_table=11
                     /product="exported protein"
                     /protein_id="YP_004682771.1"
                     /db_xref="GI:339323878"
                     /db_xref="GeneID:10920200"
                     /translation="MGQRTARGKTPRWPSTPEHIRRQPMKRRSWCITALLLACLPAGQ
                     AVAHDWPAKPIRLVVPYAPGGTNDRLAREYAEFLRKKLSQAVLVENRPGASTNIGSEL
                     VAKAEPDGYTFLIGIDGLATNPYTGPVPPFNAQKDLLPISLLTRVPCLIAANNQFAAA
                     NVADMISLARTHPDRYSISSAALVLQVGLLNSGSKIRLTHVPYKGGAQAAGDAMGGQV
                     DMVIANVPVLAPFVRGGKLRPLAVTSATRSAAFPEVPTLKESGMSDAVFSNWYGVFAP
                     AGTPEPVISRMAALSRQFVTDPAVSKQLSSEGYQLEASTPAELATLIHTDAAAASRFV
                     AANPALFRK"
     misc_feature    complement(111582..112343)
                     /locus_tag="CNE_BB2p01120"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(112571..113605)
                     /locus_tag="CNE_BB2p01130"
                     /db_xref="GeneID:10920201"
     CDS             complement(112571..113605)
                     /locus_tag="CNE_BB2p01130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682772.1"
                     /db_xref="GI:339323879"
                     /db_xref="GeneID:10920201"
                     /translation="MGAPALGMPLPRLDKGRITASHVVRWCAAQENWDRIHYDRAYAR
                     EVAGLPDAVINGALKQQFLAQLATAAFGERCWLWRLACRFRSPDLVGQHLRAEGCVRA
                     VERQAQATAVHLDQHLFNVDTARVTTDGTAVVLLPVNGADAPDALPGAYHDAGDAEDA
                     PPSAAAPLDTSVPAPIRRRIGSEIERIVSFSPVEAGRLRLFAEAVMDLPHWHHDPQAA
                     RTSVHRGLVAPPLFPIHAMSWPAGAHPLGTAPDALGREAVCEVGRDFSRRFGLPPQGL
                     LNGGTRVRIHALARPDDTVQASCRLRDVRYRVGTSGAPMLIFETENRYDTTDGRLLLH
                     ERQTTLQRLA"
     misc_feature    complement(113276..113587)
                     /locus_tag="CNE_BB2p01130"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    complement(order(113345..113356,113438..113443))
                     /locus_tag="CNE_BB2p01130"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    complement(order(113372..113380,113402..113404,
                     113411..113416,113423..113425))
                     /locus_tag="CNE_BB2p01130"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     misc_feature    complement(112643..113032)
                     /locus_tag="CNE_BB2p01130"
                     /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
                     Catalyzes the hydration of trans-2-enoyl CoA to
                     (R)-3-hydroxyacyl-CoA as part of the PHA
                     (polyhydroxyalkanoate) biosynthetic pathway.  The
                     structure of the monomer includes a five-strand
                     antiparallel...; Region: R_hydratase_like; cd03441"
                     /db_xref="CDD:239525"
     misc_feature    complement(order(112913..112918,112925..112927,
                     112970..112972,112976..112978,112985..112987,
                     113000..113002))
                     /locus_tag="CNE_BB2p01130"
                     /note="active site"
                     /db_xref="CDD:239525"
     misc_feature    complement(order(112916..112918,112970..112972,
                     112976..112978,112985..112987))
                     /locus_tag="CNE_BB2p01130"
                     /note="catalytic site [active]"
                     /db_xref="CDD:239525"
     gene            complement(113695..115275)
                     /gene="pccB"
                     /locus_tag="CNE_BB2p01140"
                     /db_xref="GeneID:10920202"
     CDS             complement(113695..115275)
                     /gene="pccB"
                     /locus_tag="CNE_BB2p01140"
                     /EC_number="6.4.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="propionyl-CoA carboxylase beta subunit"
                     /protein_id="YP_004682773.1"
                     /db_xref="GI:339323880"
                     /db_xref="GeneID:10920202"
                     /translation="MDMTQSIPSEDLLELERRRELALGLGGPEAIERHHAAGKLTIRE
                     RIDALSDKSSFHEVGRLTGQGHYDENGVLVKVTPAPYVMGLATVDGRPVAIGGEDYTV
                     RGGASWSGDRKKGGQGGFVEDLALNYKIPLINLIDGVGGSVTSAQRRGHTVFPGVHGF
                     ETSAALLGQVPVVCAVLGTAAGGPAGRTILSHWSVMVNGTSQIFAAGPPVVKRSLGQD
                     ISKDDLGGAPIAVDVAGSVDNAVETEADCFALIRRYLSYMPQNVWELPPETPCDDPVD
                     RREEALATIVPSDRRKAYDMRKIVRMVFDRGSVFEIQPTYGKAVITSLTRLNGKVVGV
                     VASNPMAYGGAIDAKAARKQTHFIELCDTFHIPLVFLVDVPGFMVGRDAEAQGTLREG
                     MRSVFVSLQATVPIATVVIRKCYGMAGMAATDKNGLGLKLAWPTAEWGSLPIEGGVAA
                     AFRREIATAPDPVAKEREIEQRLRQLASPFRTAEAFGVEDIIDPRETRQTLSRFIDAA
                     QISLKTTLGPKLRAGVRP"
     misc_feature    complement(113752..115200)
                     /gene="pccB"
                     /locus_tag="CNE_BB2p01140"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    complement(<114043..>114324)
                     /gene="pccB"
                     /locus_tag="CNE_BB2p01140"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            complement(115286..115507)
                     /locus_tag="CNE_BB2p01150"
                     /db_xref="GeneID:10920203"
     CDS             complement(115286..115507)
                     /locus_tag="CNE_BB2p01150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682774.1"
                     /db_xref="GI:339323881"
                     /db_xref="GeneID:10920203"
                     /translation="MSVKVKSEVVGSVWKCECETGQTVGEGDVLFIIESMKMEIPVEA
                     THAGTVSEVLVKEGESIAEGQLLAVVDPA"
     misc_feature    complement(115298..115495)
                     /locus_tag="CNE_BB2p01150"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(115373..115375,115394..115402,
                     115427..115429))
                     /locus_tag="CNE_BB2p01150"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(115397..115399)
                     /locus_tag="CNE_BB2p01150"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(115566..116789)
                     /locus_tag="CNE_BB2p01160"
                     /db_xref="GeneID:10920204"
     CDS             complement(115566..116789)
                     /locus_tag="CNE_BB2p01160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682775.1"
                     /db_xref="GI:339323882"
                     /db_xref="GeneID:10920204"
                     /translation="MPPSERIQPLSGYTVIELGSTVAGPFCGRLLADFGATVIKVEVA
                     EGDALRSMGSHKDGISLYALSIFRNKELISVDLRTEEGQALLRGLIDKADFVVENFRP
                     GTLERWGLSYETLSATNPGLIVVRISGYGQDGPYSQRPGYGVIGEAISGLRSITGDPD
                     RPPARVATSLSDYLTGLYGAFGALLALEARHRTGRGQVVDTALAECAFSFMEPHVMAY
                     DQLGVVAQRAGSRLPGSSPNNLYQSADGCHVHVAALADPIFRRLCVAMGQPDLADDLR
                     YATNLMRSRHSDEVDSAVQAWIGAHDYDEIHRRLGEHDIPHAKIYNIDDVFADPHFAA
                     RDSIQRRPHDRLGMVALPNVTPRLSDTPGEVRGLGRDTGADTAAVLARMLGLAPDALA
                     ALQRSGVIYDAGMAR"
     misc_feature    complement(115590..116789)
                     /locus_tag="CNE_BB2p01160"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(116810..117805)
                     /locus_tag="CNE_BB2p01170"
                     /db_xref="GeneID:10920205"
     CDS             complement(116810..117805)
                     /locus_tag="CNE_BB2p01170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682776.1"
                     /db_xref="GI:339323883"
                     /db_xref="GeneID:10920205"
                     /translation="MLSSIHRALSAAALALAGLAFTAAPLHAQDKYPNRPIKMYVGFS
                     AGSATDIVARVVAQYLSERLGQSIVVENKTGVGGSLAAEAVARSAPDGYTLLTVSSAI
                     AVNPAVYPKLSFNIEKDLTPIALVGRLPTVLLVRNGFPAKSLTEFLTYARSHPKKINY
                     GSSGVGGSTHLSTEYLATLTGTSFTHVPYRGNSQAVAALLGGEIDMVTDTILLAAPNI
                     QARRVRALAISSQARSPLAPDVPTFAEAGLKGYDGSLFFGLMGPKNLPPEIVSRINRE
                     LNDLLKNSAELRERLQSAGGLELVGGSPDQFRDTLHKEVTLWADVVKNAHVTVAQ"
     misc_feature    complement(116957..117712)
                     /locus_tag="CNE_BB2p01170"
                     /note="ABC-type amino acid transport/signal transduction
                     systems, periplasmic component/domain [Amino acid
                     transport and metabolism / Signal transduction
                     mechanisms]; Region: HisJ; COG0834"
                     /db_xref="CDD:223904"
     misc_feature    complement(116837..117652)
                     /locus_tag="CNE_BB2p01170"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(117873..118583)
                     /locus_tag="CNE_BB2p01180"
                     /db_xref="GeneID:10920206"
     CDS             complement(117873..118583)
                     /locus_tag="CNE_BB2p01180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682777.1"
                     /db_xref="GI:339323884"
                     /db_xref="GeneID:10920206"
                     /translation="MGVAERTIRKKAAPELKEAPRPTKSGAGDIADELRARIARHELL
                     PGTKLVEQDLAQEFGTTRPRIREALAALEQRGLVERIPNRGAIVTRISFEQILQIYCA
                     REALEGMSVRLAAQLAPPGEWDDLIELFGAPMEAALDNGDFDFYMEGYDRFRQRIFKN
                     AANPVIQGMLDSILERTQDVIRRAIVLPGRAKLGLAHHRATLAALRERNAEKAESIRR
                     ESLREAAEYLAKYRKYII"
     misc_feature    complement(117894..118529)
                     /locus_tag="CNE_BB2p01180"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(118317..118496)
                     /locus_tag="CNE_BB2p01180"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(118326..118337,118341..118346,
                     118374..118376,118383..118388,118392..118406,
                     118428..118433,118434..118436))
                     /locus_tag="CNE_BB2p01180"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(117918..118292)
                     /locus_tag="CNE_BB2p01180"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            118927..119211
                     /locus_tag="CNE_BB2p01190"
                     /db_xref="GeneID:10920207"
     CDS             118927..119211
                     /locus_tag="CNE_BB2p01190"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004682778.1"
                     /db_xref="GI:339323885"
                     /db_xref="GeneID:10920207"
                     /translation="MHDMQIRNLADNTQKSYLLQVSRFAQHFRRSPELLGPEGIRAWL
                     VHLRDKRKLAPSSLCPAVGALRFLYLDGKTHRSSRLRNFTIMKQRQQPSR"
     misc_feature    118933..119133
                     /locus_tag="CNE_BB2p01190"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_4; pfam13495"
                     /db_xref="CDD:257818"
     gene            119240..119575
                     /locus_tag="CNE_BB2p01200"
                     /db_xref="GeneID:10920208"
     CDS             119240..119575
                     /locus_tag="CNE_BB2p01200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682779.1"
                     /db_xref="GI:339323886"
                     /db_xref="GeneID:10920208"
                     /translation="MPRPLPDPIPPSRATFAPFGSWGTAFEQPAQRKGCPLTGRRGIA
                     VSPSVCCPRWRTARASISSTALRVMDGLGLTMLVVPKAHTPWLEQAAAHATKTGEDAV
                     REVHAWLEE"
     gene            120048..121004
                     /locus_tag="CNE_BB2p01210"
                     /db_xref="GeneID:10920209"
     CDS             120048..121004
                     /locus_tag="CNE_BB2p01210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682780.1"
                     /db_xref="GI:339323887"
                     /db_xref="GeneID:10920209"
                     /translation="MQSEQALRHVLVSKEPTCLVCATGRGRRSLVRDPFYRQCRSVWL
                     IAWLLSGVATVAMAAPGEQPAEASDANVRSSVWFPRGMRLQMEVDGDMPMSRRSTQMA
                     PLPTPSGCQTDLEIQSKTALAALMGPPVITDQQQRVLLRPAANGSPPGITGSGTVNAW
                     ARYTRLYGTTTIDALGLLDYQYRGLPLREGDAVSGATVEASVSFTIYARDSGIEVGKL
                     VAPHATVAVASRRVGKRQVIQTARGPSECVPIHYVRITSVGPMIIAGEQVLSEPSHME
                     VTDWYCPVASVVMRQDITEGHKMQRIDTTAADPLEQTSQASP"
     gene            complement(121147..121299)
                     /locus_tag="CNE_BB2p01220"
                     /db_xref="GeneID:10920210"
     CDS             complement(121147..121299)
                     /locus_tag="CNE_BB2p01220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682781.1"
                     /db_xref="GI:339323888"
                     /db_xref="GeneID:10920210"
                     /translation="MTDQQVDLRYVRDNFGHASIATTSGYLHSEEDARHEAIQERHRI
                     GWGAKT"
     misc_feature    complement(121216..>121299)
                     /locus_tag="CNE_BB2p01220"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     gene            complement(121533..122429)
                     /locus_tag="CNE_BB2p01230"
                     /db_xref="GeneID:10920211"
     CDS             complement(121533..122429)
                     /locus_tag="CNE_BB2p01230"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682782.1"
                     /db_xref="GI:339323889"
                     /db_xref="GeneID:10920211"
                     /translation="MQRARLPLLGLRAFEATARHLSVSKAASELCVTPGAVSQQVKLL
                     EDTVGVPLLRRKGRSVELTDAGQVLRPALTQAFQTIELTLNAIARRPRHDTLKLCLLP
                     TLAEKWLMPRLSRFHGAHPEVDIQIMTSFRTIQFEAEDVDMASFTGKDLPTGLEGVRL
                     FDDEFLPVCNPALLQHYKRLAAPRDLARTTLLYSVRRMDDWQRWLALAGAADLRPQRS
                     LSFENSSLAIQAAVDGLGVAVVQRAYVTDLLKAGILVAPFDLVARSENGYYLVWSAAR
                     AASPTFRSFLQWVLKEAGRNAA"
     misc_feature    complement(121536..122417)
                     /locus_tag="CNE_BB2p01230"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    complement(122229..122399)
                     /locus_tag="CNE_BB2p01230"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(121563..122147)
                     /locus_tag="CNE_BB2p01230"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(122043..122063,122067..122120,
                     122124..122147))
                     /locus_tag="CNE_BB2p01230"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(121698..121700,121758..121766,
                     122118..122120,122124..122129))
                     /locus_tag="CNE_BB2p01230"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            122539..122916
                     /locus_tag="CNE_BB2p01240"
                     /db_xref="GeneID:10920212"
     CDS             122539..122916
                     /locus_tag="CNE_BB2p01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682783.1"
                     /db_xref="GI:339323890"
                     /db_xref="GeneID:10920212"
                     /translation="MNITKYEGGHVGDFAEGLVLQGARILASGEVRFPPPEFLHGEGV
                     VEPLSLGITGRLYTYTTVHPGKAPAYSLAMVDFDYGLRAFGRLVWEGDTAPAIGAVVR
                     AVPFALSDGTSDYAFEPLKGDAA"
     misc_feature    122695..122850
                     /locus_tag="CNE_BB2p01240"
                     /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
                     /db_xref="CDD:250873"
     gene            122913..124052
                     /locus_tag="CNE_BB2p01250"
                     /db_xref="GeneID:10920213"
     CDS             122913..124052
                     /locus_tag="CNE_BB2p01250"
                     /EC_number="2.3.1.176"
                     /codon_start=1
                     /transl_table=11
                     /product="propanoyl-CoA C-acyltransferase"
                     /protein_id="YP_004682784.1"
                     /db_xref="GI:339323891"
                     /db_xref="GeneID:10920213"
                     /translation="MKEPLITGVGISDFGRFPHLTEEALAQAAILDALKDAEVPMRDV
                     QAFYCGNALGGHLPGQRALRELGTGGEAVYNIDNACSSGATALNLALQALRAGQYETV
                     VVFGMDHLSGLGGGALPMNQRDWNNRRGMIMPALYAMRAKRYIHDHGIPLETLADVAV
                     KNRRHGMLNPIAKFCREVTREEVLASRMVAEPLTLLQCCPAVVDGAAALVLSTRSSRG
                     AAKPVRVLASVVQSGLFEIHQVDMTEAEITRRAARLAYEQAGVGPEDLSVIELHDAFT
                     ISELLYYEALGLCGHGEAAQLLASGATALGGRIPVNPSGGLIAKGHPPGATGVAQIVE
                     LCEQLQGRAGKRQVQKADLGLSQVTGGGIWGVDHAACSIHILAAA"
     misc_feature    122913..124040
                     /locus_tag="CNE_BB2p01250"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06064"
                     /db_xref="CDD:235688"
     misc_feature    122934..123998
                     /locus_tag="CNE_BB2p01250"
                     /note="Thiolase domain associated with sterol carrier
                     protein (SCP)-x isoform and related proteins; SCP-2  has
                     multiple roles in intracellular lipid circulation and
                     metabolism. The N-terminal presequence in the SCP-x
                     isoform represents a peroxisomal...; Region:
                     SCP-x_thiolase; cd00829"
                     /db_xref="CDD:238425"
     misc_feature    order(123150..123152,123726..123728,123876..123878)
                     /locus_tag="CNE_BB2p01250"
                     /note="active site"
                     /db_xref="CDD:238425"
     gene            124063..124848
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /db_xref="GeneID:10920214"
     CDS             124063..124848
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
                     /protein_id="YP_004682785.1"
                     /db_xref="GI:339323892"
                     /db_xref="GeneID:10920214"
                     /translation="MTDNATISSSPVSLKGMTAIVTGGAKGIGLGIAHGLAAEGCRLA
                     LWDIDSAALAAAAAELRDAGADVTTRCVSITSEPDVQQAAAELLQRNGRIDVLVNNAG
                     IGGDNLVVKMELDFWQRVIETNLTSQFICCKAVLPTMMDQKFGRIVNISSRAWLGNRG
                     QASYSASKGGVVSLTRSIALEFARSGITANAIAPGIVETPLFGTLAPQVQEDLKRTVP
                     MQRIGQANDVANAVRFFSSPASGYVTGQVLYVCGGRSLSSASV"
     misc_feature    124099..124830
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    124114..124821
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(124129..124131,124135..124140,124144..124146,
                     124201..124209,124360..124368,124510..124518,
                     124552..124554,124564..124566,124642..124653)
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(124432..124434,124516..124518,124552..124554,
                     124564..124566)
                     /gene="fabG1"
                     /locus_tag="CNE_BB2p01260"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            124873..125097
                     /locus_tag="CNE_BB2p01270"
                     /db_xref="GeneID:10920215"
     CDS             124873..125097
                     /locus_tag="CNE_BB2p01270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682786.1"
                     /db_xref="GI:339323893"
                     /db_xref="GeneID:10920215"
                     /translation="MRRRDFTLAAAASLLAPAAPEAIDKTLRTPAVAESLLKSGFEPM
                     RLSPAEAQKALVEDTAQWTKVIRDNNIRGS"
     misc_feature    <124933..125085
                     /locus_tag="CNE_BB2p01270"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            125115..126284
                     /locus_tag="CNE_BB2p01280"
                     /db_xref="GeneID:10920216"
     CDS             125115..126284
                     /locus_tag="CNE_BB2p01280"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_004682787.1"
                     /db_xref="GI:339323894"
                     /db_xref="GeneID:10920216"
                     /translation="MLSDSLRGIRVVDFTQVAAGPVCTQTLADLGADVVKVEAPQGEL
                     CRALAPFVEGQSLGFLALNGNKRSVALDLKDPQQRAAALQLAAGADVVVESFRPGVMQ
                     RLGLGYEDVRQLNPGVIYCSISAYGQEGAWKHKPGVDGVLQAVSGLMSVTGLPDAPPC
                     KVQVPVVDMVTGYIGAIAVLGALARRTRDGGGQWIDVGMFACAVALQQMSFASYFADD
                     VAPTRIGSAAPYAAPNEALRCADGWVMLAAYHPSRWVALCEVLNCRELLSDPRFCELS
                     DRIAHRRELVQLLEARMTLRPRSEWLERFEAADIICAPINDYSEAVASPAFKDAQLAE
                     TVRHSVAGELILPRSPLRAVGESPRARRPAPLVGEHTSEVLRAAGIACEGDNPCL"
     misc_feature    125130..126242
                     /locus_tag="CNE_BB2p01280"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            126275..127051
                     /locus_tag="CNE_BB2p01290"
                     /db_xref="GeneID:10920217"
     CDS             126275..127051
                     /locus_tag="CNE_BB2p01290"
                     /EC_number="4.2.1.116"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxypropionyl-coenzyme A dehydratase"
                     /protein_id="YP_004682788.1"
                     /db_xref="GI:339323895"
                     /db_xref="GeneID:10920217"
                     /translation="MPVNLEVRDYIATVTLNRPEAMNAIDPESATQLHEAWNEISARK
                     DVRVGILTGAGERAFCTGADLKKTMPPAESFAELHFGPRAGVPPVSTLQTPKPMIAAI
                     NGFALGGGLELAMLCDIRIAASTAMFGFPEVCIGSIPAGGGTQRIVRAVGQSDAMLML
                     LSGERVDAQEALRIGLVSRVVASQDLQVLARSIASRIAANAPLAVVAAKKLAQVGGEL
                     PLAAGLELEQQTFGLLRNSEDRIEGRRAFAEKRKPRFQGR"
     misc_feature    126275..127048
                     /locus_tag="CNE_BB2p01290"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK06494"
                     /db_xref="CDD:180591"
     misc_feature    126281..126865
                     /locus_tag="CNE_BB2p01290"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(126338..126340,126344..126346,126443..126445,
                     126455..126469,126587..126589,126593..126601,
                     126665..126670,126677..126679)
                     /locus_tag="CNE_BB2p01290"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(126461..126463,126599..126601)
                     /locus_tag="CNE_BB2p01290"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(126542..126544,126563..126565,126626..126637,
                     126671..126682,126698..126700,126704..126712,
                     126716..126721,126734..126739,126743..126748,
                     126752..126757,126764..126766,126797..126799,
                     126806..126808,126851..126853,126860..126865)
                     /locus_tag="CNE_BB2p01290"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            127132..128103
                     /locus_tag="CNE_BB2p01300"
                     /db_xref="GeneID:10920218"
     CDS             127132..128103
                     /locus_tag="CNE_BB2p01300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682789.1"
                     /db_xref="GI:339323896"
                     /db_xref="GeneID:10920218"
                     /translation="MKRRSFLSALGATALASRSFASAPHSFAGKQLRFVIPYNAGGVA
                     DSSARIGLEGLQTALGSGVVVFDNRPGANGNIGTEYVTRQPADGTNFLVIPSSQLTTN
                     SFVPELRIKGIDVLERFVPVAPLVDIPLVLMVNADSGIQSFADFMRKAKASQLRFGNP
                     GVGTPHHLAALLLEKHTGVRMIHVAYKGGAPMVADLAGQHLDAVFSSWSTAHGLVTAG
                     KLKPLGSLQSGTAFGGLPSLNGELGGSSVPTWTGIFAVVGTPEGAMDAVNQATRTALL
                     SPQLEARIKDLGLVPMPMSRAKSAAKLKEEARFMRGFLGKIQLDFSK"
     misc_feature    127132..128064
                     /locus_tag="CNE_BB2p01300"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            128123..129283
                     /gene="mii"
                     /locus_tag="CNE_BB2p01310"
                     /db_xref="GeneID:10920219"
     CDS             128123..129283
                     /gene="mii"
                     /locus_tag="CNE_BB2p01310"
                     /EC_number="5.3.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methylitaconate isomerase Mii"
                     /protein_id="YP_004682790.1"
                     /db_xref="GI:339323897"
                     /db_xref="GeneID:10920219"
                     /translation="MSNANSRRMSEQVRIPVTIMRGGTSKALFLAQRDIPADPGRRAR
                     LLLALFGSPDPRQIDGLGGADVLTSKCAIIGPPSRPDADIDYTFAQIGIDAPTVSYEM
                     VCGNISAATGVYALQEKLVAVQEPVTEVRVHNTNTGKILRLLVQCADGEPRVEGDCEI
                     DGVPGSGSEVALDYSGTSGGATGKLLPTGHPRDAVHVPLLGRDIEVSIVDVGTVCVLI
                     RAADLGETGTELPGEFNPRTFEVAEAVRQWAAERCGLQGSYTPYQIVVGPPQSYRAFS
                     GDRVVESGEIDLVARMVGANGLVHKAFPGGGSVCLSIAAQIEGTVASEVRGGHQGPAR
                     IRIGHPSGVFGVYGHVARGADGEWSVQEVHFVRTARRLMDGFAYVRTSALRG"
     misc_feature    128156..129259
                     /gene="mii"
                     /locus_tag="CNE_BB2p01310"
                     /note="PrpF protein; Region: PrpF; cl19418"
                     /db_xref="CDD:267771"
     gene            129331..130515
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /db_xref="GeneID:10920220"
     CDS             129331..130515
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase ThlA"
                     /protein_id="YP_004682791.1"
                     /db_xref="GI:339323898"
                     /db_xref="GeneID:10920220"
                     /translation="MKQRDIFVVGAARTAIGTFGGSLKDVPNTQLATTAVKAAIERSG
                     VAPANVGHVVMGNVIPTDTRDAYLSRVAAVDAGCLIETPAFNVNRLCGSGLQAIVSAA
                     QAIALGDCDIAIGAGSESMSRAPYFDTAARHGARMGDAQLVDYMIGILHDPWEKMHMG
                     ITAENVAARYGISREQQDALAVQSQQRAAAALAAGRFKEQIVPVEVKTRKGVVLFDTD
                     EHVRADTTLDVLSKMKPAFKKDGLVTAGNASGINDGAGAVVLAEGERVKALGLKPLAR
                     LVGYAHAGVEPAYMGIGPVPATRKVLERTGLKVSDLDVIESNEAFAAQACAVMKELGF
                     DPAKVNPNGSGISLGHPVGATGAIITVKALAELQRVQGRYALVTMCIGGGQGIAAIFE
                     RV"
     misc_feature    129337..130512
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /note="beta-ketothiolase; Provisional; Region: PRK09051"
                     /db_xref="CDD:181625"
     misc_feature    129349..130509
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(129403..129405,129484..129486,129529..129531,
                     129538..129540,129550..129552,129583..129594,
                     129616..129618,129637..129642,129649..129651,
                     129694..129696,130168..130170,130174..130176,
                     130180..130182,130240..130242,130477..130482)
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(129601..129603,130378..130380,130468..130470)
                     /gene="thlA"
                     /locus_tag="CNE_BB2p01320"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(130540..130683)
                     /locus_tag="CNE_BB2p01330"
                     /db_xref="GeneID:10920221"
     CDS             complement(130540..130683)
                     /locus_tag="CNE_BB2p01330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682792.1"
                     /db_xref="GI:339323899"
                     /db_xref="GeneID:10920221"
                     /translation="MNEVSLPTLLNKAKSVILTEEGLRESERLFMRHFVAAGGQGNNE
                     TNL"
     gene            complement(130804..131907)
                     /locus_tag="CNE_BB2p01340"
                     /db_xref="GeneID:10920222"
     CDS             complement(130804..131907)
                     /locus_tag="CNE_BB2p01340"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004682793.1"
                     /db_xref="GI:339323900"
                     /db_xref="GeneID:10920222"
                     /translation="MQVDTTDPRWRRSELILSEAEREQLTALTMRRKTAQALALRARI
                     VLACADGIDNKTVAAKQRVTQQTVSKWRAGYVAHRLDGLLDAPRPGAPRTIDDARVDA
                     VIAKTLESVPSGATHWSTRTMAREMDLSQTAVSRIWRAFGLQPHRQETFKLSSDPLFV
                     DKVRDIVGLYLNPPLKAMVLCVDEKSQIQALDRTQPILPLAPGIPEHRTHDYMRHGTT
                     TLFAALDIATGEVIGELHRRHRSSEFLQFLRTIDANVPANLEVHLVMDNYGTHKTPSI
                     KNRFARHPRFHVHFAPTSASWVNQVERWFATLTEKYIRRGTHRSTRQLEEAIRHYLDV
                     YNANPRPIVWCKPADEILASLERFFMRIRRAAL"
     misc_feature    complement(131656..131796)
                     /locus_tag="CNE_BB2p01340"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     misc_feature    complement(131482..131787)
                     /locus_tag="CNE_BB2p01340"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    complement(131494..131709)
                     /locus_tag="CNE_BB2p01340"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(130933..131304)
                     /locus_tag="CNE_BB2p01340"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     cl19249"
                     /db_xref="CDD:267602"
     gene            131992..133182
                     /locus_tag="CNE_BB2p01350"
                     /db_xref="GeneID:10920223"
     CDS             131992..133182
                     /locus_tag="CNE_BB2p01350"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682794.1"
                     /db_xref="GI:339323901"
                     /db_xref="GeneID:10920223"
                     /translation="MKRVMKRSMVALAVLAAFSGTAMAQAGLTLYGVADINVEYVNHV
                     GKVPSAANQFNPGPANDAWRINSGGVAGSRWGLRGEEDLGNGLKSVFVLESGFNLDNG
                     TLAMSGRLFDRQAFVGVQSASYGRLTFGRQYTSIMYALANFTPMAFASQYDPIVAQIG
                     PNFREDNTVAYSGTFGPVTAMAHWSFGTGVALPQPAANGVAVGGNGEVPGQFRRDAGY
                     GVGLNYFAGKLGLAAAYDQFNPSIGTAGGTISSGAYKKAAVAASYAIGPVTVMGGYRW
                     GQNKDANGILLQRDDLYSLGANYQVTSALDLSVAYNYQDLKNFLGSTRLANPWQVALR
                     ANYALSKRTSLYLTTAFAKNAGLMLDSGPTAYVTSLFLGNSYALAGGQSTMLGAALGI
                     RHTF"
     misc_feature    132073..133179
                     /locus_tag="CNE_BB2p01350"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(132073..132075,132091..132093,132097..132105,
                     132226..132240,132256..132258,132262..132270,
                     132274..132276,132280..132291,132325..132330,
                     132334..132348,132376..132384,132481..132483,
                     132487..132492,133006..133011,133018..133020,
                     133165..133167,133171..133173,133177..133179)
                     /locus_tag="CNE_BB2p01350"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(132088..132090,132211..132213,132328..132330,
                     132421..132423,132481..132483)
                     /locus_tag="CNE_BB2p01350"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(133322..133567)
                     /locus_tag="CNE_BB2p01360"
                     /db_xref="GeneID:10920224"
     CDS             complement(133322..133567)
                     /locus_tag="CNE_BB2p01360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682795.1"
                     /db_xref="GI:339323902"
                     /db_xref="GeneID:10920224"
                     /translation="MLLASANYTLSKRTDAFLNVGNLRNKNNSNLGLNGFGSTVTPRD
                     NQTGVHGQHSPQVLTDPRLPYCSGETAGPTQQQEVKK"
     misc_feature    complement(133421..>133567)
                     /locus_tag="CNE_BB2p01360"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            133601..133840
                     /locus_tag="CNE_BB2p01370"
                     /db_xref="GeneID:10920225"
     CDS             133601..133840
                     /locus_tag="CNE_BB2p01370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682796.1"
                     /db_xref="GI:339323903"
                     /db_xref="GeneID:10920225"
                     /translation="MVARAGQRQCRRGLEAVAKPEEIVAALWRARCDADIAFEPAIAG
                     QQRRAAETDVGGRRDAPVGLAGVLPGDATCALCWS"
     gene            complement(133835..134179)
                     /locus_tag="CNE_BB2p01380"
                     /db_xref="GeneID:10920226"
     CDS             complement(133835..134179)
                     /locus_tag="CNE_BB2p01380"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682797.1"
                     /db_xref="GI:339323904"
                     /db_xref="GeneID:10920226"
                     /translation="MGLENQWDRVTLGWQQNALFDLLINYEPMVLAARYSAMPIDANF
                     AGRYDNTAKHTGKFGPVTATALFRLPAASPSPARAAPPRMAPRYPKTSRAIERSARAW
                     STPTAIRRHREL"
     misc_feature    complement(<133979..>134176)
                     /locus_tag="CNE_BB2p01380"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            complement(134110..134334)
                     /locus_tag="CNE_BB2p01390"
                     /db_xref="GeneID:10920227"
     CDS             complement(134110..134334)
                     /locus_tag="CNE_BB2p01390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682798.1"
                     /db_xref="GI:339323905"
                     /db_xref="GeneID:10920227"
                     /translation="MTSGNVSGLRWGLPGVEDLGSGMKAVYTLESGFDLDSGASGQGG
                     RQFGRQALWAWKTSGTASRLAGSRTRCLTC"
     misc_feature    complement(<134182..134334)
                     /locus_tag="CNE_BB2p01390"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            complement(134404..134664)
                     /locus_tag="CNE_BB2p01400"
                     /db_xref="GeneID:10920228"
     CDS             complement(134404..134664)
                     /locus_tag="CNE_BB2p01400"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase orfA protein"
                     /protein_id="YP_004682799.1"
                     /db_xref="GI:339323906"
                     /db_xref="GeneID:10920228"
                     /translation="MKKSRFTEEHMFTILREADRTTVAEAARKHKVSEATIYAWRKHF
                     GQMEATDVKRLKALELENSRLKKLLAERALDIEILKETNGKK"
     misc_feature    complement(134452..134661)
                     /locus_tag="CNE_BB2p01400"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            complement(134967..135449)
                     /gene="tnpA"
                     /locus_tag="CNE_BB2p01410"
                     /db_xref="GeneID:10920229"
     CDS             complement(134967..135449)
                     /gene="tnpA"
                     /locus_tag="CNE_BB2p01410"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase TnpA"
                     /protein_id="YP_004682800.1"
                     /db_xref="GI:339323907"
                     /db_xref="GeneID:10920229"
                     /translation="MDAPTRQLHLSARVEVSANTRFGGNVHHAGYDDRPRPDQECVSD
                     PRCQRARQAVLRKQLRRAQVAAFFANLPACLVGMEACSSAHHWVRKLQVLGHTVRLMA
                     PQFVKPYVKSNKNDVADAEAICEAVTRPSMRFVPVKNIEQQARLSLHRVRQGAHGWLL
                     "
     misc_feature    complement(<134994..135275)
                     /gene="tnpA"
                     /locus_tag="CNE_BB2p01410"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(134991..>135266)
                     /gene="tnpA"
                     /locus_tag="CNE_BB2p01410"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     gene            135681..137186
                     /gene="aldA"
                     /locus_tag="CNE_BB2p01420"
                     /db_xref="GeneID:10920230"
     CDS             135681..137186
                     /gene="aldA"
                     /locus_tag="CNE_BB2p01420"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase AldA"
                     /protein_id="YP_004682801.1"
                     /db_xref="GI:339323908"
                     /db_xref="GeneID:10920230"
                     /translation="MSRSDQTENHRFPEVNPHTRYDLFIAGEAVPSSGSDSFTCFDPF
                     EETEWGIVPVGTSDDVDRAVRAARAAFPAWAATPVAGRAEILRIFGNLIRENVEELAR
                     IQVHENGKTITEMRGATSTLAPLADYVAQLAIADHGTTVQPTLPGHDAWTRPEPIGVI
                     AAIAPWNNPLVLLAWKLFPAIAAGNTVVIKPSEVTPVSTLRLAQLARQAGVPAGVINV
                     VTGAAETGAALVSHPDIDKVAFTGSTATGISIAKVAAARVLPTTLELGGKGPQIVFPE
                     ADLARAVPSLLAGLIAGTGQACNAGSRLLVHESLYDEVLERLKLALANVKIGDPLDPK
                     VQVGPLASRAQFAKVTGYFDIAAREQTTKLLYGARVGTEIPEVTRGLFVEPTIYATPD
                     RTSRVRCEEIFGPVGAVISFRSENEAIEVANETEFGLVSGLWTQDVDRVARVSKRLRS
                     GVVWVNTWRAFGINVPFGGVKMSGLGRELGPDLLHEYTQVKSIWLGNGLET"
     misc_feature    135801..137165
                     /gene="aldA"
                     /locus_tag="CNE_BB2p01420"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     misc_feature    order(136167..136181,136203..136205,136248..136250,
                     136254..136259,136398..136409,136416..136418,
                     136425..136430,136470..136478,136572..136574,
                     136881..136883,136887..136889,136965..136967,
                     137079..137081)
                     /gene="aldA"
                     /locus_tag="CNE_BB2p01420"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143395"
     misc_feature    order(136179..136181,136470..136472,136563..136565,
                     136572..136574)
                     /gene="aldA"
                     /locus_tag="CNE_BB2p01420"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143395"
     gene            137322..138761
                     /locus_tag="CNE_BB2p01430"
                     /db_xref="GeneID:10920231"
     CDS             137322..138761
                     /locus_tag="CNE_BB2p01430"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     flavoprotein subunit"
                     /protein_id="YP_004682802.1"
                     /db_xref="GI:339323909"
                     /db_xref="GeneID:10920231"
                     /translation="MNTENNYDIIVIGCGAAGLATAIAYAEAADRSDKIARIALLERA
                     PEEERGGATQWTAALLRIAEDGRFDTNWRQLVDVLGGGLPDQEYCATLEKEVPATLEF
                     LTSRGVPLERLPWPAPINFAHGEVKLQTVMHPVNGGAGIVSGLFNELTKHKGVEVHYR
                     TEAVRLSISDDGAVNGVVVRKEDGRLRTLHGNNVMIASGGFEGNKEMLTRYLGSNACD
                     LVPIVPGIKNNRGEGITMAIEVGADTSGQFDMFHAEAIDPRSSQPDAVVWATPYGIVV
                     NSDAKRFFDEGSHTLDRTFELLGYEIWKNQNQRAFWITDQQIANLPGILAINFTDVDP
                     IAADSIEGLAENLGLDPSALESTIAEFNSACGSQTFDHTRLDGKSTTGITPPKSNWAN
                     PIEQGPFLAVPLTGGITFTFGGIRTDTVGRVLTPAGTPIAGLYAAGEVTGLYYHEYPA
                     ATSVLRSVTFGRLAGTHAATCSPSRDAHS"
     misc_feature    137340..138728
                     /locus_tag="CNE_BB2p01430"
                     /note="tricarballylate dehydrogenase; Validated; Region:
                     PRK08274"
                     /db_xref="CDD:236214"
     misc_feature    137352..138740
                     /locus_tag="CNE_BB2p01430"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            139096..139218
                     /locus_tag="CNE_BB2p01440"
                     /db_xref="GeneID:10920232"
     CDS             139096..139218
                     /locus_tag="CNE_BB2p01440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682803.1"
                     /db_xref="GI:339323910"
                     /db_xref="GeneID:10920232"
                     /translation="MLQNILQQAECIEQQQPDQGQKTTSFTPGKKSLRRASQAV"
     gene            139486..140247
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /db_xref="GeneID:10920233"
     CDS             139486..140247
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
                     /protein_id="YP_004682804.1"
                     /db_xref="GI:339323911"
                     /db_xref="GeneID:10920233"
                     /translation="MQIKYVAAVVTGGASGLGGAAAKRLAEAGAKVAIFDLNDELGRA
                     HARAIGGQFFKVDVTDEVAVASALAQAEELHGPARILVNSAGVGAPAKVICRDGEPLP
                     LTDFSKIISINLLGSFNVLSKFAARLHKARALGEERGVIVNVASVAAFDGQIGQPAYA
                     ASKAGIVGMTLPIARELARFGIRVMTVAPGIFLTPLLASLPQEAQESLGQQVPFPSRL
                     GQPDEFAQLVEAIVTNAMLNGEVIRLDGAIRMAPR"
     misc_feature    139486..140235
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK08217"
                     /db_xref="CDD:181297"
     misc_feature    139507..140241
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(139519..139521,139525..139530,139534..139536,
                     139591..139599,139735..139743,139915..139923,
                     139960..139962,139972..139974,140050..140061)
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(139822..139824,139921..139923,139960..139962,
                     139972..139974)
                     /gene="fabG2"
                     /locus_tag="CNE_BB2p01450"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            140428..141057
                     /locus_tag="CNE_BB2p01460"
                     /db_xref="GeneID:10920234"
     CDS             140428..141057
                     /locus_tag="CNE_BB2p01460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682805.1"
                     /db_xref="GI:339323912"
                     /db_xref="GeneID:10920234"
                     /translation="MNRTMRHCTGSIQLQSDLLTMASLATTSAGRAPVGRSSIEDTDA
                     GRDSCMDALIEWLPLDIPAEDSCAIVRGDFRCDNMIFHPTNSEVVAVLDWELSTLGDP
                     LADFAYQAMMYRMPPSIVAGLAGADLKALNIPSEEKYVRDYCTRTGRTDIESWPFYIA
                     FNFFRMVAIFHGIKGRVLRGTAVSVHARDRAASFTVLAELAYRSMKECQ"
     misc_feature    <140575..140775
                     /locus_tag="CNE_BB2p01460"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(140644..140646,140761..140763)
                     /locus_tag="CNE_BB2p01460"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     gene            complement(141588..141731)
                     /locus_tag="CNE_BB2p01470"
                     /db_xref="GeneID:10920235"
     CDS             complement(141588..141731)
                     /locus_tag="CNE_BB2p01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682806.1"
                     /db_xref="GI:339323913"
                     /db_xref="GeneID:10920235"
                     /translation="MRFQAVLIGLEKKTPRAAQRTCGRSGKGLGQLYSFCEQLIVIDG
                     TCN"
     gene            141844..143004
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /db_xref="GeneID:10920236"
     CDS             141844..143004
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="YP_004682807.1"
                     /db_xref="GI:339323914"
                     /db_xref="GeneID:10920236"
                     /translation="MAEAYIVEAVRTAGGRRNGKLAGWHPADMAAEVLNAMVERSGID
                     PAAVDDVILGCVTQAGEQAFAFARNAVLASRLPVSVPAVTIDRQCGSSQQAVQFAAQA
                     VMSGTQDVVIAAGAESMSRVPMFSNISLHEKAGIGVGPFSERIKARFGVRNFSQFAGA
                     EAIARKYGFNRAVLDAFALVSHRRAAQATDSGAFKAEIVPLATETGCHMEDEGIRRDA
                     TLESIGAVKLLSEDGVISAANASQICDGASAVLVVSEQALKQYGLTPIGRIVNMTVTA
                     GDPVIMLEEPIPATRRALSKAGLKIDDIDLYEVNEAFAPVPLAWLQALEADPARLNVN
                     GGAIALGHPLGASGSKLMATLIHALRARGKRYGLQTMCEGGGVANVTILEAL"
     misc_feature    141844..143001
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06504"
                     /db_xref="CDD:180595"
     misc_feature    141856..142998
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(141910..141912,141991..141993,142036..142038,
                     142045..142047,142057..142059,142090..142101,
                     142123..142125,142144..142149,142156..142158,
                     142201..142203,142657..142659,142663..142665,
                     142669..142671,142729..142731,142966..142971)
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(142108..142110,142867..142869,142957..142959)
                     /gene="fadA"
                     /locus_tag="CNE_BB2p01480"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(143159..143455)
                     /locus_tag="CNE_BB2p01490"
                     /db_xref="GeneID:10920237"
     CDS             complement(143159..143455)
                     /locus_tag="CNE_BB2p01490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682808.1"
                     /db_xref="GI:339323915"
                     /db_xref="GeneID:10920237"
                     /translation="MFIVELTYTQPLNAIEARLSEHRRFLDAQYARGLFLVSGPKNPR
                     DGGVILVSGLIARNELDKLLREDPFPIRFGGVPRDGVCFAQASSSTGETAVVDR"
     misc_feature    complement(<143249..143455)
                     /locus_tag="CNE_BB2p01490"
                     /note="YCII-related domain; Region: YCII; cl00999"
                     /db_xref="CDD:260739"
     gene            complement(143518..144267)
                     /locus_tag="CNE_BB2p01500"
                     /db_xref="GeneID:10920238"
     CDS             complement(143518..144267)
                     /locus_tag="CNE_BB2p01500"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004682809.1"
                     /db_xref="GI:339323916"
                     /db_xref="GeneID:10920238"
                     /translation="MARRNLEPKQEPAGEDEVGVAAVNRALSLLDTFSKEQLSFTLAQ
                     MAERTGLYKSTILRLAESLEAYGYLRRGEGSVFTLGPTPFRLATLYQRNLHPAELVMP
                     VLRNLVELTEESATFYVISGDKRLCAYRANSPLAITDNVQAGEMRPLERGAGGKVLLA
                     FVGRQGPEFDTIREEMFSLSRGELYEGIVSLASPVFGSADKLEGAISISGPATRLGKE
                     AIARIKPHLFRASQHLTELFGGDGSRYEVLL"
     misc_feature    complement(143947..144210)
                     /locus_tag="CNE_BB2p01500"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(143548..144204)
                     /locus_tag="CNE_BB2p01500"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(143614..143838)
                     /locus_tag="CNE_BB2p01500"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            144397..145875
                     /gene="dhaS"
                     /locus_tag="CNE_BB2p01510"
                     /db_xref="GeneID:10920239"
     CDS             144397..145875
                     /gene="dhaS"
                     /locus_tag="CNE_BB2p01510"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase DhaS"
                     /protein_id="YP_004682810.1"
                     /db_xref="GI:339323917"
                     /db_xref="GeneID:10920239"
                     /translation="MKRYQMFINNEWVDSTSGQWFESIEPYSGKAWAEVPKGNAQDVE
                     KAVQAAKAAFDDPAWRDLTATQRGALLRRLAELVSTNVTRLADTEQRDNGKLIAEVSG
                     QVQNVAQWFHYYAGLADKVQGAVVPINKPGVFNYIKHEPLGVVAAITPWNSPLALTVW
                     KMAPALAAGNTMVIKPSEYTSASLLELAALTKEAGFPPGVVNVITGFGADVGEPLVRH
                     QDIAKIAFTGGDIAGQRINEIAASDFKKVTLELGGKSANIVFDDADLDQAVKGAVAGI
                     FGAAGQTCMAGSRLLVQRNVHDQFVEMLIKVASDAVIGDPSKHETQVGPIATEAQFRK
                     ILSYIEIAKSGGAHCVLGGHALTGDAYGQGQFIAPTIFTGVTNDMRIAQEEVFGPVLA
                     VIPFDTEDDALRIANDTMFGLAAGVWTSDLHRAFYMSDRLKAGTVWVNNYRATSFTTP
                     FGGYKRSGIGREGGVDAIKEYLQTKSVWITTKPAKANAFVLG"
     misc_feature    144463..145833
                     /gene="dhaS"
                     /locus_tag="CNE_BB2p01510"
                     /note="Uncharacterized Candidatus pelagibacter aldehyde
                     dehydrogenase, DhaS-like; Region: ALDH_DhaS; cd07114"
                     /db_xref="CDD:143432"
     misc_feature    order(144838..144852,144874..144876,144919..144921,
                     144925..144930,145072..145083,145090..145092,
                     145099..145104,145144..145152,145246..145248,
                     145549..145551,145555..145557,145633..145635,
                     145747..145749)
                     /gene="dhaS"
                     /locus_tag="CNE_BB2p01510"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143432"
     misc_feature    order(144850..144852,145144..145146,145237..145239,
                     145246..145248)
                     /gene="dhaS"
                     /locus_tag="CNE_BB2p01510"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143432"
     gene            145911..147374
                     /gene="ifcA"
                     /locus_tag="CNE_BB2p01520"
                     /db_xref="GeneID:10920240"
     CDS             145911..147374
                     /gene="ifcA"
                     /locus_tag="CNE_BB2p01520"
                     /EC_number="1.3.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_004682811.1"
                     /db_xref="GI:339323918"
                     /db_xref="GeneID:10920240"
                     /translation="MNDKSDADVLIVGCGVAGLSAAVTALEAGLKVINLERSDESQFG
                     GNSRWTEAYMRMKNDTEISDDFEEHFANNAGWNIDPNVLDALTDSYANWPSFVKSHSL
                     PDPEVISAFANSVPPTISWLKGLGLKFEPQPIYLLTQNTTRIAAKGGGLAIIEALRAK
                     ALALGGEIRYRTTATDLVRNDNGAACGLVITTPDGVRSQLLAKHVVLASGGFQGNPEM
                     MTKYVGPRAKHIRPVAIGGYYNRGEGIQMALNAGAAPAGEFGSYHAEPVDPRSQQAEA
                     VVFIYPYGMLVNKLAKRFVNEAPGTVDAHYDNIARTIADQPDGISYVIFDSKVDDIPR
                     WKTSIRSDQPPVSAQTLEALAAKLGLPDDALAQTVATFNAACPQRSDAFEPFTVDHRG
                     TKGLEINKSHWCRPIDQSPFYAYPIISTNCFTFGGLKVNESAQVLDQDGRVMAGLYAA
                     GETMGIYHQVYTGSTSVLRGLVFGRRAAQHIALSSHR"
     misc_feature    145917..147356
                     /gene="ifcA"
                     /locus_tag="CNE_BB2p01520"
                     /note="tricarballylate dehydrogenase; Validated; Region:
                     PRK08274"
                     /db_xref="CDD:236214"
     misc_feature    145941..147356
                     /gene="ifcA"
                     /locus_tag="CNE_BB2p01520"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            147421..148617
                     /locus_tag="CNE_BB2p01530"
                     /db_xref="GeneID:10920241"
     CDS             147421..148617
                     /locus_tag="CNE_BB2p01530"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transport system
                     permease protein"
                     /protein_id="YP_004682812.1"
                     /db_xref="GI:339323919"
                     /db_xref="GeneID:10920241"
                     /translation="MDRRAFLSLAGATAGSIALPSLAIAQPKPLVYYSINAFSGNFAA
                     SGKYSDLGVRAAITGYGTRLGRAIEYKRIDTEGNPAIAVRKVQQAISQDGARHFGGAA
                     LSSEALVIMKEVNKANGVYITYVGADEVTGKDCNRSAFRWSTPTFGAVNTVLRPLFQQ
                     NPKWKKAYTITGQYVFGEALLRNSKAVMQDAKVELVGNSYHSLAEKEFSGYLGNAMAS
                     GADVLVILNFGANTLDLLRQAASFGIKKRMAVAVVWFSGLDTFQALGADVTEDIYFGL
                     QYWHGLDTPGNKTFLDVYRREFKENPRFYSAADYQIATLMFDAIRKGGSEDPAAIIKA
                     LEGYTYAGLTGEEQVRPFDHQVIKNYFLARGKKKSAMKDADDFVDILSSSKTASPKSA
                     SDCKMA"
     misc_feature    147523..148509
                     /locus_tag="CNE_BB2p01530"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            148640..149497
                     /locus_tag="CNE_BB2p01540"
                     /db_xref="GeneID:10920242"
     CDS             148640..149497
                     /locus_tag="CNE_BB2p01540"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004682813.1"
                     /db_xref="GI:339323920"
                     /db_xref="GeneID:10920242"
                     /translation="MNIYVFQALNGLGLGMIYFLLSVGLSIIFGLLGFVNFAHGALFL
                     VGAYAAFFTSQATGSFALGLIASFVCVASVGLVAEHWLLRRTYKMSHEAQILVTVGLT
                     FVLTETVVYFFGPESQRVAPPEALSSVLMIGPYPIPSFRVFIVIVCAVIGAALWWLFE
                     RTMFGARVRAGNERPQMLKLLGTKVSRVYAIAFGLGTGLAGLAGGLAVPLRGADPSMG
                     LEAIVIAFVVVVIGGMGSFSGPLVGGLIIGVTQSMMSAIWPEGARLAIFLLMVVVLLL
                     MPKGLFGRA"
     misc_feature    148670..149437
                     /locus_tag="CNE_BB2p01540"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    149165..149221
                     /locus_tag="CNE_BB2p01540"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            149490..150476
                     /locus_tag="CNE_BB2p01550"
                     /db_xref="GeneID:10920243"
     CDS             149490..150476
                     /locus_tag="CNE_BB2p01550"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004682814.1"
                     /db_xref="GI:339323921"
                     /db_xref="GeneID:10920243"
                     /translation="MLNTISKSAGAFYLTLLALPLALPLMSGSATTAVVVMIFGIAAA
                     ACNLMLGYAGLLSFAQGTFFGVGSYAAGLLLRSHPDLGLGVLVLCAVAGAVAALIIGM
                     LSIRRKGIYFVMITLAMAQMAFFAALSFPDVTGGENGLLDIPRLSAGLDGILSESQSQ
                     YLVVSVMFFLAFAFLRRVVRSPFGRVLDAVRENETRAQMAGYDVRRLKLLAFVISGSV
                     TALAGALYAIQLRSAPLSNIDLMMSETILIMAILGGKRSLLGAVFGALLMTLMAEQLS
                     QLWPRWQMIVGFVLILTVLFAPSGIGGVSSQWRMSREKRKASGTHLSSKETA"
     misc_feature    149595..150398
                     /locus_tag="CNE_BB2p01550"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    150072..150128
                     /locus_tag="CNE_BB2p01550"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            150476..151228
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /db_xref="GeneID:10920244"
     CDS             150476..151228
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein LivG"
                     /protein_id="YP_004682815.1"
                     /db_xref="GI:339323922"
                     /db_xref="GeneID:10920244"
                     /translation="MTATILTTRGLGLDYGSFTAVGKVALDLKANTLHSLIGPNGAGK
                     TSLFNIVSGRLPATRGTIEFEGKNITRSPAHGRVKLGMARSFQVTSLFPESTVLDNLR
                     LAAMGYEAGRSLHFWSTWNKEASKHEIADKVLVELDLARYASMPVGALSHGTQRLVEI
                     GMCLVARPMLLLLDEPMAGLGLADVPRVSELLLQLKASYTILLVEHNMHVVMGISDRI
                     TVMFQGNVIAEGSPDEIRQDANVKRVYLGSSV"
     misc_feature    150479..151219
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    150491..151189
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    150587..150610
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(150596..150601,150605..150613,150734..150736,
                     150995..151000,151091..151093)
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    150725..150736
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    150923..150952
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    150983..151000
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    151007..151018
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    151079..151099
                     /gene="livG"
                     /locus_tag="CNE_BB2p01560"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            151225..151944
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /db_xref="GeneID:10920245"
     CDS             151225..151944
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein LivF"
                     /protein_id="YP_004682816.1"
                     /db_xref="GI:339323923"
                     /db_xref="GeneID:10920245"
                     /translation="MTQPLLALHGVQASYGKSIALEDVSLQVGRGEVVSLMGRNGMGK
                     TSTLNTIVGVLEKTAGSVHLDGVDISDLESDEISRLGVSLVPADRGIFTLLSVEENLK
                     IARRKHSAWTLESAYASFPRLKERRKNLGGALSGGEQQMLSIARALMQGPKVLLLDEP
                     TEGLAPVIVDELVELIASVGRSGVSIVLVEQTFAVCRALASRHYVLEEGHVVFEGPTA
                     ALDDDPTTLERFLGLDVGVHA"
     misc_feature    151231..151923
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    151240..151893
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    151336..151359
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(151345..151350,151354..151362,151483..151485,
                     151696..151701,151795..151797)
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    151474..151485
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    151624..151653
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    151684..151701
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    151708..151719
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    151783..151803
                     /gene="livF"
                     /locus_tag="CNE_BB2p01570"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            152081..154720
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /db_xref="GeneID:10920246"
     CDS             152081..154720
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /EC_number="4.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase AcnA"
                     /protein_id="YP_004682817.1"
                     /db_xref="GI:339323924"
                     /db_xref="GeneID:10920246"
                     /translation="MRLSRNSFRCRTALPGMPGYFCMSIVEAEKNGAGALTRLPYSLR
                     VLAEHLLRHEDGDVVRKEDIEALGEWTLTGSSTKSVGFMPGRVLMQDAAGLPVLADLA
                     ALDEELRAKRGTGITLKLPADLIVDHAVEVDASGTRAALSANLQLEFERHGKRYEFLK
                     WAAQRFTNLRIAPPGIGICHQLNLEVLADLVSTNTTDDPELLGFDSVLGTDSHTTMVN
                     GLSIFGWGIGGIDATAALLGEPTVIRIPDVIGVRLYGSLRPGVQASDLALTLTSTLRE
                     HDLVQRVVEFCGPALGTLSVPDRATVANMAPEYGATMAYFPPDAQTLAYLRWTGRPQE
                     HLARVENFLRAQGTYRVASDPEPCFTAVIDFDLGSVEPTVAGPSLPQQRRTLSEVPAT
                     IEHTGMGEGLTHGAVVLAAITSCTNTSNPEALVTAGLLARNAVARGMHVPRWVKTSFA
                     PGSRVASELLSAAGLQQHLDTLGFHVVGHGCATCMGNSGPLHPGVEAYVKNEKLSVAA
                     VLSGNRNFEGRIHPAVRSAYLASPALVVAYALAGNLAVDLSSAPLGSAPDGSPIQLAD
                     IWPDPQEVRAALEGVRLESHFAANRRAWQLGTAEWDALPSAVGDEYPWEARAGYIRRP
                     PFLETTVRRPLLTSDIVGARPLLILGDAVTTDHISPVSRIPADSSAGRWLQEHDVPAT
                     KHGTFSARRLNHEVMLRGGFANPRIRNRLLSEVEGGFTRILPHGDVVPIHEATGVYAD
                     REVPIIVIAGERYGGGSARDWAAKVTRLLGVRAVIARSFERIHRANLVAFGVLPLETQ
                     EDLGSLLTGGETLDMVGLPEALRLGGELELTIRAPDGTDVKRLKLVCRIDTTVEAEWL
                     KSGGMLGRVLDKLLIETTTPQPS"
     misc_feature    152090..154690
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="aconitate hydratase; Validated; Region: PRK09277"
                     /db_xref="CDD:236445"
     misc_feature    152336..153709
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="Aconitase catalytic domain; Aconitase catalyzes the
                     reversible isomerization of citrate and isocitrate as part
                     of the TCA cycle; Region: Aconitase; cl00285"
                     /db_xref="CDD:260326"
     misc_feature    order(152348..152350,152357..152359,152711..152716,
                     153533..153535,153620..153622,153635..153637)
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153129"
     misc_feature    order(152717..152719,153323..153325,153521..153523,
                     153530..153535,153617..153619)
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153129"
     misc_feature    154022..154525
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="Aconitase swivel domain. Aconitase (aconitate
                     hydratase) catalyzes the reversible isomerization of
                     citrate and isocitrate as part of the TCA cycle. This is
                     the aconitase swivel domain, which undergoes swivelling
                     conformational change in the enzyme...; Region:
                     Aconitase_swivel; cl00215"
                     /db_xref="CDD:260268"
     misc_feature    154349..154357
                     /gene="acnA"
                     /locus_tag="CNE_BB2p01580"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238236"
     gene            155410..156609
                     /locus_tag="CNE_BB2p01590"
                     /db_xref="GeneID:10920247"
     CDS             155410..156609
                     /locus_tag="CNE_BB2p01590"
                     /EC_number="2.8.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-transferase; caiB/baiF CoA-transferase
                     family"
                     /protein_id="YP_004682818.1"
                     /db_xref="GI:339323925"
                     /db_xref="GeneID:10920247"
                     /translation="MQKPLRNVRVLDLTNVLAGPFCCHQLAHMGAEVIKVETPGTGDL
                     ARQLGADPELNQRLMGVSFLAQNPGKQSITINLKHARGKEVFRKLVCSADVVVENFRP
                     GVMNRLGLGYEMLKQENPRLIYCAISGFGQDGPLAELPAYDQIIQGMSGVMSITGDSQ
                     TAPYRVGYPVSDTIGGLTAAFAVAASLADHQRTEGYFIDVSMLDATLATMGWVVSNNL
                     IAGKTPAPMGNENMTASPSGTFRTGDGLLNIAANKQEQFEAVCRVVGRPELATDERFA
                     QRQGRLANRVALTDALEVELVKKPAMEWWPLLNAADVPAGPVLSVPDTLAHPQVRDRG
                     MIGVFPNAPGVGRDIRVVRTGFKVNREAPAVDTPPPELGQHTRQVLGSLGYSDSDIDQ
                     LSEERAV"
     misc_feature    155410..156606
                     /locus_tag="CNE_BB2p01590"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            156606..156833
                     /locus_tag="CNE_BB2p01600"
                     /db_xref="GeneID:10920248"
     CDS             156606..156833
                     /locus_tag="CNE_BB2p01600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682819.1"
                     /db_xref="GI:339323926"
                     /db_xref="GeneID:10920248"
                     /translation="MSGAEEVMNPGENTTDPDQRLSQDWWRTEIIDMRPGEIRYRGYP
                     IEQLIGRVSFAQMICSRPVDASAGWDVISRS"
     misc_feature    156657..>156782
                     /locus_tag="CNE_BB2p01600"
                     /note="Citrate synthase (CS), citryl-CoA lyase (CCL), the
                     C-terminal portion of the single-subunit type ATP-citrate
                     lyase (ACL) and the C-terminal portion of the large
                     subunit of the two-subunit type ACL. CS catalyzes the
                     condensation of acetyl coenzyme A; Region: CS_ACL-C_CCL;
                     cl00416"
                     /db_xref="CDD:260413"
     gene            complement(156892..158295)
                     /locus_tag="CNE_BB2p01610"
                     /db_xref="GeneID:10920249"
     CDS             complement(156892..158295)
                     /locus_tag="CNE_BB2p01610"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004682820.1"
                     /db_xref="GI:339323927"
                     /db_xref="GeneID:10920249"
                     /translation="MEQTLAKIQNCFECSPEEQNGAEFCEVNLFSHARAASLSRPRIG
                     YKIVQTNAPADSPPMELLPLEPLPTSAAAPPTPLERLHLPPALSGAAGSNRAPATATR
                     IAATNDLAAVTAWLARYADTPATVSAYRREVERLLLWAVLQLGKPLSSLTHEDLLVYE
                     RFLADPQPAARWVLSGSKKLARSHPDWRPFAGPLSPASVRHAMVILNALFARLTEAGY
                     LAGNPLALARRRRAPTRPRITRYLSHDLWNAVKATIEAMPAATERERLHAARCRWLLT
                     VLYLGGLRAAEVTGTAMGAFFCRRDAQGVERWWLEVTGKGNKTRLVPATDELIAELAR
                     YRRAHGLPPTPHPGETRPLLLPVIGRETGRDKALSRGALHLILKEVFGMAAARLRARG
                     PEWEGQAAVLASASAHWLRHTAGSHMTDQKVDLRFVRDNFGHASIATTSGYLHSEEDA
                     RHAATQERHRIGWAQKS"
     misc_feature    complement(156961..157989)
                     /locus_tag="CNE_BB2p01610"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    complement(156961..157575)
                     /locus_tag="CNE_BB2p01610"
                     /note="INT_SG1, DNA breaking-rejoining enzymes,
                     integrase/recombinases subgroup 1, C-terminal catalytic
                     domain. The CD contains mainly predicted
                     integrase/recombinase and site-specific XerD recombinases.
                     The members of this CD are found predominantly in...;
                     Region: INT_SG1_C; cd01183"
                     /db_xref="CDD:238588"
     misc_feature    complement(order(156967..156969,156994..156996,
                     157063..157065,157072..157074,157351..157353,
                     157444..157446))
                     /locus_tag="CNE_BB2p01610"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238588"
     gene            158379..160424
                     /locus_tag="CNE_BB2p01620"
                     /db_xref="GeneID:10920250"
     CDS             158379..160424
                     /locus_tag="CNE_BB2p01620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682821.1"
                     /db_xref="GI:339323928"
                     /db_xref="GeneID:10920250"
                     /translation="MEEGIDDNSFYSRRMIDGRTVDTSHWASPDEGALTGDRRVLYLA
                     RKQAVSLYLSGASAESIRRLTSLGTRQAYRLIRERCLETHPDGRPYGWRGLVPWLRVK
                     PYRRSRKVHVDQFGRGAAGAMQALLDCQPALRQAFEARILASASAKRLVETKQSRRRH
                     CAWFLDQLRSFGYEARNEWPFNTSSLGYYSICRYIDKVLSANPRALAAASGGPNLALK
                     LRSGDGTGRPVLRFMQRVEMDAHKLDGRFCVSLPLMGGGFKEKIVHRLWVVVILEVVS
                     RAVLGYYFSVRREVSKDDVMRALKRALGRWCLRPVSFCDTPYLPEAGLLSAVGSDFVG
                     LCWDETSVDGALAETCQHVRDALRDSVGSTLLDPKTSFSKRRSKDDRPFIEAFFRNLA
                     GQGFQRLSNTTGANFQDRKGRQPEEVALASRFQYEYAEELLDVLIANYNATPHSGIGN
                     RTPLAYAKFLYHHSQQSFRRADPAVVDTLFSIRKRCIVRGGAASGRAPFVEFHYGRYT
                     NDVLHNRHDLVGSEIWVVCHKEDDCRVALASTLDGMSLGVLRAAPPWNMSPHSLSLRA
                     AICQACSHGKFAIPAGVDAIDVFMRYVESQAHNRLPVHPAYLEARRILAAAADSSIGP
                     SMLDAAMARAKAGSSSSNHSKGSAQEPTARRAQSGAADPPKPPAGSTLPPRRMAQSR"
     gene            160428..161408
                     /locus_tag="CNE_BB2p01630"
                     /db_xref="GeneID:10920251"
     CDS             160428..161408
                     /locus_tag="CNE_BB2p01630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682822.1"
                     /db_xref="GI:339323929"
                     /db_xref="GeneID:10920251"
                     /translation="MSFSLPERIDPRHCIVTKQYAVYTPPMHEMIEQIGEWIDQQRPG
                     GYIYGASRLGKSRCLQWYVANELQERFKAVMPLVVWNRRPDSQSSEAGFWHQLLLASR
                     FEFANPAKPPKKAEGIYLCKQRFIAIANNAQRNYVVLLIDEAQDLTLREWKWLAGLQN
                     ELDYEGYLLSVFSVGSHQLNYRHEYMAITGNAHVAARFMAAHARFHGLRSPEEIGYVL
                     NGYDIDSEWPPSSGVPYLEYFAPADYAAGRRLAECAAQLWKALMELSPESARRHFEFP
                     MQHVAKATEAILFQLARGEDWDDVTSHESWLRELAKANFPDHMRIISTGS"
     misc_feature    160545..160964
                     /locus_tag="CNE_BB2p01630"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     gene            161410..162852
                     /locus_tag="CNE_BB2p01640"
                     /db_xref="GeneID:10920252"
     CDS             161410..162852
                     /locus_tag="CNE_BB2p01640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682823.1"
                     /db_xref="GI:339323930"
                     /db_xref="GeneID:10920252"
                     /translation="MAAYPSVNWWPGNLRPYESRLSFVARFCAMNGINVRKCAKFLSV
                     EPDSNTPLPIDKIRRLASVLGETAPLVEDVFSPSIRFIDVGRYGPPPDSRERGAIRYC
                     ETCVQHGYHSYLHQLGWLSRCPFHLSELKTTWAQKHTASLVSQRVGALEFVMRQRCRT
                     WPHGINAGFPAREQGRVASLAGWVARASVAAARMSLGEIWSSGNDGMPGAVSLDQAFG
                     QLRTLEPPPEDIEPLLIEAGDRWTLESHAFARQAKIQLGGLRLCHLSFAEVLHFYIRI
                     NAASANPSSFVTRLHAMQDRQTRHGTCRCRWRLTKAGWLSRWVSVHPEEGPRWGLICP
                     YDIALNELQLGWGRSDLALSNRQAEQERRRFCSVSHAMRDLGLIRYTRDAAVAPAGYL
                     YADQDVWTCCEWVRESALSAVLDMAVAWEAELTFDALTTWLDDIDRGVDPLERDDSKS
                     CVRLCETDDGLLLIKWTRAEANVRRGRSRI"
     gene            163221..165260
                     /locus_tag="CNE_BB2p01650"
                     /db_xref="GeneID:10920253"
     CDS             163221..165260
                     /locus_tag="CNE_BB2p01650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682824.1"
                     /db_xref="GI:339323931"
                     /db_xref="GeneID:10920253"
                     /translation="MEVRDADDSCHCSRRTIGRRAIDTSLWASPDEGALEGERRALYF
                     ARKQAVSLYLSGATADTIKRLTSLGAKQAYRLIRERCLETHPDGRPYGWRGLVPWTRI
                     KHYRRHRKIHVSQFGGGAVGALQALLDAQPELRQAFEARILASASGKRLVETRQSKRR
                     HCGWLLDQLRELGCEQRNEWPFNTATLGYVSIGRFIDKVLSANPRALAAASGGPDLVS
                     KLKTGDGTGRPVQKFMQRVEMDAHKLDGRFCVSLPLMGGGFREKIVHRLWVIVILEVM
                     SRAVLGYYFSMRREVSKDDVLRALKRALGKWCARPVSFSDRAYLPDAGLLSVLGDDFV
                     GLCWDETSVDGALAETCQHVRDALRDTVRATLLEPKTSFSKRRSKDDRPFIEAFFRNL
                     AGKGFQRLSNTTGAKPQDRKGRKPEDVALASRFQYEYAEELLDVLIANYNATPHSGIG
                     NRTPLAYANFLYHHAQQSFRRVDPAVVEALFSIRKRCIVRGGAASGRAPYVEFYYGRY
                     TNEVLHNRHDLVGSEIWVVCHKEDDCRVALASTLDGISLGVLRAAPPWNISPHSLAVR
                     AAISQACSHGQLIIPAGADAIEIFMRFVESQAHKRLPVHPAYLEARRILVAAADPSIG
                     AAMLDAAMDRAKQKDSRGSRNGGTSNKPARPNGAIKTEPATPGSMLPPRRMAQSG"
     gene            165264..166244
                     /locus_tag="CNE_BB2p01660"
                     /db_xref="GeneID:10920254"
     CDS             165264..166244
                     /locus_tag="CNE_BB2p01660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682825.1"
                     /db_xref="GI:339323932"
                     /db_xref="GeneID:10920254"
                     /translation="MRFPLPERIDPRHCIVTKQYAVYTPPMHEMIEQLGEWIDQQRPG
                     GYIYGASRLGKSRCVQWYVAQVLQERLNAVVPLVVWNRRPDSQTSEAGFWHQLLLASN
                     FEFANPAKPPKRAEGIHLCRQRFIAIANNAQRNYVVLTIDEAQDLTFREWKWLLGLQN
                     DLDYEGYLLSVFSVGSHQLNYRHEYMAITGNAHLAARFMAAHARFHGLRSPEEIAYVL
                     NGYDIDSEWPPGSGVSYLKYFAPVQFATGHRLADCAALVWKALVELSPESARRHLEFP
                     MQHIARATEAMLFQLAHGGDWVDVTSYENWLQEFAKANFPDHMRIISTGS"
     misc_feature    165381..165800
                     /locus_tag="CNE_BB2p01660"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     gene            166246..167685
                     /locus_tag="CNE_BB2p01670"
                     /db_xref="GeneID:10920255"
     CDS             166246..167685
                     /locus_tag="CNE_BB2p01670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682826.1"
                     /db_xref="GI:339323933"
                     /db_xref="GeneID:10920255"
                     /translation="MAAYPSVNWWPGNLRSYESRLSFVARFCALNGINVRKCAEFLSV
                     EPDSNTPLPIDEIRRLASVLGETAPLVEDVFSPSIRFIDVGRYGPPPDSRERGAIRYC
                     ETCVQHGYHSYLHQLGWLSRCPFHLSELKTTWAQEHTASHVSQRVGALEFVMRQRCRT
                     WPHGIDAGFPAREQGRVASLAGWVARASVAAARMSLGEIWSSGNDGMPGAVSFDQAFG
                     QLRTLEPPPEDIEPLLTEAGDRWSLESHAFARQAKIQLGRLRLCHLSFAEVLHFYIRI
                     NAASANPSSFVTRLHAMQDRQTRHGTCRCRWRLTKAGWLSRWVNVHPEEGPRWGLICP
                     YDIALNELQLGWGRSDLALSNRQAEQERQRFCSVSHAMRDLGLIRYTRDAAVAPAGYL
                     YADQDVWTCCEWVRESTLTAVLEMAVAWEIELTFDALTTWLDDIDRGVDPLERDDSKS
                     CVRLCETDDGLLLIRWTQADGSASQTTPF"
     gene            168266..169417
                     /locus_tag="CNE_BB2p01680"
                     /db_xref="GeneID:10920256"
     CDS             168266..169417
                     /locus_tag="CNE_BB2p01680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682827.1"
                     /db_xref="GI:339323934"
                     /db_xref="GeneID:10920256"
                     /translation="MPAPDLDLSDAALQAAMAHDIAELRGRFPETRALYREVCGLLFF
                     RYGVTPTANKLYSLVRKGSMGTPAEVLQGFWQELRGRTRVTIDHPDLPDALKQVAAEA
                     VRTIWQAANEAASAELATLRAEARDVAKAAEAERDAARAETAAALEDALALSAQLGEA
                     RQAHDAVQAELAAERQAHAATRARWEAGRGELEATGRQLAELRTQFSTELERAREAVT
                     LAQERAEASERRSLRELDQERTARQKSERTAEDLRAELAVARSEARDAAVAQAEGRAK
                     LEAQAVALAERLAVAEQAQRKAAGDLDTVQAELAAAQRRAERAEAEAALARQLLATLR
                     VAPPERDGGGGGGGGGGGGGGGGGEAQGRPFGGDRAGRAGRRSGGRSPG"
     misc_feature    168389..>168643
                     /locus_tag="CNE_BB2p01680"
                     /note="Plasmid replication region DNA-binding N-term;
                     Region: KfrA_N; pfam11740"
                     /db_xref="CDD:256587"
     gene            169615..170727
                     /locus_tag="CNE_BB2p01690"
                     /db_xref="GeneID:10920257"
     CDS             169615..170727
                     /locus_tag="CNE_BB2p01690"
                     /codon_start=1
                     /transl_table=11
                     /product="histone-like nucleoid-structuring protein H-NS"
                     /protein_id="YP_004682828.1"
                     /db_xref="GI:339323935"
                     /db_xref="GeneID:10920257"
                     /translation="MKENKLAPEQEVEPRVASNATNGLGQMELPIAEAMRDADPAIGE
                     ASGAGVGSGSVDTQAQRLDFWSTSRDSGPTATVSYRRRRSYAAPDASTEDVAPEESRE
                     AAASEALTESDAPEAPIEAMPSEATTEAVAEAPVEVLATDEPMEAAARDELTESAAPV
                     APLYAPAPEAAPEERQAPKRGRKPKALTETAAPEAAPEGRRTPKRGRKPKTLAEVAAP
                     EVTTQETPTRKRGPKQITLPGVEAAPEAPTQKPQTRKPRQEQKTPTATQSPSQSSLLA
                     QLASVNAQLEQLRATEVPKVVEEIRQLMQEYDLSIEDIAGKPSVEPAARAVPTKTKAA
                     PPPRYRNPKTGQTWSGRGRAPAWIGKKSERFLISSP"
     misc_feature    170434..170706
                     /locus_tag="CNE_BB2p01690"
                     /note="H-NS histone family; Region: Histone_HNS;
                     pfam00816"
                     /db_xref="CDD:250154"
     misc_feature    170599..170715
                     /locus_tag="CNE_BB2p01690"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; cl19571"
                     /db_xref="CDD:267924"
     gene            171184..172434
                     /locus_tag="CNE_BB2p01700"
                     /db_xref="GeneID:10920258"
     CDS             171184..172434
                     /locus_tag="CNE_BB2p01700"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase family"
                     /protein_id="YP_004682829.1"
                     /db_xref="GI:339323936"
                     /db_xref="GeneID:10920258"
                     /translation="MLSPERATIGARRSDELGRYYTRADIGELLVDYMGSTAPYGVLD
                     LGSGVGSLSEAAARRWSNSNILTVDVDQAVSAQIRAALNLRAEGRHAHLRADALSSRL
                     PLLIRAQLDKIDAAVCNPPFIKPVWRKTFDNILEDAGLSGCLPAIKDADAALLFLAQN
                     LRTLDAGATLGIILPDTMISSQRYQRFRKDLLARYKVEAVIKLPRGSFLGTEALASIL
                     IVKTAKPTDQSVPLYKLNFERTISTPILVPIDQAVERLDYDYHALTRVQPVRPGKKLP
                     LAAICTEVRRGLIENSLAKRCSISVFHTTSMSSADLGRWVDLPNQFPGSDNESSMITA
                     TSGDILVARVGRNIGQKILGVATGMVLLTDCVYRIRVPQRYQKLVLSQLSSKANRDWF
                     ESRTYGVGARQLTKADLLSFPIYL"
     misc_feature    171235..>171873
                     /locus_tag="CNE_BB2p01700"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
                     /db_xref="CDD:251262"
     misc_feature    171307..171591
                     /locus_tag="CNE_BB2p01700"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(171316..171336,171388..171393,171466..171474,
                     171538..171540)
                     /locus_tag="CNE_BB2p01700"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            172449..174134
                     /locus_tag="CNE_BB2p01710"
                     /db_xref="GeneID:10920259"
     CDS             172449..174134
                     /locus_tag="CNE_BB2p01710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682830.1"
                     /db_xref="GI:339323937"
                     /db_xref="GeneID:10920259"
                     /translation="MSEFEERADQLALDIIDTSLVDGEMFRSARRKLLATGAKLLVGP
                     RGTGKTHLMRYTYQHALDKPTAPLVLYASFNRYLNLEPLLKRSPDALKRFHSWVLAKL
                     ILSCFQWLEDKGENSAWFAALDPLYDSAKLSGLISLLERGGGDDIYQEFGQFLTVDLV
                     LKAARALASRFSRSRTVFLLDDAALSLSDQYLVSFFEIFRLLKTQYISPKASVYPGTT
                     QYGPTFHASHEAESVPLWLSIEDSEYSQIMGEIAEKRLTKKEVETINRDILEVFKYAS
                     FGIPRTFLRLLREYFDSRPGTSQQKINKIIEQQASLIGAEYDSLGLKIRQFSSLVSMG
                     RRLFDKAVIDISAGQSEDTSTRNIVLGIRQDSGQNPLAERMLRFLIEVGMLFPLQAVS
                     HGPNRKYDRYIPHIAFLYQHGAFREGRGSSLKVLPQVMQRPAAKHPVRRDLNSLLGAE
                     TVENLHLDLPPCQNCGAERLNDSQRFCHNCGQELVAASLFEECMKLPLEQVPGISKAL
                     IQRIQADTNLRTIGHVYASQNASGDLQQANYVGPVRASGIISKVSVMVNEFLS"
     misc_feature    172518..>172859
                     /locus_tag="CNE_BB2p01710"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    172560..172886
                     /locus_tag="CNE_BB2p01710"
                     /note="AAA domain; Region: AAA_14; pfam13173"
                     /db_xref="CDD:257541"
     misc_feature    173832..173900
                     /locus_tag="CNE_BB2p01710"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:257597"
     gene            174348..174989
                     /locus_tag="CNE_BB2p01720"
                     /db_xref="GeneID:10920260"
     CDS             174348..174989
                     /locus_tag="CNE_BB2p01720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682831.1"
                     /db_xref="GI:339323938"
                     /db_xref="GeneID:10920260"
                     /translation="MIAAVESYLRAILRRLIAMDSICQESVHRRDVSYGAAIHLTKDM
                     LPEAVLEKISFISKGSIVDSIRELAGIKGNLPPDVTASIDDYVKICHLRHCAVHRFGK
                     LGVSNAIALGLEDHKELLEKPLLLDYLSLQNSIVISTGMVKTINNFLFNEIVSRISDS
                     RWTGVYKTDKRLFLTYYKIFADTISTTGFSVGLKDMYILFMSQKAKFSAGLPF"
     gene            complement(175360..176343)
                     /locus_tag="CNE_BB2p01730"
                     /db_xref="GeneID:10920261"
     CDS             complement(175360..176343)
                     /locus_tag="CNE_BB2p01730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682832.1"
                     /db_xref="GI:339323939"
                     /db_xref="GeneID:10920261"
                     /translation="MFPQGRGERMPSACVEVAMDTKGGMSGGPVVNANGDLVGIVSSS
                     FDGGPSYVTLIWEALRIKVSSRLPSLALRGDIDLIAARELGLVKLKGEVKRSKRGDIT
                     MTLTEPECELLTVSSDPEAIVSPPPGSKPLIGVRLEDFEERWLSEVETAAADTALAYL
                     EGLELPLVRRFLSASDVPEACLAPIREFTVEDFDGVEDPDIQSAREDEDGTVAIAFAF
                     DLLSVVWTMQVPASDYLALARDYDSHFMNITVDGPTASMELIQRCHFETSLALDREAS
                     EFTKASITFSGVIRPKPRAPGTRRIPDAPIDLDYWLRETPADAGGLLSGYP"
     misc_feature    complement(176224..>176337)
                     /locus_tag="CNE_BB2p01730"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     gene            complement(176725..176922)
                     /locus_tag="CNE_BB2p01740"
                     /db_xref="GeneID:10920262"
     CDS             complement(176725..176922)
                     /locus_tag="CNE_BB2p01740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682833.1"
                     /db_xref="GI:339323940"
                     /db_xref="GeneID:10920262"
                     /translation="MDIFTRNAGLADPVLSDEAAFFIQLILDDVWLWFNTVYGEQARR
                     YRPPPDLDPDDDPANELDLPF"
     gene            complement(176974..177768)
                     /locus_tag="CNE_BB2p01750"
                     /db_xref="GeneID:10920263"
     CDS             complement(176974..177768)
                     /locus_tag="CNE_BB2p01750"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_004682834.1"
                     /db_xref="GI:339323941"
                     /db_xref="GeneID:10920263"
                     /translation="MYRQHFGLRCAPLDKDSTSLWDDGAIAHLNERFQWLLTSPGVGL
                     LTGEPGVGKTAALRHITRSLNPHRYQVIYTAESDFGRIDLYRALARELGLEPSYRRAD
                     LWRDIKRRITELAQNRQVLPVWVIDESQNLPPAFFRDLPAFLNFAMDARDLITIWLAG
                     HPSLADVLERAPYAALYGRIQVRVHFTPVIERERFAQLIGHALAAAGCNHTLLSDSGI
                     EQLREASRGVPRQAGRILRNAMRLAVPKGLNHIPDDLLLRAIGEVR"
     misc_feature    complement(176977..177768)
                     /locus_tag="CNE_BB2p01750"
                     /note="putative secretion ATPase, PEP-CTERM locus
                     subfamily; Region: pepcterm_ATPase; TIGR03015"
                     /db_xref="CDD:132060"
     misc_feature    complement(177205..177639)
                     /locus_tag="CNE_BB2p01750"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(177607..177630)
                     /locus_tag="CNE_BB2p01750"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(177286..177288,177388..177390,
                     177604..177627))
                     /locus_tag="CNE_BB2p01750"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(177385..177402)
                     /locus_tag="CNE_BB2p01750"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(177232..177234)
                     /locus_tag="CNE_BB2p01750"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(177772..179133)
                     /locus_tag="CNE_BB2p01760"
                     /db_xref="GeneID:10920264"
     CDS             complement(177772..179133)
                     /locus_tag="CNE_BB2p01760"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic region"
                     /protein_id="YP_004682835.1"
                     /db_xref="GI:339323942"
                     /db_xref="GeneID:10920264"
                     /translation="MSFPHFDEGFNEMNDIDEMALFRLGVLGPLTSRGELARGELTRL
                     IRQIAQQEYAIPGSRRRHISEKTLHAWYDTWRREGIAGLASKVRADRGSSKLPEAVQA
                     AVLAAKRENPRRSIRQIRLLLESAGLVARDTLSRSAVHRLLKANGLSRIAGPAVVPDE
                     KRSFEAEHAGSLWYGDVMHGPTLSIDGKRRKTYLVSLMDDASRLVAHSAFCLSETALD
                     IESVLKQALLRRGIPGRLVVDNGSAYRSATLQSICARLSIRLIYCRPYQPASKGKIER
                     WHRTLREQFLAELDTSRIRELGDLNARLWAWIEQIFHRSKHASLGGLTPLARYQQDLP
                     RIRLLGPLAAQLDQLFWYRITRLVRRDGTVSYQGKRFEVPYELAGQHVRLVVDPHTGV
                     VMHVENEAGLQLGAATELDTVANSTRRRQRPQAEPATAEPAVAGPNLIELAHRQHYPH
                     TEH"
     misc_feature    complement(178705..178935)
                     /locus_tag="CNE_BB2p01760"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(178141..178821)
                     /locus_tag="CNE_BB2p01760"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    complement(178279..178641)
                     /locus_tag="CNE_BB2p01760"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(178159..178368)
                     /locus_tag="CNE_BB2p01760"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(179232..179762)
                     /locus_tag="CNE_BB2p01770"
                     /db_xref="GeneID:10920265"
     CDS             complement(179232..179762)
                     /locus_tag="CNE_BB2p01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682836.1"
                     /db_xref="GI:339323943"
                     /db_xref="GeneID:10920265"
                     /translation="MHRIVFAFLTLEQHLLAIRCTPQSYRPDACAHCGCGCLWGHGCY
                     HRKADRSGDAELNPVPIPRFRCPSCRRTCSRLPLAICPRRWYGWALQQQVLLLLIAGA
                     SLRRTAAIFALGYHTVRRWWRWLNTSQTFAFHLRSRFADLGRCANSVEFWLTCFGQMP
                     LCQAMAWIDHDGLTVP"
     gene            complement(179872..180369)
                     /locus_tag="CNE_BB2p01780"
                     /db_xref="GeneID:10920266"
     CDS             complement(179872..180369)
                     /locus_tag="CNE_BB2p01780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682837.1"
                     /db_xref="GI:339323944"
                     /db_xref="GeneID:10920266"
                     /translation="MTSVRITEANPALATLRRSWVTAIYTNEDGIGSMGSLHEAGDAL
                     VALALMEEDGPTILGSGVMIGPGLVVAATHVLAEFKARNADPVLLTFLPDGARAWLPR
                     ESSTLTGPSVFGADRRIVSDVSLLSCTLNSEAHEHHPLTLVLRPAQSEVWEGPFIPRT
                     AGAIF"
     gene            complement(180724..181311)
                     /locus_tag="CNE_BB2p01790"
                     /db_xref="GeneID:10920267"
     CDS             complement(180724..181311)
                     /locus_tag="CNE_BB2p01790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682838.1"
                     /db_xref="GI:339323945"
                     /db_xref="GeneID:10920267"
                     /translation="MSIVGGNQRIGFRWIQLLHAIEANKFWILKPLTITPHAIARCLQ
                     RVGTMDVPGILEPISLALGFAIPLMSVSHQEKWRQFAVPVREGLFLGDSGPDGWVIRT
                     YISRKPYEHESGWDKYLNLFPEIPRWSPSDLRNISVSGRWMTEQLMAIRKERLIVDRV
                     SRLAKQYERREDKQGEQWRKAKSQRDRDRRRQSDA"
     gene            complement(181727..182182)
                     /locus_tag="CNE_BB2p01800"
                     /db_xref="GeneID:10920268"
     CDS             complement(181727..182182)
                     /locus_tag="CNE_BB2p01800"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase Tn3 family"
                     /protein_id="YP_004682839.1"
                     /db_xref="GI:339323946"
                     /db_xref="GeneID:10920268"
                     /translation="MRGKTGGAYRPAAAFCRDEAKGRLNAFRPIVQLAFHGTPNFALA
                     SKLPRFASSTGPTSARSIKGLSRKQIAWLNLRHVTEQRIDKAIVKVINAYNQFALPKY
                     WGGGKRASAALTGLPVGHKEGLLGNGGGNSLGVLNRITDACPSSSVRIA"
     misc_feature    complement(<181850..182032)
                     /locus_tag="CNE_BB2p01800"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     cl14901"
                     /db_xref="CDD:265477"
     gene            complement(182202..183029)
                     /locus_tag="CNE_BB2p01810"
                     /db_xref="GeneID:10920269"
     CDS             complement(182202..183029)
                     /locus_tag="CNE_BB2p01810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682840.1"
                     /db_xref="GI:339323947"
                     /db_xref="GeneID:10920269"
                     /translation="MLESILPTSPNMVTPKLVAKIEAEEPTLRLAVLIDADNAQAAVI
                     EGILGEVARFGEATVKRIYGDFTSPHSASWKKVLQTYAIKPVQQFAYTTGKNATDSTL
                     IIDAMDLLYTRRFDGFCLVTSDSDFTGLATRIREEGLFVLGFGEQKTPDAFRNACNKF
                     VLTELLRPAPAEATPAAAAKPETAVVPIVTQANTVTKAPVPSFPQDFMLSAIDQSSDE
                     NGWAHLGTFGSYLTKLQPDFDPRVYGFKKLSDLVRSRQDIFVTEERTRRAKLRSSST"
     misc_feature    complement(182547..182942)
                     /locus_tag="CNE_BB2p01810"
                     /note="Uncharacterized subfamily of N-terminal LabA-like
                     domains; Region: LabA_like_N_1; cd11297"
                     /db_xref="CDD:199898"
     misc_feature    complement(order(182652..182654,182658..182660,
                     182664..182666,182733..182735,182916..182918,
                     182925..182927))
                     /locus_tag="CNE_BB2p01810"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199898"
     misc_feature    complement(182547..>182747)
                     /locus_tag="CNE_BB2p01810"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     misc_feature    complement(182238..182414)
                     /locus_tag="CNE_BB2p01810"
                     /note="C-terminal domain of LabA_like proteins; Region:
                     LabA_like_C; cd10146"
                     /db_xref="CDD:199214"
     gene            183803..184150
                     /locus_tag="CNE_BB2p01820"
                     /db_xref="GeneID:10920270"
     CDS             183803..184150
                     /locus_tag="CNE_BB2p01820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682841.1"
                     /db_xref="GI:339323948"
                     /db_xref="GeneID:10920270"
                     /translation="MGACPPMCCRRSCRNSGRTRVTIDHSALPAALKGIAAGAVQAIW
                     QAANEAATGELATLRAEAPPAAIAAESESESESEPDAARRGLRPRRPVRRWPPSRRSW
                     PRHPTCMTPCRRT"
     misc_feature    <183842..>183979
                     /locus_tag="CNE_BB2p01820"
                     /note="Plasmid replication region DNA-binding N-term;
                     Region: KfrA_N; pfam11740"
                     /db_xref="CDD:256587"
     gene            complement(185191..185430)
                     /locus_tag="CNE_BB2p01830"
                     /db_xref="GeneID:10920271"
     CDS             complement(185191..185430)
                     /locus_tag="CNE_BB2p01830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682842.1"
                     /db_xref="GI:339323949"
                     /db_xref="GeneID:10920271"
                     /translation="MSMPKTITPLPRGQYWATPHAPFPLDGPNGHDEVFPGAYGVSDG
                     QWVTFYKDGEEVWACNAIYAAAHFDFAAVSSAGAD"
     gene            185574..185720
                     /locus_tag="CNE_BB2p01840"
                     /db_xref="GeneID:10920272"
     CDS             185574..185720
                     /locus_tag="CNE_BB2p01840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682843.1"
                     /db_xref="GI:339323950"
                     /db_xref="GeneID:10920272"
                     /translation="MARYLPILARAFGVGAFIVIAAIVSRQVYLRSAAEGLPTPAQTR
                     SLRQ"
     gene            complement(186530..187378)
                     /locus_tag="CNE_BB2p01850"
                     /db_xref="GeneID:10920273"
     CDS             complement(186530..187378)
                     /locus_tag="CNE_BB2p01850"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator IclR family"
                     /protein_id="YP_004682844.1"
                     /db_xref="GI:339323951"
                     /db_xref="GeneID:10920273"
                     /translation="MANVVPRDRSASARAGKPQNLTRAVLREPGDRQFASTLERGLRV
                     LQCFSADSPELGNAEIAARTGLPKPTVSRLTHTLVRLGYLRRHPDSGDFGLGMSILCL
                     GYPLLAGLQLRRLAAGPMKELADLIDGSVAIGVRDHLRIVALENITTRDVLKRKPGTG
                     LTLPLVSSTAGTAWLVGATADERKRAIREIEYAEPGSWARQADEFDVFRKEFARLGYV
                     KRRNVLRPDTVALGVPLRRRPGAELLVLSCVLATSAATADALEQQAAVGLLTAAKCIG
                     EKLQQP"
     misc_feature    complement(186539..187273)
                     /locus_tag="CNE_BB2p01850"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(187004..187270)
                     /locus_tag="CNE_BB2p01850"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     gene            complement(187463..188371)
                     /locus_tag="CNE_BB2p01860"
                     /db_xref="GeneID:10920274"
     CDS             complement(187463..188371)
                     /locus_tag="CNE_BB2p01860"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S33 family"
                     /protein_id="YP_004682845.1"
                     /db_xref="GI:339323952"
                     /db_xref="GeneID:10920274"
                     /translation="MHVDIRHHHVMLNGFDMHYASCGEPGHPLLLFVHGFPENWQAWH
                     HQLEAFGPHYYAVALDTRGINESAGPVDVKGYRAGHMVADILALIDHLGYPQCVLVGH
                     DWGGAIACAVALANPARLHGLVMINAVHPAIYRRELVESPAQQAASAYMNFFIGDDAL
                     AQICANDFAYLFGMFAEDGQQPEWLDAPTQAGYRHSWSRPGSVRAGLDYYRASPLHPA
                     ALGDSGAAGVVFDSAAMTLSVPTLVIWGERDRFLLMGCIDGLRQFAPDLRIERIPDGS
                     HWVIHEHGPRVNRLITEFLNDRLDTA"
     misc_feature    complement(<187997..188350)
                     /locus_tag="CNE_BB2p01860"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(187487..188335)
                     /locus_tag="CNE_BB2p01860"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<187820..>188146)
                     /locus_tag="CNE_BB2p01860"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(188388..189698)
                     /locus_tag="CNE_BB2p01870"
                     /db_xref="GeneID:10920275"
     CDS             complement(188388..189698)
                     /locus_tag="CNE_BB2p01870"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_004682846.1"
                     /db_xref="GI:339323953"
                     /db_xref="GeneID:10920275"
                     /translation="MQANTTQAIEERVKPNAGLGVLVRSEYFTNLIPGVHTLGGQGNS
                     LAIETARGVVIVDAGPGGGVTRAMITRLRELSAAPVLAIVYSHGHSGYNAGARLWQEH
                     AAERGEIRPALIAQAGVPARYRRYTETAQLQAWLNSRQFRKTMRPASADSYPMPDQTF
                     DSRMVIDGGDRRIELIAAPSETDDALAVWLPESRFLYGGASMIRSIPNVGTPLRTIRD
                     PLRWANTLERLYALNPTQVLPEFGDPITDPQEIHDAFQVPIRALRYLRDAVVERMNAG
                     MNEREILHDMVYPEALFGHKWMRPIYGDPEYIVREIWRMENGWWDRNPTHLHPARPAE
                     AANAVLSALGNPGHVLDEARRLQAEGDTQLALHVIDLLALADPVIPEVIAARALKAAL
                     CRQRAEQMRSIVSRQILLSSAEDLLGLPIGSTSAEDPPADFSWN"
     misc_feature    complement(188925..189608)
                     /locus_tag="CNE_BB2p01870"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     misc_feature    complement(188445..188870)
                     /locus_tag="CNE_BB2p01870"
                     /note="Alkyl sulfatase dimerization; Region:
                     Alkyl_sulf_dimr; pfam14863"
                     /db_xref="CDD:259000"
     gene            complement(189782..191050)
                     /locus_tag="CNE_BB2p01880"
                     /db_xref="GeneID:10920276"
     CDS             complement(189782..191050)
                     /locus_tag="CNE_BB2p01880"
                     /EC_number="3.1.6.-"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl sulfatase"
                     /protein_id="YP_004682847.1"
                     /db_xref="GI:339323954"
                     /db_xref="GeneID:10920276"
                     /translation="MDTSNILMVKQALACHADGVYTLGGQGNSVVVDLGATLLLVDAG
                     PGGGITDAMIAQLRASLDKPVAYIVYSHGHMGYNNGVRQWLAEAARRGDPTPQLVAHA
                     NLPARYRRYRETGGLQAYTNVRQFRSDYPATPPAHWFQMPTLTYQDRLALTGTERHVV
                     LMHAPSETDDGTAVWIPDARTLYGSNAFIKTCPNVGSPYRIYRDPMRWAQTLERFAEL
                     APAVLIPEFGKPVTDAAEIHEALTVPARALRYLRREVVARMNAGMSENDIINDVPLPD
                     ELFGSRFMKPTYGCAAYIMHDIWRSENGWWNRNPTDLHPAAPAKAAAAVRRALANPER
                     VLARTRELQAAGELQLALHVIDLLASDDDGDPVSKQARELKAALCEGRAQPMTSVVSR
                     HLYLSAADELLDRPVGAAERARGDAGYAWQ"
     misc_feature    complement(190319..191035)
                     /locus_tag="CNE_BB2p01880"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     misc_feature    complement(189845..190264)
                     /locus_tag="CNE_BB2p01880"
                     /note="Alkyl sulfatase dimerization; Region:
                     Alkyl_sulf_dimr; pfam14863"
                     /db_xref="CDD:259000"
     gene            complement(191103..192089)
                     /locus_tag="CNE_BB2p01890"
                     /db_xref="GeneID:10920277"
     CDS             complement(191103..192089)
                     /locus_tag="CNE_BB2p01890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682848.1"
                     /db_xref="GI:339323955"
                     /db_xref="GeneID:10920277"
                     /translation="MSSFGRRPRLAMIAATAMCLIVQPVAAQTPWPSRPVRLVVPFPP
                     GGSTDLLARALGEKLSKSLGQAVVIDNKPGASGALAAESVVRADPDGYTVLVTIQAPV
                     VVVPHYTTVRYDPLRDLVPVAALANGPLVFAGNAAFPARNVKEVVAYARTHPNTVSYA
                     SFSPGTWSHFAGLLLNRHEKIDLLHVGYKGSAPAIGDVVGGQVQLIFDGQATVLPMVK
                     AGKLRAYAVTSATRTRLLPDVPTFAELGYPEISSDGWMGAFAPAKTPDAVVKRLNAEL
                     VKLVNTPEVMERLNTLGAEPASAMDAARFGRQVASDYKRWGDIVRTSGYRQE"
     misc_feature    complement(191109..192065)
                     /locus_tag="CNE_BB2p01890"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            complement(192221..193189)
                     /locus_tag="CNE_BB2p01900"
                     /db_xref="GeneID:10920278"
     CDS             complement(192221..193189)
                     /locus_tag="CNE_BB2p01900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682849.1"
                     /db_xref="GI:339323956"
                     /db_xref="GeneID:10920278"
                     /translation="MTFRSFATAALAACLTLPGVASAQTYPSKPVRMVSPYGPGGSND
                     ISARIIAEGLGKKYGQQFVVENKPGAATRVANEMVAGAQPGGYTLLYAAAPFAINEAA
                     GIKGHYDIRKNFIAIGPRVVAPLFLIVNAASPIRNLADFVSFAREKKDGVTFAGTGVG
                     AAPHLASELLANAAGFKLLNVQYRGDATAYTELLAGRVDATLTAITSALPFIKAGRLR
                     VIAIASEQRSPIYPEAPTFSELGYPTVIGYGWFGLLAPAGTPPAVVQQLNRDVNAVLA
                     DPGNKERLVNLGLQPESGSSEAFADFIGGEVAKWSAVIKRAGIVLE"
     misc_feature    complement(192233..193051)
                     /locus_tag="CNE_BB2p01900"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            193447..194415
                     /gene="bug"
                     /locus_tag="CNE_BB2p01910"
                     /db_xref="GeneID:10920279"
     CDS             193447..194415
                     /gene="bug"
                     /locus_tag="CNE_BB2p01910"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004682850.1"
                     /db_xref="GI:339323957"
                     /db_xref="GeneID:10920279"
                     /translation="MTMSIGKLLAAPVACLVLAPMAHADPYPSKPIRLIVPFPAGGGT
                     DTVARMMAERLQQSLKQTVVVENRAGAGGTIGTSYAAQAEPDGYTIVLGISATMVMAP
                     FLYPNAAYTANQRFAALGQIGTVSNMLVVNPAFPAHNLKELVAAAKARPGQINYGSWG
                     LGSGGHLCAEILMRAKGITMTHVPYKGTAPELADVLGGTIMVAMVDSTTSAPYVQAGK
                     LRALAACTERSSNLPDVPGLKDEGVSFDSSFWYGLFAPAGTPAPVLSRLREEVGQILK
                     QPAVAARLKDLGIQATNLSPAQFEEVVRRDYAGWGKLIREAGIKAE"
     misc_feature    193585..194403
                     /gene="bug"
                     /locus_tag="CNE_BB2p01910"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(194468..196597)
                     /locus_tag="CNE_BB2p01920"
                     /db_xref="GeneID:10920280"
     CDS             complement(194468..196597)
                     /locus_tag="CNE_BB2p01920"
                     /EC_number="6.2.1.14"
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxyhexanoate-CoA ligase"
                     /protein_id="YP_004682851.1"
                     /db_xref="GI:339323958"
                     /db_xref="GeneID:10920280"
                     /translation="MFDHASLDRMFRPRSIALIGASTNPDKIGGVPLALLLKYEYDGK
                     LYPVNPNAGEVQGVPAYPSLAAIGAPADLAIVAVPMARAEQAVKDAAEAGVCSVVLFT
                     SGYAEVGETGRAAQARLAALARTRGVRILGPNCLGFMNTRDQVYATFSPAPHAARARP
                     GAVGIVSQSGAFGIYAYAMARERDIGLSYWISTGNECDIEFADAVAWLARDPDTRVIM
                     GYVEGCRDGAKLKAALSLARDAGKPVIVTKVGRTASGAAAAASHTAALAGDDAVFDAL
                     LRQYGAIRTRTLDEFFNVGYALSGPVRPANNALGIMTLSGGVGALMADDAADAALELV
                     PMPAGAQAAIMARVPFAAPRNPVDITGQVTSEPELMTFAARTMLDSGSYGSLLAFLAA
                     AGTSATFWPHLLAFAKTIRAEYPDTPLALCSLFTPERRRALEALGCLVFADPSAAVRA
                     LKCLGDTAAIARPACDPGLSPYSENPATIEAGVLDEPAGLALLRSAGVPVVAHQRVAS
                     QDEAVAAAAAFGYPVVMKLVSADITHKSDIGGVRLHLQDAGAVRAAYREILEEAARHA
                     PAARLDGLLVAPMIKGGVECILGVQRDPVYGPVVMFGLGGVLVEAVRDVAFRMAPFDE
                     REAHAMIDEIRGRRVLAGMRGQPPADVSALASALAALSRFAWANRDAVVSVDVNPFIV
                     LPLGGGALALDAVVIGAGNASDRLATA"
     misc_feature    complement(194720..196582)
                     /locus_tag="CNE_BB2p01920"
                     /note="Acyl-CoA synthetase (NDP forming) [Energy
                     production and conversion]; Region: COG1042"
                     /db_xref="CDD:223972"
     misc_feature    complement(196175..196558)
                     /locus_tag="CNE_BB2p01920"
                     /note="CoA binding domain; Region: CoA_binding_2;
                     pfam13380"
                     /db_xref="CDD:257707"
     misc_feature    complement(195704..196120)
                     /locus_tag="CNE_BB2p01920"
                     /note="Succinyl-CoA ligase like flavodoxin domain; Region:
                     Succ_CoA_lig; pfam13607"
                     /db_xref="CDD:257921"
     misc_feature    complement(194507..195154)
                     /locus_tag="CNE_BB2p01920"
                     /note="ATP-grasp domain; Region: ATP-grasp_5; pfam13549"
                     /db_xref="CDD:257867"
     gene            196834..197574
                     /locus_tag="CNE_BB2p01930"
                     /db_xref="GeneID:10920281"
     CDS             196834..197574
                     /locus_tag="CNE_BB2p01930"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004682852.1"
                     /db_xref="GI:339323959"
                     /db_xref="GeneID:10920281"
                     /translation="MNNSQAHADLHGKVAVITGAGRGIGRAIAMAYARSGAAVVCSAR
                     TTNEIQDTVHQIEAAGGKAAAVTADVCDYAAMEALFATSFTLFGGVDIVVANAGVSMQ
                     SRKVEHCDPELWRQTVEVNLIGAFHTARAALPHLRRRGAGKMIFTGSGSRHRPNPGMS
                     SYASAKLGMWMLTQTLAVELLDANISVNELIPGPVRTEMTGFGDKFAPAGEWVKDPED
                     VVPLALFLAGQGDAGPTAQSFSLMRRAG"
     misc_feature    196858..197514
                     /locus_tag="CNE_BB2p01930"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    196876..197544
                     /locus_tag="CNE_BB2p01930"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(196888..196890,196894..196905,196960..196968,
                     197035..197043,197119..197127,197191..197193,
                     197272..197280,197317..197319,197329..197331,
                     197407..197418,197422..197427)
                     /locus_tag="CNE_BB2p01930"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(197194..197196,197278..197280,197317..197319,
                     197329..197331)
                     /locus_tag="CNE_BB2p01930"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(198107..199534)
                     /locus_tag="CNE_BB2p01940"
                     /db_xref="GeneID:10920282"
     CDS             complement(198107..199534)
                     /locus_tag="CNE_BB2p01940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682853.1"
                     /db_xref="GI:339323960"
                     /db_xref="GeneID:10920282"
                     /translation="MPRRPHPMTRAFGPILALAMAMAGIPCRAEAQGSAPPYNFLRYT
                     EDYRYLQDPARRSDPWDPVKLIPLGAPDAYLSLGGELRERFESYSAPNFGVPGPSSDS
                     YLLHRLLLHADLHVGSYFRVFAQLGNQLAPGKDIATPPYEDRADVQQAFVDIRLPVTD
                     GPRADSELPILRIGRQEMAFGSQRLVSVRDAPNVRRSFDGARLGGKVGEVKLDAFATR
                     PVLLKTGNFDDTPNHAQGFWGLYATFPKTVIPASGADLYYLGFENSQARYSIGTGVER
                     RHSAGGRIFGSHGPWDWDWEALAQFGSFGRQDLFAWGVSTDTGYAFKLAEWGARAGLK
                     ATVGSGDRDPQDGKLGTYGGLFPKLAYFNQAGLLGASNVMDLQPSLTFKPTATLRFIL
                     SWDFIWRQTTNDAVYTAAGLPIAGTAGRSGRYTGSQLAFDMLWQVDRHIAINAGVVHV
                     DVARVLGSVGGHNTNFTYVAAAYTF"
     misc_feature    complement(198137..199318)
                     /locus_tag="CNE_BB2p01940"
                     /note="Alginate export; Region: Alginate_exp; pfam13372"
                     /db_xref="CDD:257699"
     gene            complement(199562..200239)
                     /locus_tag="CNE_BB2p01950"
                     /db_xref="GeneID:10920283"
     CDS             complement(199562..200239)
                     /locus_tag="CNE_BB2p01950"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004682854.1"
                     /db_xref="GI:339323961"
                     /db_xref="GeneID:10920283"
                     /translation="MSQPANFNGKRPAIDPADTAMLLIDHQSGLFQTVGDMPMPELRL
                     RAAALAKMATLSKLPVITTASVPQGPNGPLIPEIHENAPHAKYVARKGEINAWDNPDF
                     VAAVEATGRKTLIIAGTITSVCMAFPSISAVADGYRVFAVVDASGTYSKMAQEITLAR
                     VVQAGVVPMDTAAVASELQQTWHRDDAQQWAEVYTKIFPAYQLLIESYTKAQDVQKNG
                     EALDSAR"
     misc_feature    complement(199700..200182)
                     /locus_tag="CNE_BB2p01950"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(199868..199870,199970..199972,
                     200165..200167))
                     /locus_tag="CNE_BB2p01950"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    complement(order(200009..200011,200147..200149,
                     200156..200158))
                     /locus_tag="CNE_BB2p01950"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    complement(199880..199885)
                     /locus_tag="CNE_BB2p01950"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            complement(200309..201175)
                     /locus_tag="CNE_BB2p01960"
                     /db_xref="GeneID:10920284"
     CDS             complement(200309..201175)
                     /locus_tag="CNE_BB2p01960"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="YP_004682855.1"
                     /db_xref="GI:339323962"
                     /db_xref="GeneID:10920284"
                     /translation="MKRLLGVYSAPRSHWVGDGFPVRSMFSYQSHARQLSPFLMLDYA
                     GPADFGPTDRPRGVGTHPHRGFETVTVVYKGEVAHRDSTGQGGVIGPGDVQWMTAGAG
                     ILHEEFHSEAFTRDGGPLEMVQLWVNLPARHKLTAPGYQAILDRDIPAVALPDGAGTV
                     RVIAGQYGAHAGPARTFTPMHVWDLRLVQGGVSTLPLPDGWNAALVVLRGRVRINGDT
                     VAGEAQMAVLDRSGASLTLEASTDTVVLLLTGEPIDEPVVGYGPFVMNTEQEIQQALS
                     DFNNGRFVPASA"
     misc_feature    complement(200324..201175)
                     /locus_tag="CNE_BB2p01960"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    complement(200795..201121)
                     /locus_tag="CNE_BB2p01960"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    complement(200327..200632)
                     /locus_tag="CNE_BB2p01960"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            202006..203784
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /db_xref="GeneID:10920285"
     CDS             202006..203784
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 3 large subunit"
                     /protein_id="YP_004682856.1"
                     /db_xref="GI:339323963"
                     /db_xref="GeneID:10920285"
                     /translation="MNMPTLEFRNTPAKPNARAPRVLRGAEMIVEALLAEGVRTVWGY
                     PGGAVLPIYDAIASQTGLEHLLVRHEQAAVHAADGYARASGEVGVALVTSGPGLTNAV
                     TGIATAYFDSIPLVVLSGNVPTTMIGEDAFQECDAVGITRPIVKHNFLISDIGNLAVT
                     LKKAFHLARTGRPGPVLVDIPKDIALASAPFHYPDKVEIRSYRPAVEGHEGQIRHAAQ
                     LLREARRPYLYVGGGAVTAGATVALRELAALADAPVTTTLMALGAFSATDPRYLGMPG
                     MHGTYEANRTMQECDVLVAIGARFDDRVIGNVADFCATPRQIVHIDIDPASIGKRVRP
                     TVPIVGDARRVLEKLTAALREARTPLADRADWWRRIDSWRARRCLAYVRDGQRIKPQY
                     VIETLSRLAGGDAIICSDVGQHQMWAAQHYRFTQPRRWINSGGLGTMGVGLPYAMGVK
                     HAFPERDVIAITGDGSIQMCIQELSTCKQYDLPVKIVSLNNGYLGMVRQLQHVEYERR
                     YSQSYMEALPDFPALARAYGHIGLSVNTEADVEPALRDALAQKTRTVFLDIHVDGSEN
                     VWPMIPGGHGLGEMLLGESTSTDASR"
     misc_feature    202006..203754
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="acetolactate synthase 3 catalytic subunit;
                     Validated; Region: PRK06965"
                     /db_xref="CDD:180780"
     misc_feature    202084..202551
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(202123..202125,202138..202143,202153..202155,
                     202165..202167,202192..202212,202219..202221,
                     202228..202233,202240..202245,202249..202257,
                     202291..202293,202312..202314,202324..202326,
                     202333..202338)
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(202138..202146,202153..202155,202165..202167,
                     202195..202197,202201..202212,202216..202218,
                     202291..202293,202300..202305,202309..202314,
                     202321..202323,202423..202425,202432..202434)
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(202138..202140,202213..202215,202291..202293,
                     202303..202305)
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    202642..203052
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    203167..203727
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
                     module; composed of proteins similar to the large
                     catalytic subunit of AHAS. AHAS catalyzes the condensation
                     of two molecules of pyruvate to give the...; Region:
                     TPP_AHAS; cd02015"
                     /db_xref="CDD:238973"
     misc_feature    order(203236..203247,203314..203316,203320..203322,
                     203395..203403,203410..203412,203476..203478)
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238973"
     misc_feature    order(203305..203307,203314..203316,203320..203322,
                     203407..203412,203416..203421,203440..203442,
                     203557..203562,203572..203574,203581..203583)
                     /gene="ilvI"
                     /locus_tag="CNE_BB2p01970"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238973"
     gene            204121..204828
                     /locus_tag="CNE_BB2p01980"
                     /db_xref="GeneID:10920286"
     CDS             204121..204828
                     /locus_tag="CNE_BB2p01980"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682857.1"
                     /db_xref="GI:339323964"
                     /db_xref="GeneID:10920286"
                     /translation="MSKALTIESTPSTRVETAIEKLREALLRGHFPPGASVREIDVCA
                     LCGVSRTPARSAMLALHSEGLLDYVAQKGYRARRFEMANTQDAYAIRGVVEGLACRLL
                     VERGLAHLVVPRLQALVALGDKLIRNAEKAPFDTAAWSQMNADFHKILLEPMNPVFDE
                     VSGYARRVPHAAPTTTADWRAQPDIDLIKSAQNDHRKIVNALANNEATRAEELMREHL
                     YNAGEVLRRTLDATMAG"
     misc_feature    204148..204822
                     /locus_tag="CNE_BB2p01980"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    204157..204345
                     /locus_tag="CNE_BB2p01980"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(204157..204159,204163..204165,204229..204234,
                     204262..204276,204280..204285,204292..204294,
                     204322..204327,204331..204342)
                     /locus_tag="CNE_BB2p01980"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    204376..204774
                     /locus_tag="CNE_BB2p01980"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(204932..206014)
                     /locus_tag="CNE_BB2p01990"
                     /db_xref="GeneID:10920287"
     CDS             complement(204932..206014)
                     /locus_tag="CNE_BB2p01990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682858.1"
                     /db_xref="GI:339323965"
                     /db_xref="GeneID:10920287"
                     /translation="MESQSGLQNLRPRIYGVLGRPMSGNPKTAALIMHPTSNYMGHYF
                     VGPLAAMNVPCLALNSRYAGNDTLLQMERVILDLGAGIRYLRSRGYQKIILIGSSGGG
                     ALAAFYQSESENLTVHEFIEGGPTGITKDDIPPADGIVLSAAHLGRADIFAEWVDPAV
                     VNEHDLFATNLELDIYEGPIKPPFTSQFIATFRAAQLARRARIEGWVEAEIAALRKRP
                     NGPADRIFIINRTHSDPRMIDLSLDRNDRKWGSVWGDPRTVNYAANAFGRVTSLRAFM
                     SQFSSKSRALGPANLKQTSVPVLLLVHTADASTFPSTRDAWQASAAGRITTVGIEPGN
                     HYLVGQTELVEFGANTIVDWIDKHVR"
     gene            complement(206215..206781)
                     /locus_tag="CNE_BB2p02000"
                     /db_xref="GeneID:10920288"
     CDS             complement(206215..206781)
                     /locus_tag="CNE_BB2p02000"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004682859.1"
                     /db_xref="GI:339323966"
                     /db_xref="GeneID:10920288"
                     /translation="MPIQRFSHVAYRCADARKTVDFYTQLLGLEYAFAVAENYVPSTG
                     QFDPHIHVFLRVSPGSYLAFFELSEAPEMGFDPNTPDWVQHIALHVPRVEEVKSFKEA
                     LETAGIAVLGITDHGIFKSIYFRDPSGHRVEITCESLSDELCEQLGARSKALLDEWSH
                     TRRAPDIGIHRSGSLVGTVNLEDRALRE"
     misc_feature    complement(206377..206769)
                     /locus_tag="CNE_BB2p02000"
                     /note="N-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_N_like; cd08346"
                     /db_xref="CDD:211356"
     misc_feature    complement(order(206752..206754,206758..206760))
                     /locus_tag="CNE_BB2p02000"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211356"
     gene            207085..208368
                     /gene="ttuB"
                     /locus_tag="CNE_BB2p02010"
                     /db_xref="GeneID:10920289"
     CDS             207085..208368
                     /gene="ttuB"
                     /locus_tag="CNE_BB2p02010"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate transporter TtuB"
                     /protein_id="YP_004682860.1"
                     /db_xref="GI:339323967"
                     /db_xref="GeneID:10920289"
                     /translation="MSRTQAVLEPMNAVDRDVLYRKVSRRIVPFLVICFVVAFLDRVN
                     ISYAKFQMQQDLGFGDAVYGLAAGVFAIGYVLFEIPSNLLLARYGARRTFVRIMVCWG
                     LVSMAMMFVTEPMHFYVLRVLLGVFEAGFYPGLMLYLAYWFPTRHYAKAVSWFIAGSS
                     IAGLIGGPLSGWIMRDMAGVLGLHGWQWMFFLEALPAIFLGAVAYFHVSDNPGTARWL
                     SAEEKAALARDLAAENHTHANARSHSFRAALRNPIIYIFAAIYFTVNCAAYGLVLWLP
                     SLVHATGVGSVLEVGLLSAIPNVVGAVGIIVLCRHSDATGERRWHFLTSASIGALALL
                     TLTVATRSLPLTIIALSVAVIATYALLPIFWATPHVFLAGSAAAGGLALISSIGQLAG
                     FVSPYVMGLTKAHTASFSLGLSLMAIVRKREICRT"
     misc_feature    207145..208335
                     /gene="ttuB"
                     /locus_tag="CNE_BB2p02010"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    207166..208341
                     /gene="ttuB"
                     /locus_tag="CNE_BB2p02010"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(207208..207210,207217..207225,207229..207234,
                     207283..207285,207292..207297,207304..207306,
                     207316..207321,207325..207330,207466..207471,
                     207478..207483,207490..207495,207502..207504,
                     207538..207543,207550..207555,207571..207573,
                     207877..207879,207886..207891,207898..207903,
                     207910..207912,207952..207954,207964..207966,
                     207976..207978,207985..207987,207997..207999,
                     208144..208146,208153..208158,208165..208167,
                     208177..208182,208189..208191,208222..208227,
                     208234..208239,208246..208251,208258..208260)
                     /gene="ttuB"
                     /locus_tag="CNE_BB2p02010"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            208425..208913
                     /locus_tag="CNE_BB2p02020"
                     /db_xref="GeneID:10920290"
     CDS             208425..208913
                     /locus_tag="CNE_BB2p02020"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911"
                     /protein_id="YP_004682861.1"
                     /db_xref="GI:339323968"
                     /db_xref="GeneID:10920290"
                     /translation="MDQSDLDCLPLRAINVGANGKRSFDKGDKRRLVEACLQPGVSVA
                     GMAIKAGVNANQLRRWIEQHKAEQKDADGTMDAIESAPAAFVPVVEVHAAGPKAGAEL
                     PTVPEPLPVRTLQPPQPLPARLVARLPNGVSVELECSGQDATLVMATIEALGRCHVPA
                     RR"
     misc_feature    208479..>208622
                     /locus_tag="CNE_BB2p02020"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    208482..>208682
                     /locus_tag="CNE_BB2p02020"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            208894..209247
                     /locus_tag="CNE_BB2p02030"
                     /db_xref="GeneID:10920291"
     CDS             208894..209247
                     /locus_tag="CNE_BB2p02030"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 Orf2-like protein"
                     /protein_id="YP_004682862.1"
                     /db_xref="GI:339323969"
                     /db_xref="GeneID:10920291"
                     /translation="MFRLDADLQVYLHRNAVDFRLGINGLVALVEQSMQHDPFARAVY
                     AFHNRRRNRIKLLLWDRNGFWLLLKRLEEDRFVWPRRQQAVIELTTEQLHWLLDGIDV
                     DAVQRHPSRKYQHTG"
     misc_feature    208909..209226
                     /locus_tag="CNE_BB2p02030"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:253347"
     misc_feature    <208912..>209196
                     /locus_tag="CNE_BB2p02030"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     gene            209273..210910
                     /locus_tag="CNE_BB2p02040"
                     /db_xref="GeneID:10920292"
     CDS             209273..210910
                     /locus_tag="CNE_BB2p02040"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS66"
                     /protein_id="YP_004682863.1"
                     /db_xref="GI:339323970"
                     /db_xref="GeneID:10920292"
                     /translation="MDVGCTIVFSMNEHDLSQLPPAAQAYIRELEARAAANAQHIAEL
                     NERIGLLEEQFRLAQSKRFAPSSEKLKDRVFDEAEQMAAAEPADDDEDEVLALPDTGL
                     PEPDKPAGRKRGRKPLPAELPRQRIEYDLTEDQKICPCCRGALHRMGEEVSEQLHIEV
                     KASVLQHVRFKYACRHCERNAERTPVVTAPMPAQPLPGSNASPAMLATVTTGKYVDGT
                     PLYRMEDALGRAGIEVGRGTLANWIIRPAQLHYSRLYEALRRSLLSQPLIHGDETTVQ
                     VLKEEGKAAQSKSYMWVYRSAEDSEQPVVLFDYQPGRGQEYPQAFLAGYHGMLMTDGY
                     KAWRTLEGVTHFGCVAHARRMFVDAQKGQKKPSARVLKALESFQALYQVETLAKAELP
                     EGETRVDYTYRMRQQHSVPLLEALKAWLDQQAPQVLPESLLGKAIAYARNQWEYLSRY
                     VTDGRAPVDNNAIERDIRPFCTARKAWLFADTVAGAKASAMIYSLMLTCRACDVEPYA
                     YLLHVLTELPQRAPDADISDLLPFNFARRQTAPPHPA"
     misc_feature    209420..209653
                     /locus_tag="CNE_BB2p02040"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:257454"
     misc_feature    209603..210097
                     /locus_tag="CNE_BB2p02040"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    209672..209806
                     /locus_tag="CNE_BB2p02040"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     misc_feature    209864..210736
                     /locus_tag="CNE_BB2p02040"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    210752..210871
                     /locus_tag="CNE_BB2p02040"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:258097"
     gene            complement(210991..211266)
                     /locus_tag="CNE_BB2p02050"
                     /db_xref="GeneID:10920293"
     CDS             complement(210991..211266)
                     /locus_tag="CNE_BB2p02050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682864.1"
                     /db_xref="GI:339323971"
                     /db_xref="GeneID:10920293"
                     /translation="MKECRMAQTTAQRQAAYRARRGTAGKDGNGERRLDMWVSTEADL
                     ALARLAHRYAVTKRQMLERLIARADDAIVRRLDPDSEQWDLYFNVPR"
     gene            complement(211384..211605)
                     /locus_tag="CNE_BB2p02060"
                     /db_xref="GeneID:10920294"
     CDS             complement(211384..211605)
                     /locus_tag="CNE_BB2p02060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682865.1"
                     /db_xref="GI:339323972"
                     /db_xref="GeneID:10920294"
                     /translation="MDCAAVGVGTAQFFRRQGKRNKLPRVADDFIDAGYAPAAVTTPV
                     NGDAATNTRPGTMPNHLAQPAQPLFSREE"
     gene            211936..212052
                     /locus_tag="CNE_BB2p02070"
                     /db_xref="GeneID:10920295"
     CDS             211936..212052
                     /locus_tag="CNE_BB2p02070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682866.1"
                     /db_xref="GI:339323973"
                     /db_xref="GeneID:10920295"
                     /translation="MLAGRQRLDARAALARAYGHVGVPVSTEAEVQTGGVHA"
     gene            complement(212111..212899)
                     /locus_tag="CNE_BB2p02080"
                     /db_xref="GeneID:10920296"
     CDS             complement(212111..212899)
                     /locus_tag="CNE_BB2p02080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682867.1"
                     /db_xref="GI:339323974"
                     /db_xref="GeneID:10920296"
                     /translation="MVESDPQQDQTKPSYPIASVDKALRLLRSFTDRGAIRVAEASRD
                     LDVARSTAHRLLEMLQHHEFVQQDPVSRAYVPGPALLKIGLSVVRNLDVRAVARPVIE
                     ALVDEVQESAHLVILSGRDMLIIDAVESPRMLRIGSRLGGTIPAHAAAGGRAMLATLS
                     DERIKELYPTEELKAVTPDTLTSRKDLLSELEQVRARGYAVSVAEVEPDVSTVAATIP
                     GSARTTPAAITISVPRSRVKRDDLPRLGKAAVSAALRVADRMAL"
     misc_feature    complement(212582..212851)
                     /locus_tag="CNE_BB2p02080"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(212120..212845)
                     /locus_tag="CNE_BB2p02080"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(212135..212506)
                     /locus_tag="CNE_BB2p02080"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            213089..214498
                     /gene="mtaD2"
                     /locus_tag="CNE_BB2p02090"
                     /db_xref="GeneID:10920297"
     CDS             213089..214498
                     /gene="mtaD2"
                     /locus_tag="CNE_BB2p02090"
                     /EC_number="3.5.4.28"
                     /EC_number="3.5.4.n1"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methylthioadenosine/S-adenosylhomocysteine
                     deaminase MtaD"
                     /protein_id="YP_004682868.1"
                     /db_xref="GI:339323975"
                     /db_xref="GeneID:10920297"
                     /translation="MTFTRKILRGGHIVSMDPNIGELVGDVLIEGDTIAAIGPDLNIA
                     DGSAEVIDASRHIVLPGFIDSHRHLFQALLRGLASDWSLFQYFVSMFGMLAPTMTPED
                     MYLGTTLGALDALDAGVTGVFDYSHNQSTPEHTDAAIRALRNAGIRAVFGYGGSMAEQ
                     AEILVPPFKSATLSNQAEIRRIRRQYFSSDSGLLTLGMGARGPDSSTMDVVRADWALA
                     RELGIRINIHIGMAALDLGSRPNVTRLCKEGLLGDDLIFSHCNLLTDDEFRMMADAGV
                     SATVTPEDECAMGHGWPPIAGLLKAGIRPNIGIDTCMAVGGDPFTAMRFALAVPRGLD
                     NQTMLEAHENPWALKLTARDVLEFATIEGARAIGQEATTGSLTPGKQADIVMIRSDHI
                     SMIPAIDPIASIVHHASRHTVDHVYVAGTAVKRDGKLLGTDMAELNRRAVAASDQILR
                     RAGVQRGWAPKQPQPHHAS"
     misc_feature    213098..214456
                     /gene="mtaD2"
                     /locus_tag="CNE_BB2p02090"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08204"
                     /db_xref="CDD:181288"
     misc_feature    213107..214378
                     /gene="mtaD2"
                     /locus_tag="CNE_BB2p02090"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(213284..213286,213290..213292,213770..213772,
                     213863..213865,214016..214018)
                     /gene="mtaD2"
                     /locus_tag="CNE_BB2p02090"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            214603..215088
                     /locus_tag="CNE_BB2p02100"
                     /db_xref="GeneID:10920298"
     CDS             214603..215088
                     /locus_tag="CNE_BB2p02100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682869.1"
                     /db_xref="GI:339323976"
                     /db_xref="GeneID:10920298"
                     /translation="MTESARASDYAISRAHIEDTVARFVLALDSRDIDRAVACLAPRV
                     RWDYASVTGQPAAEFDAGALADRWRSSIVHTDASQHFLSMPYIGLSGDRATCVVHAQV
                     TVRLANRIGSHHLRTHGTYTFGLVRTDADWSIDAVAMAQLWSDGNPRIMELAAAGGVR
                     R"
     misc_feature    214651..215004
                     /locus_tag="CNE_BB2p02100"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cd00531"
                     /db_xref="CDD:238296"
     gene            215085..215453
                     /locus_tag="CNE_BB2p02110"
                     /db_xref="GeneID:10920299"
     CDS             215085..215453
                     /locus_tag="CNE_BB2p02110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682870.1"
                     /db_xref="GI:339323977"
                     /db_xref="GeneID:10920299"
                     /translation="MNPTHHAANSSLNRPLFVIFSDPGERPGELAQHIPAHIEYMVGL
                     EKRGALFMSGPFLDTSGEPAPSGMWIVRAASREQAHALAAGDPFHVSGARAFRVEAWQ
                     VHQGRIEMSIDLSDQKIHLS"
     misc_feature    215127..215396
                     /locus_tag="CNE_BB2p02110"
                     /note="YCII-related domain; Region: YCII; cl00999"
                     /db_xref="CDD:260739"
     gene            215520..216413
                     /locus_tag="CNE_BB2p02120"
                     /db_xref="GeneID:10920300"
     CDS             215520..216413
                     /locus_tag="CNE_BB2p02120"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase protein"
                     /protein_id="YP_004682871.1"
                     /db_xref="GI:339323978"
                     /db_xref="GeneID:10920300"
                     /translation="MNQQTRTHTVGLIAPGKIGLPFAANLVADGNAVWGYRRGSLAEF
                     EAIGGMAARSPQEVAEKAEIVFTCVSSADALDEVISGPHGLLAAGRSDLLVVDIGAMA
                     LGRKLSARETLRRAGIEMLDAPVSGTPPMVSARKGVVFASGEQTACERVRPLLTALGS
                     TVVYAGAFGAGSKLKFVANTLVAVHTAAAAEAMALAKAVGLDPKLVLDTIRPSAASST
                     MFNIRAPMMAEGRSRPVNGTVTGLVDVMDAILATADDAGAAMPLLNTAKRLYERACED
                     GYGAEDIAVMVKVLESLAVPA"
     misc_feature    215544..216392
                     /locus_tag="CNE_BB2p02120"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    215544..216011
                     /locus_tag="CNE_BB2p02120"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    216024..216389
                     /locus_tag="CNE_BB2p02120"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            216463..217416
                     /locus_tag="CNE_BB2p02130"
                     /db_xref="GeneID:10920301"
     CDS             216463..217416
                     /locus_tag="CNE_BB2p02130"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004682872.1"
                     /db_xref="GI:339323979"
                     /db_xref="GeneID:10920301"
                     /translation="MSLETDFSPNIFPKARQPSTRALGLGIHRTGHVALRAPDPSAAA
                     EFAVSQLGFTLAGHDDEGRYYLSAAGPDPYSLVYTPGQGGLDHISYIVADHAALDEAA
                     ARLADANIPVTRHEPSLWSPGASLRFSTPAGHTLELTTGLITDVPIAATTLRPASASG
                     PIVCDHVVVRCSDLQAEMAFASRTLGLMESARIETPDATPVMTFFRASRLYHCLAVAQ
                     SPSNGLHHVQFTLKDGAAVFEAWEKMRSESRVELLWGPVRHGPGHNIACYFRDHVGHV
                     IEYSAEEEVIFDDEAYSPMRWSVEDPRSLDEWGTRPPESML"
     misc_feature    216538..217407
                     /locus_tag="CNE_BB2p02130"
                     /note="catechol 2,3 dioxygenase; Region: catechol_2_3;
                     TIGR03211"
                     /db_xref="CDD:234146"
     misc_feature    216538..216876
                     /locus_tag="CNE_BB2p02130"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(216556..216558,216568..216570,216649..216651,
                     216691..216693,216697..216699,216721..216723,
                     216841..216843,216865..216867,216871..216873)
                     /locus_tag="CNE_BB2p02130"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(216556..216558,216721..216723,216871..216873)
                     /locus_tag="CNE_BB2p02130"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     misc_feature    216955..217353
                     /locus_tag="CNE_BB2p02130"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(216958..216960,216970..216972,217066..217068,
                     217105..217107,217111..217113,217138..217140,
                     217264..217266,217288..217290,217294..217296)
                     /locus_tag="CNE_BB2p02130"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(216958..216960,217138..217140,217294..217296)
                     /locus_tag="CNE_BB2p02130"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            217413..218351
                     /locus_tag="CNE_BB2p02140"
                     /db_xref="GeneID:10920302"
     CDS             217413..218351
                     /locus_tag="CNE_BB2p02140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682873.1"
                     /db_xref="GI:339323980"
                     /db_xref="GeneID:10920302"
                     /translation="MTQEHFQEGTGGRLPWRLGTVASDGRPVTVVETAGTLYLLEELI
                     ARTGTPAPAQTAVRDVIEQWDTWRPILTKLAGSSAAARPLERDRLDWLPAIPNPGKIV
                     CVGVNYRDHLAEMGSGAVRPERPFAFIKPRNTLLGHRQTLWLPPVTRKVDWEAELAII
                     IGRKAFQVAAQDAWNVVAGYCPFNDISARDWISDLVPGLGQDWILHKSFDGFGPLGPL
                     ITPAEFVRDPQDLAIRLSVNGEVRQDSSTANMVFDIASVIEYFSSVMTLMPGDIIATG
                     TPAGVGHGRGEYLKDGDRISLSIECLGELDTLVRRR"
     misc_feature    217521..218345
                     /locus_tag="CNE_BB2p02140"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    217710..218342
                     /locus_tag="CNE_BB2p02140"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            218446..220173
                     /locus_tag="CNE_BB2p02150"
                     /db_xref="GeneID:10920303"
     CDS             218446..220173
                     /locus_tag="CNE_BB2p02150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682874.1"
                     /db_xref="GI:339323981"
                     /db_xref="GeneID:10920303"
                     /translation="MKRNAARAIWRRASPRRRILRARPTAIVTPVFAAVAMTVASVAN
                     AFEFDTGNEDLKARWDNTLKYSVAQRLGRPSGALTADANLDDGDRNFRQYGLISNRVD
                     LYSEFDLRYRDVGMRVSGAAWYDQVYNRPNDNNSPGTANAASVSSNHFPDATERLHGR
                     KADLLDLFAFGKAEIGDMSATGRLGKHTLLYGESLFFGNNGIAAAQSPVDLIKLLSVP
                     NTPFKEVIRPVPQISGQLQLSPNVAVGGYYQASWERDRLPGVGSYFSQVDILDAGGER
                     ILAGPNAIIPGGSPFYLARVGDLKAKNSGQGGVQLRLRPEGGDMEFGFYAARFHAKSP
                     VVYAFPGAGFNPVSGQVGAYQLVFPQDIKVYGASVTTTLADVNVSAEASIRRNMPLVP
                     HGGSVAVPVGVSADNAGNPLYPVGGTAHAQLSWVALLAPSALWQGGSFLGEIAWNRRL
                     SVDGNAATLDPNASRDATAIRMVFQPSYFQVFDGVDLSVPIGIGYGLSGKSSVIHPGF
                     GARHAGDLSIGVLGDYLKVWKFSLNYTHYFGSADGVLTPANAAVQNYSYAQSLRDRDF
                     VSLSISRTF"
     misc_feature    218581..220170
                     /locus_tag="CNE_BB2p02150"
                     /note="Protein of unknown function (DUF1302); Region:
                     DUF1302; pfam06980"
                     /db_xref="CDD:254001"
     gene            220194..221567
                     /locus_tag="CNE_BB2p02160"
                     /db_xref="GeneID:10920304"
     CDS             220194..221567
                     /locus_tag="CNE_BB2p02160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682875.1"
                     /db_xref="GI:339323982"
                     /db_xref="GeneID:10920304"
                     /translation="MKSSNMYLRAALCGMLAVSQLAGAAVPPEEAAKLKTTLTPFGAE
                     RAGNKDGTIPAWTGGYAEVPPGYKSGAPRPDPFSAEKALFSISAKNLDKYADKLSDGV
                     KALLKKYPDSYRLDVYPTHRTAAAPQWVYDNTYRNATRATTTGRGIGLEGAFGGIPFP
                     IPKDGFEAMWNHKLRWMGETTAFTGANYLGTADGKSVLAARVVNKTQNPYYDKSGSLE
                     GFKGANQLLRIFMTDPPFKSGEQYLIVDSINKPRQAWQYLTGQRRVRKAPTIGYDTPD
                     DVNSGQSYYDEAFVFYGDLDRYDWKLVGKREIYVPYNNNKYYQKTPIGQRLMAHHVNP
                     DLVRWELHRVWVVEASLAQGQRHVVHKRRFYLDEDTWAALMGEGWDAEGQLWRVQIQL
                     PLIVPEGPFIYTGGQISVFNLLAGSWVSMGDTDWENASTSSYLKLLDRLPATYFTPEA
                     VAGEGVR"
     misc_feature    220446..221552
                     /locus_tag="CNE_BB2p02160"
                     /note="Protein of unknown function (DUF1329); Region:
                     DUF1329; pfam07044"
                     /db_xref="CDD:254034"
     gene            221645..222766
                     /locus_tag="CNE_BB2p02170"
                     /db_xref="GeneID:10920305"
     CDS             221645..222766
                     /locus_tag="CNE_BB2p02170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682876.1"
                     /db_xref="GI:339323983"
                     /db_xref="GeneID:10920305"
                     /translation="MRTRSLALCIAAVACTVGMGLSGATAPARAGGPADVLERQALRS
                     VLAPASLMLAVTRAGERLVAAGERGIVLLSDDNGRSWRQAGVPVSVTLTSVFFASRTQ
                     GWAVGHGGVILHSDDGGETWSKQLDGVRAAQLVLAAAQAAVADTGATTGDRSTRRLRD
                     AERLVADGPDKPLLDVYFANEREGLVVGAYGLAFSTEDAGKHWQPADDRLVNPEGRHL
                     YRIRAVGSDLYLAGEQGALYRSRDGGRHFTGIKTNYPGSYFGMVTGPRDDLLIFGMRG
                     NLYRTQDAGLNWRQIDSGRTAALTDGIRASDGAILIVDGDGGLMRSIDDGKTFRNIPT
                     GIAGPINSIAQAADGSLILAGLRGVARLPLDKIRTGVEP"
     misc_feature    221654..222721
                     /locus_tag="CNE_BB2p02170"
                     /note="Uncharacterized protein related to plant
                     photosystem II stability/assembly factor [General function
                     prediction only]; Region: COG4447"
                     /db_xref="CDD:226855"
     misc_feature    221840..>222016
                     /locus_tag="CNE_BB2p02170"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     misc_feature    222152..>222631
                     /locus_tag="CNE_BB2p02170"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     gene            222763..225249
                     /locus_tag="CNE_BB2p02180"
                     /db_xref="GeneID:10920306"
     CDS             222763..225249
                     /locus_tag="CNE_BB2p02180"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_004682877.1"
                     /db_xref="GI:339323984"
                     /db_xref="GeneID:10920306"
                     /translation="MKRVDTSSGQGRPDVSGLDASSGSLLERLLFNHRRVVVALCVLA
                     TLLLGYRATGLQLNAAFEKMIPTSHPFIAAYLENRQELSGLGNTLRIAVENTKGDIFD
                     ASYLETLRRINDEVFLLPGVDRSYVKSLWTPSTRWLGVTEEGLEGGPVIPNTYDGSAA
                     SLTELRANIERSGQVGQLVAANLRSSVIVVPLLDVDAHGQRLDYHEFSGKLERLRHKY
                     ENGSIRLHITGFAKVVGDLIEGLKHVVLFFGLAIAVCAGVLYWHTRCMRSTVLVVFCS
                     LLSVVWLLGLLSLLGYELDPYSILAPFLVFAIGMSHGAQKMNGIMQDIGRGLHRLTAA
                     RLTYRRLFVAGLTALLADAVGFAVLMVIRIQVIHDLAVAASLGVAVLIFTNLVLLPIL
                     LSYVGVNPEAALRSLRGDSASAGSADAGAVVAPRKHAFWAFLDRFTQRKWAALALGIA
                     MALGAASFIVRLDLKVGDLEPGAPELRRDARYNRDTAFMVANYAASSDTYVVMVRTPQ
                     FQCSRFSTLSLVDDLEWKLRQLPGVDGTSSFASLAKTAAVGMNEGSFKWHDVPRTQDM
                     LNAITTRAPREMFNQNCDLLTIYVYLRDHKSDTLDAVVKVVDQFGQTNNTADLKFLSA
                     AGNAGIEAATNIVVRQANGQMLLLVYAAVILLAFVTFRSWRAVLCAVIPLMLTTILTE
                     ALMVKLGIGVKVATLPVIALGVGIGVDYALYVLAVTLAELRQGNSLSASYYRALLFTG
                     KVVVLTGVTLAIAVATWMLSPIKFQADMGILLAFMFIWNMLGALILLPALACFLFPHA
                     SSEARVPAGATASSSSGRFRMGRGGPMDMN"
     misc_feature    222838..225162
                     /locus_tag="CNE_BB2p02180"
                     /note="Predicted exporters of the RND superfamily [General
                     function prediction only]; Region: COG1033"
                     /db_xref="CDD:223964"
     misc_feature    <223732..223953
                     /locus_tag="CNE_BB2p02180"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <224656..225213
                     /locus_tag="CNE_BB2p02180"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            225287..226276
                     /gene="nagI"
                     /locus_tag="CNE_BB2p02190"
                     /db_xref="GeneID:10920307"
     CDS             225287..226276
                     /gene="nagI"
                     /locus_tag="CNE_BB2p02190"
                     /EC_number="1.13.11.4"
                     /codon_start=1
                     /transl_table=11
                     /product="gentisate 1,2-dioxygenase oxidoreductase protein
                     NagI"
                     /protein_id="YP_004682878.1"
                     /db_xref="GI:339323985"
                     /db_xref="GeneID:10920307"
                     /translation="MKPGQAGEPEALAQRTEALHLLPGWFRRPTPLLWREMRSHCVPA
                     HWRYQEVRECLRQAAHEVSTEEAERRNLILRNPIPDNDHSTLRTLICAYQTMLPGERA
                     KSHRHSPHAMRVILESRGAYSIVDGHKHPMESGDIVLTPGGSWHGHGHEGSEQAFWLD
                     GLDVPLTHLLEPMFYEPHPDQWERVAQETTHSPMRFAWTDTMAALDRAEPDPTGHFGT
                     TITLPTPMMPTVTLKVCRWPANWANRPYRHTANTVYVVMRGSGRSEVGELEVDWSFGD
                     TFVAPAWSRVSHHATDDSVICTISDEQLMHWARYYRVEDLGRGEMPLPLQANP"
     misc_feature    225308..226201
                     /gene="nagI"
                     /locus_tag="CNE_BB2p02190"
                     /note="Gentisate 1,2-dioxygenase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG3435"
                     /db_xref="CDD:225969"
     misc_feature    225560..225766
                     /gene="nagI"
                     /locus_tag="CNE_BB2p02190"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            226301..227161
                     /locus_tag="CNE_BB2p02200"
                     /db_xref="GeneID:10920308"
     CDS             226301..227161
                     /locus_tag="CNE_BB2p02200"
                     /EC_number="5.3.3.10"
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate
                     delta-isomerase"
                     /protein_id="YP_004682879.1"
                     /db_xref="GI:339323986"
                     /db_xref="GeneID:10920308"
                     /translation="MYLCRFDDDRLGVVEADTVFDVTPALEVLPTHRYPLPRVDPLIA
                     NLAAVRERIAGLRDGAPRLRLADVELLCPVANPGKIIAAPVNYVDHLHEGLSQPEIHH
                     GNKINEISQAGLFLKATSSLVGPSHGVFIQHPERRNDHEIELVAVIGKSGRNIPQADA
                     LSYVAGYCVGLDMTVRGPEERSMRKSIDSYSVVGPWLATADAVADPSNLTLSVTVNGE
                     HRQRENTSNLIMGIAQLIAFASSFYTLYPGDILFTGTPAGVGPVKSGDRLTASVEGVG
                     RMEVKVGLAR"
     misc_feature    226445..227137
                     /locus_tag="CNE_BB2p02200"
                     /note="4-hydroxyphenylacetate degradation bifunctional
                     isomerase/decarboxylase, C-terminal subunit; Region:
                     HpaG-C-term; TIGR02303"
                     /db_xref="CDD:131356"
     misc_feature    226535..227146
                     /locus_tag="CNE_BB2p02200"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            228011..228832
                     /locus_tag="CNE_BB2p02210"
                     /note="transposase"
                     /pseudo
                     /db_xref="GeneID:10920309"
     gene            complement(229237..229830)
                     /gene="retA"
                     /locus_tag="CNE_BB2p02240"
                     /note="RNA-directed DNA polymerase RetA; reverse
                     transcriptase"
                     /pseudo
                     /db_xref="GeneID:10920310"
     gene            complement(229838..231142)
                     /locus_tag="CNE_BB2p02250"
                     /db_xref="GeneID:10920311"
     CDS             complement(229838..231142)
                     /locus_tag="CNE_BB2p02250"
                     /codon_start=1
                     /transl_table=11
                     /product="prophage lambdaSa1 transcriptase/maturase family
                     protein"
                     /protein_id="YP_004682880.1"
                     /db_xref="GI:339323987"
                     /db_xref="GeneID:10920311"
                     /translation="MSEIPVHPRPRRLSDWINPMEARKVHSLIDKVYQRKNLEVAWER
                     VRANRGSGGIDGISVAAFAEQADQQLGRLQAELRAQTYQPQPVRQVSIPKVGKPGEFR
                     KLGIPSIYDRVCQQALLNRLEPVFEPIFDDANFGYRRGRSTHDALRKIWKEIEAGGEW
                     IVDADLKDFFGSVDHDKLLALIARRVADGRVLGLIKAMLKAGSFGQGRLFPSERGTPQ
                     GGVASPLLSNILLTPFDREMRRRGYQLTRYADDWVITCSSRAEAHAAIAAATKILTAL
                     GVQLHPEKTRIVQVQFGFEFLGYKIKRGRRLSLPAAKIRSGARSGALYAYPREKSIQR
                     LMDQVRRLTKRCIPLRTRDLIARLNPILRGWGHYYKRSHVRRIFNRLDRWIVRRIWSH
                     RFKRWRNRGWKLMTEARLYGDLGLVNLVGLIPSIASQHAASS"
     misc_feature    complement(230240..230881)
                     /locus_tag="CNE_BB2p02250"
                     /note="RT_G2_intron: Reverse transcriptases (RTs) with
                     group II intron origin. RT transcribes DNA using RNA as
                     template. Proteins in this subfamily are found in
                     bacterial and mitochondrial group II introns. Their most
                     probable ancestor was a retrotransposable...; Region:
                     RT_G2_intron; cd01651"
                     /db_xref="CDD:238828"
     misc_feature    complement(230240..230869)
                     /locus_tag="CNE_BB2p02250"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:249567"
     misc_feature    complement(order(230249..230254,230390..230395,
                     230399..230401,230486..230491,230633..230650))
                     /locus_tag="CNE_BB2p02250"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    complement(order(230393..230395,230489..230491,
                     230633..230650))
                     /locus_tag="CNE_BB2p02250"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    complement(230486..230488)
                     /locus_tag="CNE_BB2p02250"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    complement(229934..230149)
                     /locus_tag="CNE_BB2p02250"
                     /note="Group II intron, maturase-specific domain; Region:
                     GIIM; pfam08388"
                     /db_xref="CDD:254769"
     gene            231414..232550
                     /locus_tag="CNE_BB2p02260"
                     /db_xref="GeneID:10920312"
     CDS             231414..232550
                     /locus_tag="CNE_BB2p02260"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902"
                     /protein_id="YP_004682881.1"
                     /db_xref="GI:339323988"
                     /db_xref="GeneID:10920312"
                     /translation="MNTTPNTALHGQNTTITGWLYMAFELGDKSWKLSLGDGVLGPSR
                     HTLGAGDLNAVLQVIAKAKARCGLAPQAPVRSCYEAGRDGFWLHRWLIEQGIANLVVD
                     SASIEVNRRARRAKTDRVDGDKLLSMLMRYYAGERRLWAVARVPTPQQEDERRLHREL
                     GRLRLERAAHSNRIRSLLVLHNLRVAHIGDRSWKHWWNAHGSQLPAGLSAEIEREVAR
                     LALVETQIKTIETQQRDAVKAGTQPAIALLARLRGIGLGSSWLLINELFGWRRFHNRR
                     EVAGCLGLAPTPYSSGESQVEQGISKAGNKRSRWLMIELAWAWLRYQPTSQLTQWFNE
                     RFARGSKRMRRVGIVAVARRLAIALWRYLEYGEIPHGASLKSVH"
     misc_feature    231612..232502
                     /locus_tag="CNE_BB2p02260"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    <231624..231932
                     /locus_tag="CNE_BB2p02260"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    232149..232394
                     /locus_tag="CNE_BB2p02260"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(233751..234791)
                     /locus_tag="CNE_BB2p02270"
                     /db_xref="GeneID:10920313"
     CDS             complement(233751..234791)
                     /locus_tag="CNE_BB2p02270"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682882.1"
                     /db_xref="GI:339323989"
                     /db_xref="GeneID:10920313"
                     /translation="MLKASHCLKSQLTIALLTCLGASATAHAANGGVRLYGLIDTYIG
                     SIKPSGTAYSSWQLDNGGETTPFWGMSGEEDLGGGLSTVFALESFFRSDTGEAGRSAT
                     DSFFARSAYVGLSSDKFGELRLGRNSTPLLYLTTLFNPFAGSTRFSPLNVQNWTPNFG
                     RLIHGDTGWSNAARYISPTMAGFSVQLIYGLGEAANNNGTNNVGGFIRYQGGPLDVAV
                     GGNHTKTGTAITAFEPSQKVMFAGASYDFKVLKLFGTFNMTKNGQSELRTYTYQAGVS
                     APLGPGQLNASYVWTKNDRKTLADFNRTTAGIGYSYNFSKRTDVYANYLYDKLTTAAT
                     GNTFGVGLRHKF"
     misc_feature    complement(233754..234695)
                     /locus_tag="CNE_BB2p02270"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(233754..233756,233760..233762,
                     233766..233768,233838..233840,233847..233852,
                     234279..234284,234309..234311,234414..234422,
                     234450..234464,234468..234473,234513..234524,
                     234528..234530,234534..234542,234546..234548,
                     234564..234578,234663..234671,234675..234677,
                     234693..234695))
                     /locus_tag="CNE_BB2p02270"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(234309..234311,234375..234377,
                     234468..234470,234591..234593,234678..234680))
                     /locus_tag="CNE_BB2p02270"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(234964..235902)
                     /locus_tag="CNE_BB2p02280"
                     /db_xref="GeneID:10920314"
     CDS             complement(234964..235902)
                     /locus_tag="CNE_BB2p02280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682883.1"
                     /db_xref="GI:339323990"
                     /db_xref="GeneID:10920314"
                     /translation="MKIIAYAEGGATALGVITSPTHYVAVSDIAPELPTGLIAILELE
                     HGLARLRDAAQGVQGDRALAAVTLKPFLDRPNAMWALALNFKSHVAETGLQTNADYPH
                     LFMRMPASYVGADEPIVAPPESIARAFDYEGELAVIIGKPGRYIPAQRAMEHVAGYTC
                     LNEGSVREYQVHNRQFGLGKNFEASGSYGPWLMTSDEFGDPAKHAVLTRINGVVRQRA
                     PLDDMLFDVARVISYLSQGYKLRPGDLIAMGTPGALKPQPDDVEGRDMSRQYGLFKVP
                     GLVHMRPGDQVEVEIDGLGILRNPVVRDEAYRGSTQ"
     misc_feature    complement(234994..235800)
                     /locus_tag="CNE_BB2p02280"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    complement(234997..235674)
                     /locus_tag="CNE_BB2p02280"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            236489..236806
                     /locus_tag="CNE_BB2p02290"
                     /db_xref="GeneID:10920315"
     CDS             236489..236806
                     /locus_tag="CNE_BB2p02290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682884.1"
                     /db_xref="GI:339323991"
                     /db_xref="GeneID:10920315"
                     /translation="MSEVVAAEPAADIENAREEWEREIPGLLELMDPDVPGMHATTSI
                     DFVVVLSGAITLELDSGVATVLHAGDTLVQNGVRHRWMNHGTERAWIAAVVLGTELST
                     RKT"
     misc_feature    <236624..236755
                     /locus_tag="CNE_BB2p02290"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            237011..238246
                     /locus_tag="CNE_BB2p02300"
                     /db_xref="GeneID:10920316"
     CDS             237011..238246
                     /locus_tag="CNE_BB2p02300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682885.1"
                     /db_xref="GI:339323992"
                     /db_xref="GeneID:10920316"
                     /translation="MTAGKIIIDQANDFDAADGSARDEIRRFAGDGGTDRSRRGLLKL
                     AGIGGASMILGGRAHAASGIEGERDGARVFDPNRHGKVHTLPSTPETVRVGEMDPAVQ
                     SVLEIESGDVVHYQNTWVHWGNEAKFGMSFAERNVIRKRYPQGPQSLVGPVSIKGAVP
                     GDVIECRMIRLRPIDWGWNSTVRGMGALPGDFQEPYLHYFRFDAERRFAEFAPGVLIP
                     LAPTQGAIAAQPAGDKPTSALLLGAYGGNLSLASLVEGTSLFVSVEVPGAKMWTGDSN
                     AAQGDGVVNQTGIESAMEDLRIQYVLHKRVALNAPLAETPTHWIVLGAGPTLEEALTA
                     ALRQMIGWISAATALSWHDVYALCSIEGSFRVTQYANQTNSNYSFPSPKVIHATLPKR
                     IFSAERQTKISRSLRPQNS"
     misc_feature    237263..238192
                     /locus_tag="CNE_BB2p02300"
                     /note="Acetamidase/Formamidase family; Region: FmdA_AmdA;
                     cl19826"
                     /db_xref="CDD:268179"
     gene            238274..239548
                     /gene="pcaK2"
                     /locus_tag="CNE_BB2p02310"
                     /db_xref="GeneID:10920317"
     CDS             238274..239548
                     /gene="pcaK2"
                     /locus_tag="CNE_BB2p02310"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate transporter PcaK"
                     /protein_id="YP_004682886.1"
                     /db_xref="GI:339323993"
                     /db_xref="GeneID:10920317"
                     /translation="MISLRQDMEAAKAGVAPLASDGTQHLQWRIYILCGLVAFLDGFD
                     TQSIGPAADAIAASIGIDIKDFGPVFSASQIGFLIGAMIFSALGDRFGRKRMLVAGTL
                     IIAISSLGTAFASSYNELIVIRIVAGLGLGGVTPNFISLASEFSPLVLRARVVTMLWA
                     AVPLGGMVGSFVSSVTLSRFGWQAIFLLGCGAPLLLVPALVFLLPESREVQRGANDNG
                     AAQLRVSPIRTLFGEGRGLATLWLWLASWMTWALLVVIGVWTPSLLQRAGWTIAMAAS
                     MLGLLNAGGVAGTFLIGAALKFVSPQRALMLALIAATASIVMLGAFTHSFAVVAVAAG
                     LAGFFSSAAGGSLLALSASLYPEHVRATGVGWSLGFARTGAVLGPVCVGLLVGFQWSA
                     ASIYSAIALPGLVAAVLVVLLSRTSTFRAAIE"
     misc_feature    238346..239431
                     /gene="pcaK2"
                     /locus_tag="CNE_BB2p02310"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    238367..239476
                     /gene="pcaK2"
                     /locus_tag="CNE_BB2p02310"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(238406..238408,238415..238423,238427..238432,
                     238481..238483,238490..238495,238502..238504,
                     238514..238519,238523..238528,238664..238669,
                     238676..238681,238688..238693,238700..238702,
                     238736..238741,238748..238753,238769..238771,
                     239021..239023,239030..239035,239042..239047,
                     239054..239056,239093..239095,239105..239107,
                     239117..239119,239126..239128,239138..239140,
                     239282..239284,239291..239296,239303..239305,
                     239315..239320,239327..239329,239360..239365,
                     239372..239377,239384..239389,239396..239398)
                     /gene="pcaK2"
                     /locus_tag="CNE_BB2p02310"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            239581..240045
                     /locus_tag="CNE_BB2p02320"
                     /db_xref="GeneID:10920318"
     CDS             239581..240045
                     /locus_tag="CNE_BB2p02320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682887.1"
                     /db_xref="GI:339323994"
                     /db_xref="GeneID:10920318"
                     /translation="MPMSTEESNVNSLTLISYKQASQALEAAVRLAQGHNTALSFVVV
                     DSAGHLVAAARMDGTPFVTIEVARGKAFACVATGGQSGRALRQRYVDHPMVWGNISSL
                     GYGAPLLPAIGSQPIWVKGELIGAMGVSGGAAEIEEETLKNAIESIGGSVTP"
     misc_feature    239620..240027
                     /locus_tag="CNE_BB2p02320"
                     /note="Domain of unknown function (DUF336); Region:
                     DUF336; cl01249"
                     /db_xref="CDD:260854"
     gene            240175..240795
                     /locus_tag="CNE_BB2p02330"
                     /db_xref="GeneID:10920319"
     CDS             240175..240795
                     /locus_tag="CNE_BB2p02330"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004682888.1"
                     /db_xref="GI:339323995"
                     /db_xref="GeneID:10920319"
                     /translation="MLTIWGHQGSPNVQKVIWACEELGARYVRKDIGGAFGGTDTPSY
                     LAKNPNGRVPTIEDDGFALWESHAILRYLAARDPAKRLTSDDWQARAKIDQWMDWHCA
                     HLSPAIRSLVVLVVKPRSTMPTPEEIEAARAEIIPLLRLVDRELEQRDYVAGNTFTIA
                     DIPVAISYNLWKIMEPACADFPALEAWYARINRRVAFKPMSGQRRV"
     misc_feature    240178..240774
                     /locus_tag="CNE_BB2p02330"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    240178..240396
                     /locus_tag="CNE_BB2p02330"
                     /note="GST_N family, unknown subfamily 2; composed of
                     uncharacterized bacterial proteins with similarity to
                     GSTs. GSTs are cytosolic dimeric proteins involved in
                     cellular detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of...; Region:
                     GST_N_2; cd03047"
                     /db_xref="CDD:239345"
     misc_feature    order(240208..240210,240214..240219,240223..240228,
                     240235..240240,240373..240375,240382..240387)
                     /locus_tag="CNE_BB2p02330"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239345"
     misc_feature    order(240208..240210,240328..240336,240367..240372)
                     /locus_tag="CNE_BB2p02330"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239345"
     misc_feature    order(240328..240330,240364..240369,240373..240378,
                     240385..240387)
                     /locus_tag="CNE_BB2p02330"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239345"
     misc_feature    240436..240765
                     /locus_tag="CNE_BB2p02330"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    order(240454..240456,240475..240477,240649..240651,
                     240658..240663,240670..240672,240682..240684)
                     /locus_tag="CNE_BB2p02330"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    order(240454..240459,240466..240471,240478..240480,
                     240595..240597)
                     /locus_tag="CNE_BB2p02330"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    order(240475..240477,240487..240492,240673..240675,
                     240682..240684)
                     /locus_tag="CNE_BB2p02330"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            complement(240883..241737)
                     /locus_tag="CNE_BB2p02340"
                     /db_xref="GeneID:10920320"
     CDS             complement(240883..241737)
                     /locus_tag="CNE_BB2p02340"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004682889.1"
                     /db_xref="GI:339323996"
                     /db_xref="GeneID:10920320"
                     /translation="MAERLPAQILQGDFGRATINTTEQAIVEHAHREFNVIIKLSGAD
                     TALQLESASLEVDDSSVVLLNPWVLHAKRPSDCGPTTILSLFLNPSWLANEFKDAAPH
                     LDYLFPRPREPIADELREKVNLLVAAITTRSLGSPGTCEERLKAVVGTVVRQYGNLDA
                     DGRALRNTRPTDHRIRKAIAYIHEHATENPQVSEITRSAGISRSHFFAQFSLCVGVPP
                     RHYIDSLRLGIATRWLATTDRPLVDLADELGFGTHSNFTRFFTKHMALSPSEFRRRTT
                     DIAFLEPR"
     misc_feature    complement(240916..241155)
                     /locus_tag="CNE_BB2p02340"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            complement(241802..242314)
                     /locus_tag="CNE_BB2p02350"
                     /db_xref="GeneID:10920321"
     CDS             complement(241802..242314)
                     /locus_tag="CNE_BB2p02350"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of ribonuclease activity A"
                     /protein_id="YP_004682890.1"
                     /db_xref="GI:339323997"
                     /db_xref="GeneID:10920321"
                     /translation="MLIMFSTSDLSDEHPDTTSVCQLQFRSFGLREHFAGPCATLRVQ
                     EDHRPVLRRLSTPGAGRVLVVDVGGSLRIGVFGDRLAGLAAANGWAGLVIHGVIRDSK
                     TVNGIDIGVKALGTTALRNASEQPGAEDNVPLTFGGVIFRPGEWVYCDADAVLISPEA
                     IQAAAPPQAY"
     misc_feature    complement(241838..242305)
                     /locus_tag="CNE_BB2p02350"
                     /note="Demethylmenaquinone methyltransferase; Region:
                     Methyltransf_6; cl00480"
                     /db_xref="CDD:260452"
     gene            complement(242373..243356)
                     /locus_tag="CNE_BB2p02360"
                     /db_xref="GeneID:10920322"
     CDS             complement(242373..243356)
                     /locus_tag="CNE_BB2p02360"
                     /codon_start=1
                     /transl_table=11
                     /product="exported protein"
                     /protein_id="YP_004682891.1"
                     /db_xref="GI:339323998"
                     /db_xref="GeneID:10920322"
                     /translation="MRYPKICLGVLGIITAIGAGGTAQASAEAYPSRPIRLVVPFVPG
                     GVTDASARLVADKLGQALGQSVIVDNRPGASGNIGAEMVAKASADGYTLLLGFDGALV
                     TGTHITKPRFNVLADFAPITKVGDATLIFVTSPSVPAKNFKELVAYASSRKSTGLSFG
                     SSGTGTTCHLAGELLKEQAGINLQHIPYKGGSQALTDVLGGSLPVLCTAVASVSQYVK
                     SGQVRAIAVTGSQRIASLPEVPTLMESGVRNFSVDSWVGILAPAGTPPAVVTRLQREI
                     RKVLDQPETRARMLDLGITPVGNSPDEFAKQIRSDYARYGEVVKKAGITLN"
     misc_feature    complement(242385..243206)
                     /locus_tag="CNE_BB2p02360"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(243413..243535)
                     /locus_tag="CNE_BB2p02370"
                     /db_xref="GeneID:10920323"
     CDS             complement(243413..243535)
                     /locus_tag="CNE_BB2p02370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682892.1"
                     /db_xref="GI:339323999"
                     /db_xref="GeneID:10920323"
                     /translation="MPVCVPLQHIVLPTPFSAEFSSAYPVQCAWERHIMRRPHP"
     gene            complement(243572..244054)
                     /locus_tag="CNE_BB2p02380"
                     /db_xref="GeneID:10920324"
     CDS             complement(243572..244054)
                     /locus_tag="CNE_BB2p02380"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator AsnC family"
                     /protein_id="YP_004682893.1"
                     /db_xref="GI:339324000"
                     /db_xref="GeneID:10920324"
                     /translation="MIDLDKIDLRILAELQRDACLTNVELAARVNLSPSPCLARVRVL
                     KQSGLISRHVTLLDPRKLGLNVNVFIQVTLEKQTRAGLESFERAVLALPQVMECYLMS
                     GDSDYLIRVVVAEVQALEHFIVDKLTRLAGVASIRSSFALKQVKYQTALPLPEPTARK
                     "
     misc_feature    complement(243596..244054)
                     /locus_tag="CNE_BB2p02380"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(<243896..244042)
                     /locus_tag="CNE_BB2p02380"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(243896..243901,243917..243922,
                     243926..243931,243938..243943,243947..243958,
                     243983..243991,244031..244039))
                     /locus_tag="CNE_BB2p02380"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(243980..243982,243989..243991))
                     /locus_tag="CNE_BB2p02380"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(243623..243847)
                     /locus_tag="CNE_BB2p02380"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            complement(244062..244658)
                     /gene="leuD2"
                     /locus_tag="CNE_BB2p02390"
                     /db_xref="GeneID:10920325"
     CDS             complement(244062..244658)
                     /gene="leuD2"
                     /locus_tag="CNE_BB2p02390"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="YP_004682894.1"
                     /db_xref="GI:339324001"
                     /db_xref="GeneID:10920325"
                     /translation="MNHRIEQIAARAMPLRGDDIDTDQIMPARHLKCITFDGLEAHVF
                     GDERKLARARQRLHPFDDPRFAGAEILLVNANFGCGSSREHAPQALRRYGIRAIVGES
                     FGEIFAGNCVALGIACVHLADDAVRRLQAHCEARPATTLQIDLANMTLALPDATLAIG
                     MRDGPRRQLLNGNWDSLSVLLQGSHETRARLAILQSQP"
     misc_feature    complement(244224..244616)
                     /gene="leuD2"
                     /locus_tag="CNE_BB2p02390"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    complement(244410..244418)
                     /gene="leuD2"
                     /locus_tag="CNE_BB2p02390"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            complement(244655..246088)
                     /gene="leuC2"
                     /locus_tag="CNE_BB2p02400"
                     /db_xref="GeneID:10920326"
     CDS             complement(244655..246088)
                     /gene="leuC2"
                     /locus_tag="CNE_BB2p02400"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_004682895.1"
                     /db_xref="GI:339324002"
                     /db_xref="GeneID:10920326"
                     /translation="MGKTLYEKVFDSHALRELAPGQYQIVVDRHMLNEVSSPQAFATL
                     RERGLKVAYPERTFSTSDHTTSTLGDPEAVDDATSALQIATMRGNAAESGIRYFDPRQ
                     GEHGIIHVIAPERGLIHPGMVVVCGDSHTSTYGAFGAVAFGIGTTQVRDVLASQTMLC
                     EKLRVRRIDIVGKLAPGVYAKDVALYAIARLGAKGGVGYAYEFGGEVVERFSMEERMT
                     LCNMAIEGGARCGYVNPDATTYRYLQGRAHAPAGQRFRQSVARWEKVRSDADARYDNR
                     VTLHADEIGPMVTWGTSPDQAVAVHERIPVVSPALADTLGFMGLEAEQPIAGTRVDVA
                     FIGSCTNGRLSDFEAVAEHLRRGTYRVAAHVKALVVPGSRAVHEALIASGIDRLFTEA
                     GFEMRDAGCSLCCGMNADRLSGHQRCASSSNRNFRGRQGSPEGRTMLMSPVMVAAAAI
                     AGEIVDARRLFGIDGTAPPSSRTIEQP"
     misc_feature    complement(244727..246004)
                     /gene="leuC2"
                     /locus_tag="CNE_BB2p02400"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    complement(order(244802..244804,244817..244819,
                     244874..244876,245702..245707,245981..245983,
                     245990..245992))
                     /gene="leuC2"
                     /locus_tag="CNE_BB2p02400"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    complement(order(244820..244822,244874..244879,
                     244886..244888,245072..245074,245699..245701))
                     /gene="leuC2"
                     /locus_tag="CNE_BB2p02400"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            complement(246108..247313)
                     /gene="frc"
                     /locus_tag="CNE_BB2p02410"
                     /db_xref="GeneID:10920327"
     CDS             complement(246108..247313)
                     /gene="frc"
                     /locus_tag="CNE_BB2p02410"
                     /EC_number="2.8.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl-coenzyme A transferase Frc"
                     /protein_id="YP_004682896.1"
                     /db_xref="GI:339324003"
                     /db_xref="GeneID:10920327"
                     /translation="MKVLQNVRVIEIGRFITAPLAAQLLGELGAEVIKVESPKVVDPF
                     RTFDGGLYAGHFQSHNRNKRSLVLDFATPDGREVLQELLRDADVLLLNMRPGSETKLG
                     LDAEHLRRINPRLVHCSITGFGADGPYAHRPAFDNVGQALSGWMSMFHRGTDSRVPGP
                     PVSDTISGIYACIGILGALVERASTGRGRKVEVSMLEAMIALATEPLGQLSAYGSAPE
                     FFSRASKSQSYLVTCKCGRRIGLHLSSPEKFWQSLLGAIERPDLAQAYPDRQSRVHGY
                     DAIAAELSAVFATADRDTWMARLQQHDVPAAPELRLDELDADEQVRHLDIFYQLEHPD
                     YGPVRAANRAIRYDGDNASGFRVPPAFGEHSIEVLREAGIEEARIEQLVGAGTVLDHH
                     RPQAGGTQG"
     misc_feature    complement(246150..247304)
                     /gene="frc"
                     /locus_tag="CNE_BB2p02410"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(247310..248104)
                     /locus_tag="CNE_BB2p02420"
                     /db_xref="GeneID:10920328"
     CDS             complement(247310..248104)
                     /locus_tag="CNE_BB2p02420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682897.1"
                     /db_xref="GI:339324004"
                     /db_xref="GeneID:10920328"
                     /translation="MEKQELRSDMGWSTADRITVRGLDLCQDVLGKIALGDFAFLEVT
                     GRRPGAAESTVFNAILAVLVEHGMTPSAMVARLTYLGAPESMQAAIAAGLCGMGTTFA
                     GTAEGAARLLQGVQPLGTAKQYDVAETAARIVQEHRQQRLPVPGIGHPVHKPVDPRAV
                     TLFAIAEENGLAGPYVALMKAISLEAERAFGKPGQLPVNATGAIGAIASELGLSWKLC
                     RGLAVVSRAVGLLGHLAEEIEHPIANALWVRTEEEASAHLVQKEPQ"
     misc_feature    complement(247352..248041)
                     /locus_tag="CNE_BB2p02420"
                     /note="Citryl-CoA lyase (CCL), the C-terminal portion of
                     the single-subunit type ATP-citrate lyase (ACL) and the
                     C-terminal portion of the large subunit of the two-subunit
                     type ACL. CCL cleaves citryl-CoA (CiCoA) to acetyl-CoA
                     (AcCoA) and oxaloacetate (OAA); Region: CCL_ACL-C;
                     cd06100"
                     /db_xref="CDD:99854"
     misc_feature    complement(247388..>247975)
                     /locus_tag="CNE_BB2p02420"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    complement(order(247364..247366,247373..247375,
                     247427..247429,247502..247504,247508..247510,
                     247517..247519,247631..247633,247655..247678,
                     247784..247786,247793..247795,247802..247810,
                     247898..247900,247907..247909))
                     /locus_tag="CNE_BB2p02420"
                     /note="active site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(247364..247366,247427..247429,
                     247631..247633,247655..247660,247802..247804,
                     247898..247900,247907..247909))
                     /locus_tag="CNE_BB2p02420"
                     /note="oxalacetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(247427..247429,247508..247510,
                     247631..247633,247655..247669,247673..247678,
                     247802..247807,247898..247900,247907..247909))
                     /locus_tag="CNE_BB2p02420"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(247373..247375,247502..247504,
                     247508..247510,247517..247519,247655..247678,
                     247784..247786,247793..247795,247802..247810))
                     /locus_tag="CNE_BB2p02420"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(247502..247504,247658..247660,
                     247802..247804))
                     /locus_tag="CNE_BB2p02420"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99854"
     gene            complement(248152..249501)
                     /locus_tag="CNE_BB2p02430"
                     /db_xref="GeneID:10920329"
     CDS             complement(248152..249501)
                     /locus_tag="CNE_BB2p02430"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004682898.1"
                     /db_xref="GI:339324005"
                     /db_xref="GeneID:10920329"
                     /translation="MATSIQPTSIEAALPDLEKRTYDKVFWRTVPLFFVCYVISYLDR
                     VNIGFAKLQMLGDLNLNDNVYALAASMLFWGYVLFEMPSNLILHRVGARRWISRIMIS
                     WGCVSISMMYIEPLAALFHITPATMFYVLRFLLGVCEAGFFPGVVLYLNQWFPSHKQN
                     RVLAGFMFALPLSLCIGGPVSGWILQNMHEAFGHRGWQWMLLIEGLPAVILGIVVLAC
                     LTDSVDKARWLSADEKALIKRNLAAENAHKTHNFGAALKSPVIWLLCAILLTMNTGFY
                     GLSFWLPSIIQATGLKNIYHVGLLSALPYVVAGVFIVANAVHSNRTGERRLHAAIPAG
                     CAGIGLILSAAFASQLEMSLLLISVAAAGILGVAPLFWIFSGRALTGAAAAAGLAMIN
                     SVGSLAGITGAMITNVAKNVTGNVNSGTYVLGACLLLCCLLILLLPRAIVSADAHRP"
     misc_feature    complement(248227..249435)
                     /locus_tag="CNE_BB2p02430"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(248278..249414)
                     /locus_tag="CNE_BB2p02430"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(248305..248307,248314..248319,
                     248326..248331,248338..248343,248374..248376,
                     248383..248388,248398..248400,248407..248412,
                     248419..248421,248566..248568,248578..248580,
                     248587..248589,248599..248601,248611..248613,
                     248653..248655,248662..248667,248674..248679,
                     248686..248688,248980..248982,248998..249003,
                     249010..249015,249049..249051,249058..249063,
                     249070..249075,249082..249087,249250..249255,
                     249259..249264,249274..249276,249283..249288,
                     249295..249297,249346..249351,249355..249363,
                     249370..249372))
                     /locus_tag="CNE_BB2p02430"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(249721..250998)
                     /locus_tag="CNE_BB2p02440"
                     /db_xref="GeneID:10920330"
     CDS             complement(249721..250998)
                     /locus_tag="CNE_BB2p02440"
                     /codon_start=1
                     /transl_table=11
                     /product="gram-negative type outer membrane porin protein"
                     /protein_id="YP_004682899.1"
                     /db_xref="GI:339324006"
                     /db_xref="GeneID:10920330"
                     /translation="MTPTTKRPHDVPRVIHRRPPFVSLTTTQPTSTVARQPGGTKLKR
                     HRPNQRAWHAGILPILAIGLGGVAANAMAQAGPVAPGGSGHIYGVLDAGYVYQSGSVN
                     HANGTSSGPVVRNALQGGVARGSRLGFRGSENLGNDLKAIFVAEMGFYVDTGVSSQGA
                     QVLNQYPAGPLFGRQAFVGLASNAGTLTMGRQYTPAFLVTTLADPFFQGMAGNMANLQ
                     NTSGRASNSVIYVTPAFGGLTASAMYALGEVPGDSAKGRQYSANLMYQASRLNVGLAF
                     YNTNNAGASATSRTTTLAANYDAGIATLYGDLQIQRASMENPPGSTVLGGDRVFTSYN
                     SFLVGVSVPLGRHQFLLSYIYNRDMRSGPDSDRNAGQFAIGYKYHYSKRTYLYSAYGT
                     VTNHNGASYTIGDALSVNGNARRAFNLGLSHDF"
     misc_feature    complement(249724..250743)
                     /locus_tag="CNE_BB2p02440"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(250330..250332,250387..250389,
                     250477..250479,250621..250623,250732..250734))
                     /locus_tag="CNE_BB2p02440"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(249724..249726,249730..249732,
                     249736..249738,249847..249849,249856..249861,
                     250321..250326,250330..250332,250426..250434,
                     250459..250473,250477..250482,250543..250554,
                     250558..250560,250564..250572,250576..250578,
                     250594..250608,250717..250725,250729..250731))
                     /locus_tag="CNE_BB2p02440"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     gene            251029..251754
                     /locus_tag="CNE_BB2p02450"
                     /db_xref="GeneID:10920331"
     CDS             251029..251754
                     /locus_tag="CNE_BB2p02450"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682900.1"
                     /db_xref="GI:339324007"
                     /db_xref="GeneID:10920331"
                     /translation="MCVILSYNKGNREERSPDMTNPSATQRSTLEYVVDSLRHAILSG
                     RLVPGQRLVEADLTRELGVSRGPVRESFRRLSAEGLVESIPNQTTMVRRYSQLEMKEL
                     FEVRAELEALAARRTASRMNEACVRERFLQATQPIWEDHHGMSPAAYFEENRRFHQAI
                     ADECGNAKLTDFIGRLQLPMIMFQLGNAIHGEAQQESVVEHRLIAQAIVSGDADKSAQ
                     LIREHLRRASEFVDRMPADTFRP"
     misc_feature    251068..251739
                     /locus_tag="CNE_BB2p02450"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    251119..251304
                     /locus_tag="CNE_BB2p02450"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(251185..251187,251188..251193,251215..251229,
                     251233..251238,251245..251247,251275..251280,
                     251284..251295)
                     /locus_tag="CNE_BB2p02450"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    251329..251706
                     /locus_tag="CNE_BB2p02450"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            252065..254761
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /db_xref="GeneID:10920332"
     CDS             252065..254761
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component PdhA"
                     /protein_id="YP_004682901.1"
                     /db_xref="GI:339324008"
                     /db_xref="GeneID:10920332"
                     /translation="MTNLASPRAQLLEQAQRRGDDDPQETQEWLDALEAVVAQCGQER
                     ARYLLGRLLDVAPTLGVSTTAQSNSPYVNTIPVERQPPYPGDAAMEARITAIVRWNAL
                     AMVVRANKAYGELGGHISSYASAADLFEVGFNHFFRGAEAGNGGDLVYFQPHSAPGVY
                     ARAFLEGRLSEGQLDNFRRESEGKGLCSYPHPWLMPDFWQFPTGSMGLGPIQAVYQAR
                     FMRYLEHRGLQATSGRHVWGVFGDGEMDEPESIAAIPLAAREKLDNLTFVINCNLQRL
                     DGPVRGNGQIVQELEALFRGAGWNVIKVLWGSAWDPIFARDHSGALLRAFAATMDGQF
                     QTYKAKDGHYGRAHFFGQNEALKALVAHMTPEEVAELNRGGHDLRKLHAAFAAARDHK
                     GQPTVILAKTVKGYGMGDAGQAQNTTHQQKKLDLDALKAFRRRFGLDLSDEDLEAMRF
                     YRPAEDSAELRYLRERRAALGGYLPARRRQADAVPVPALPQYGQFAVQAEGKEMSTTM
                     AMVRMLTGLLKDKTLGPRVVPIVADEARTFGMASLFRQVGIYSSQGQLYEPEDAGSML
                     YYREDIRGQILEEGITEAGAMSSWIAAGTAYSTHGTAMLPLYIYYSMFGFQRIGDLIW
                     AAGDQRARGFLVGATAGRTTLSGEGLQHQDGTSHIIAATIPNCRAYDPAYAYELAVIV
                     DEGMRAMMERQEDVFYYLTVMNENYAQPSMPAGVERDIVRGMYRLAQTERGGRGKVRL
                     LGSGAILREVEAAARMLAEDWQVDSEVFSVTSFSELEREAREVARQQLHQPLAEVAPS
                     HVERLLAGNAPVVAATDYVRAYPQLIAPYVRAPYTVLGTDGYGRSDNRPSLRRFFEVD
                     RAYVCVAALRALAAQGTVPAALVAQALERYGIDAGKPAPSLL"
     misc_feature    252068..254749
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /note="2-oxoacid dehydrogenase subunit E1; Provisional;
                     Region: PRK13012"
                     /db_xref="CDD:237267"
     misc_feature    252326..253480
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of E. coli
                     PDC-like subfamily, TPP-binding module; composed of
                     proteins similar to the E1 component of the Escherichia
                     coli pyruvate dehydrogenase multienzyme complex (PDC). PDC
                     catalyzes the oxidative...; Region: TPP_E1_EcPDC_like;
                     cd02017"
                     /db_xref="CDD:238975"
     misc_feature    order(252401..252409,252596..252607,252626..252631,
                     252635..252637,252641..252643,252668..252670,
                     252674..252682,252800..252811,252818..252820,
                     252827..252829,252839..252841,252887..252895,
                     252905..252907,252929..252931,252938..252943,
                     252950..252952)
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    order(252425..252427,252518..252520,252524..252526,
                     252674..252676,252680..252682,252788..252796,
                     252803..252805,252878..252880,252884..252886,
                     253274..253276)
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    253802..254167
                     /gene="pdhA4"
                     /locus_tag="CNE_BB2p02460"
                     /note="Transketolase, pyrimidine binding domain; Region:
                     Transket_pyr; smart00861"
                     /db_xref="CDD:214865"
     gene            255007..255129
                     /locus_tag="CNE_BB2p02470"
                     /db_xref="GeneID:10920333"
     CDS             255007..255129
                     /locus_tag="CNE_BB2p02470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682902.1"
                     /db_xref="GI:339324009"
                     /db_xref="GeneID:10920333"
                     /translation="MILAGCAAWASGFSEKPVTLIVPQAPGGANDAIAESWRNG"
     misc_feature    255007..>255108
                     /locus_tag="CNE_BB2p02470"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            255707..256532
                     /gene="vacJ"
                     /locus_tag="CNE_BB2p02480"
                     /note="'surface lipoprotein, VacJ-like'"
                     /pseudo
                     /db_xref="GeneID:10920334"
     gene            complement(256588..256995)
                     /locus_tag="CNE_BB2p02510"
                     /db_xref="GeneID:10920335"
     CDS             complement(256588..256995)
                     /locus_tag="CNE_BB2p02510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682903.1"
                     /db_xref="GI:339324010"
                     /db_xref="GeneID:10920335"
                     /translation="MSTDSNGLLLYPPALVEGQVLPAVRFASCYEFRIVDRRTGTKVS
                     DFVGSMCALFERRVGTLQRLKLATGGTLLCWPIRYTKFVDPGRFRLVDTDIELEPTML
                     DMTDWCCPARRLVMRQEVRYRNQQQVADVLEID"
     gene            complement(257125..257262)
                     /locus_tag="CNE_BB2p02520"
                     /db_xref="GeneID:10920336"
     CDS             complement(257125..257262)
                     /locus_tag="CNE_BB2p02520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682904.1"
                     /db_xref="GI:339324011"
                     /db_xref="GeneID:10920336"
                     /translation="MAADVRWLEPARACSTCRGDRPSTRTLKPIVRAIWISTPSLRFG
                     T"
     gene            257427..258599
                     /locus_tag="CNE_BB2p02530"
                     /db_xref="GeneID:10920337"
     CDS             257427..258599
                     /locus_tag="CNE_BB2p02530"
                     /note="porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_004682905.1"
                     /db_xref="GI:339324012"
                     /db_xref="GeneID:10920337"
                     /translation="MGSFLTHGCAMRRGSVRAEVEKHGDNMKSSLVGATFLVLTGVCT
                     AAGAQSQVTLYGRLNTSLEYSDATTASDGTRLGGTGRLTNNRSVFGMRGEESLGDSLK
                     AIWQIESSISLDSGGGQIAGRNTRIGLAGSAGSFFMGNWTTPYLEATSAYDPFYPTTA
                     GYMAIMGNGSTPTSNNVEDTSSFDRRQKNSIHYRSASWNGFRAGVTWGVNEERVTVPR
                     NPSLWSFSAAYDGGPLNLVLAYERHNNYQTAGRDDDGLKVGVSYQFPITRVSAIYERL
                     HYRTATGDLKRDAYYASVVQTLWTGSLRAGVGVASNGRGNATEAVGFFRSGADTGAVQ
                     ATIGYEYPLSKRTAVFGFYSRIFNKKNATYDFAINELGISAGADPQTFALGMRHTF"
     misc_feature    257574..258596
                     /locus_tag="CNE_BB2p02530"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(257574..257576,257580..257582,257598..257600,
                     257604..257612,257703..257717,257733..257735,
                     257739..257747,257751..257753,257757..257768,
                     257790..257795,257799..257813,257838..257846,
                     257982..257984,257988..257993,258453..258458,
                     258465..258467,258582..258584,258588..258590,
                     258594..258596)
                     /locus_tag="CNE_BB2p02530"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(257595..257597,257688..257690,257793..257795,
                     257883..257885,257982..257984)
                     /locus_tag="CNE_BB2p02530"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            258640..259620
                     /locus_tag="CNE_BB2p02540"
                     /db_xref="GeneID:10920338"
     CDS             258640..259620
                     /locus_tag="CNE_BB2p02540"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004682906.1"
                     /db_xref="GI:339324013"
                     /db_xref="GeneID:10920338"
                     /translation="MRFTTTRRAVLAMLLCLPLMHTAARADGFPSKPIKMVVPFAAGS
                     ATDLLARIVSAEMSTGSNMQIVIDNRPGAGGTIGTAVVAKSPPDGYTLLLTSAGHAVN
                     PTLYPKLSYDTTRDLMGVSTVATMPYLLVVGASSPYRTLKELLAAARARPDAVTYSSA
                     GSGSSSHLSGELFNVTAGVQTRHIPYKGAPAAITDVMSGRVDMFFAPSITALQFVKEG
                     KLRILGVATAARVPSMPDVPTIAEAGVPGYVFDAWFGVLAPAGTPKDIIAQLNTAMLK
                     ALGSPATKEKLKAQGAEAKPSTPGALDKLIAVDIAKLEPVVKRSGAQPGQ"
     misc_feature    258787..259605
                     /locus_tag="CNE_BB2p02540"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            259752..261401
                     /locus_tag="CNE_BB2p02550"
                     /db_xref="GeneID:10920339"
     CDS             259752..261401
                     /locus_tag="CNE_BB2p02550"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-dependent Hydrolase"
                     /protein_id="YP_004682907.1"
                     /db_xref="GI:339324014"
                     /db_xref="GeneID:10920339"
                     /translation="MAAPAQAVAHADRILVNGTVLTMDAADGIAQAIAIRGDKIAAVG
                     TNQEVRRLAGQHTEVVDLGGRTVIPGLIDTHIHAIRGGQGYGFETYWYEGETTSLAAG
                     LEQLRQTALARGAGKWVVVTGSWHPDQFAEKRAPTSAELTALLPDNPAYVQYLYDYAV
                     VNAKAIEVLGLEQADALPAGVRAERDGAGRLTGRILGAIRPLSALYARIHAQSNVDTA
                     GNLAAFFGKLNSLGVTAMIDASAGPGANYDPLFALWREQRLPLRVSYRVSAMAAGNES
                     DWLQNTLAYLPPRLGDGKLRFLGPGEMLVFGMDDGVTMGPGFRPVAKDRAELLKVASF
                     AASRGYPVEIHAYTDDAASAILDVFEEVARSHDLGKLRWAMAHLNTGKPETFRRMKVL
                     GLAYTVQMGPYFEAGAIGHANDNHVAESAPPVRLALRQGLKVAGGTDATRIGIPGVWR
                     ALEFHVSGYAIGKEVRRREEFRLTRLEALRLYTANAAWISFDENVRGTLEAGKLADLA
                     VLDKPYLTVPMADIHRIRSVLTLVDGKVVHADGSFASLKAR"
     misc_feature    259785..261365
                     /locus_tag="CNE_BB2p02550"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    259845..261278
                     /locus_tag="CNE_BB2p02550"
                     /note="YtcJ_like metal dependent amidohydrolases. YtcJ is
                     a Bacillus subtilis ORF of unknown function. The
                     Arabidopsis homolog LAF3 has been identified as a factor
                     required for photochrome A signalling; Region: YtcJ_like;
                     cd01300"
                     /db_xref="CDD:238625"
     misc_feature    order(259974..259976,259980..259982,260784..260786,
                     260880..260882,261066..261068)
                     /locus_tag="CNE_BB2p02550"
                     /note="active site"
                     /db_xref="CDD:238625"
     gene            261402..261797
                     /locus_tag="CNE_BB2p02560"
                     /db_xref="GeneID:10920340"
     CDS             261402..261797
                     /locus_tag="CNE_BB2p02560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682908.1"
                     /db_xref="GI:339324015"
                     /db_xref="GeneID:10920340"
                     /translation="MPHLIVEYTRNLGESARIGALLDTLCSTLAMQHGTFPVGGIRAR
                     AMCLDTYRIADGSADDAFVHVTLAVAAGRPGDVLGDTVNALFDAMIAHFAALYRRRYL
                     ALSLELREFSGAGTYRSLNNIHQRFSSLQ"
     misc_feature    261405..261737
                     /locus_tag="CNE_BB2p02560"
                     /note="5-carboxymethyl-2-hydroxymuconate isomerase (CHMI)
                     is a trimeric enzyme catalyzing the isomerization of the
                     unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to
                     5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate. This is one
                     step in the...; Region: CHMI; cd00580"
                     /db_xref="CDD:238324"
     misc_feature    order(261405..261407,261519..261521,261525..261527,
                     261609..261611,261618..261620)
                     /locus_tag="CNE_BB2p02560"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238324"
     misc_feature    order(261408..261410,261420..261422,261468..261470,
                     261477..261479,261513..261518,261522..261563,
                     261579..261581,261591..261593,261603..261605,
                     261633..261638,261657..261659,261669..261671,
                     261705..261728)
                     /locus_tag="CNE_BB2p02560"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238324"
     gene            261846..262937
                     /locus_tag="CNE_BB2p02570"
                     /db_xref="GeneID:10920341"
     CDS             261846..262937
                     /locus_tag="CNE_BB2p02570"
                     /note="porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_004682909.1"
                     /db_xref="GI:339324016"
                     /db_xref="GeneID:10920341"
                     /translation="MKIGSMGAALIAATPALALAQSVTMYGVIDTGVEYVSNVGAAGD
                     GLVRMPTLTGTVPSRWGMRGTEDLGGGLKSVFVLESGFAPDTGGANQGGRLFGRQALV
                     GLSGKWGQLSFGRQYTMLFWANLDADILGPNVYGAASLDSYLPNTRADNAVAYKGSFG
                     GLTVGATYSFGRDAVNAGPSPTGTNCAGENPASQSACREWSALIQYEQKGWGVSAAYD
                     SLRGGPGAFGGLGSKSMTDDRLSLNGYVLLERAKLGLGVIRRDNEGSPTPRSDLWYGG
                     VTYDITPAFTMSGQVYYLKFHDSANKAMLYALRGAYAFSKRSSVYATAGYIDNGGQLA
                     LSVSAGAAGSNPRPGGSQFGTMVGIKHVF"
     misc_feature    261909..262934
                     /locus_tag="CNE_BB2p02570"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(261912..261914,261930..261932,261936..261944,
                     262035..262049,262065..262067,262071..262079,
                     262083..262085,262089..262100,262134..262139,
                     262143..262157,262182..262190,262287..262289,
                     262293..262298,262785..262790,262797..262799,
                     262920..262922,262926..262928,262932..262934)
                     /locus_tag="CNE_BB2p02570"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(261927..261929,262020..262022,262137..262139,
                     262221..262223,262287..262289)
                     /locus_tag="CNE_BB2p02570"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(262964..263899)
                     /locus_tag="CNE_BB2p02580"
                     /db_xref="GeneID:10920342"
     CDS             complement(262964..263899)
                     /locus_tag="CNE_BB2p02580"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682910.1"
                     /db_xref="GI:339324017"
                     /db_xref="GeneID:10920342"
                     /translation="MDLRQLRYFKVLATLQHFGRASAALHIAQPALSRQIRLLEEELG
                     VRLVERHVRGATPTPEGLVLLDRASFLLRYANQVKIDIADLAASPRGLVALGLTPALA
                     PLLFIPLAEALRQRYPDIRLRLVENFAPALQDALLQGTLDVGLLSGPVSSAGVSAMPL
                     VTEDLCAIGPHDDMSLGDGPLDIEQLQHLPIVLAGLPKSGVRLALEALAARQGVALQV
                     AMEVESIEVARRLVARGFGWTVHFAAAIREELQTRQLRAQPIRGLALQRLIGYAAARP
                     PSRASLAVMETLKQVAVELAGTDHWPHSRLLEAAG"
     misc_feature    complement(263012..263899)
                     /locus_tag="CNE_BB2p02580"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(263717..263893)
                     /locus_tag="CNE_BB2p02580"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(263036..263623)
                     /locus_tag="CNE_BB2p02580"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(263198..263203,263207..263212,
                     263228..263245,263522..263542,263546..263548,
                     263558..263560,263567..263572,263576..263581))
                     /locus_tag="CNE_BB2p02580"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(264010..265023)
                     /locus_tag="CNE_BB2p02590"
                     /db_xref="GeneID:10920343"
     CDS             complement(264010..265023)
                     /locus_tag="CNE_BB2p02590"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LacI family"
                     /protein_id="YP_004682911.1"
                     /db_xref="GI:339324018"
                     /db_xref="GeneID:10920343"
                     /translation="MSKPTIKQIAQALDIHPSTVSRVLNPETRHRIGEDMVARVLKAA
                     QDLHYSPNRIAAALRTRRSGTIGVVVPDISSPVFPPIVLGIENALSRHRYIPIMANAG
                     GDKARQTFIVDQLLARQVDGLILATAERNDPVVAHCLTQGVPIVMVNRSDDAGRVSSV
                     VGDSRQAMALAVAHLHALGHRRIGHIAGPASVSTGHEREAGFLQALTDAGLSAAQCPV
                     VRAPAYTEAAGQAACAQLLARRTRITAVVAANDFLALGCYAAVRATGGSCPQDLSVVG
                     HNDMLLMHAVAPPLTTIRVHFYEMGTRAAALMLGALDGSITTTARTLLAPELVVRDST
                     RTL"
     misc_feature    complement(264013..265014)
                     /locus_tag="CNE_BB2p02590"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(264844..265005)
                     /locus_tag="CNE_BB2p02590"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(264847..264852,264856..264861,
                     264868..264870,264877..264879,264916..264918,
                     264925..264930,264949..264951,264958..264963,
                     264967..264981,265003..265005))
                     /locus_tag="CNE_BB2p02590"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(264850..264879)
                     /locus_tag="CNE_BB2p02590"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(264037..264831)
                     /locus_tag="CNE_BB2p02590"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(264235..264240,264247..264249,
                     264259..264261,264343..264345,264667..264675,
                     264682..264684,264691..264693,264724..264726,
                     264730..264744,264763..264768,264772..264777,
                     264784..264792,264829..264831))
                     /locus_tag="CNE_BB2p02590"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(264139..264141,264190..264192,
                     264352..264354,264430..264432,264538..264540,
                     264577..264579,264646..264648,264781..264783,
                     264790..264795))
                     /locus_tag="CNE_BB2p02590"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     gene            265246..266187
                     /locus_tag="CNE_BB2p02600"
                     /db_xref="GeneID:10920344"
     CDS             265246..266187
                     /locus_tag="CNE_BB2p02600"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH dependend quinone reductase"
                     /protein_id="YP_004682912.1"
                     /db_xref="GI:339324019"
                     /db_xref="GeneID:10920344"
                     /translation="MKGAVSLSGRLPAYQEFREPEAAGGQVVVDVSAAALTRLDMAIA
                     EGRHYIKPPVEQFIVGREGVGRLADGRRIYFNVNAPAAPFGSMAQRALVDAELTFPVP
                     DGIDDARAAALGNAGLAAWLPLSWRARMLAGETVLILGATGISGLLAVASAKLLGAGR
                     VIAAGRDTQALERARRLGADAVVVLDSGTDLPAAYRKAAQGEVDVVLDYLCGSPAEAA
                     LQVLGHGGRLVHIGTTVGPTITFAGAAARKACFDIMGFAYYHAPIAEQARAYAELCRH
                     TETGRMEIDIEPTPLSEIAQAWQAQARGARQRFVLVP"
     misc_feature    265282..266184
                     /locus_tag="CNE_BB2p02600"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    265309..266145
                     /locus_tag="CNE_BB2p02600"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    order(265354..265362,265369..265371,265588..265590,
                     265600..265602,265663..265674,265678..265683,
                     265738..265743,265753..265755,265798..265800,
                     265870..265875,265936..265941,266011..266013)
                     /locus_tag="CNE_BB2p02600"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176178"
     gene            266355..266906
                     /locus_tag="CNE_BB2p02610"
                     /db_xref="GeneID:10920345"
     CDS             266355..266906
                     /locus_tag="CNE_BB2p02610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682913.1"
                     /db_xref="GI:339324020"
                     /db_xref="GeneID:10920345"
                     /translation="MDITPAEMEATRIARWGKVEPYRETFIESRLPGMKKNIYKIMNR
                     GVLENKGVEPAIPGNHRFGVTFIEIPVGQGASLHAHKTEEVFCPLNGRMELIWGAKGQ
                     YSLMLNQWDVISCPIGVMRGFRNPNDHALVVYSVVGGTDEECGRIAWHPDVVKAAEAT
                     GLVYGQDGFIKEAGANAADRAGD"
     gene            267004..268002
                     /locus_tag="CNE_BB2p02620"
                     /db_xref="GeneID:10920346"
     CDS             267004..268002
                     /locus_tag="CNE_BB2p02620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682914.1"
                     /db_xref="GI:339324021"
                     /db_xref="GeneID:10920346"
                     /translation="MNRRSALGWIAAGAAGLALGRGAVARAAGQTAAWTPSGTVRIVV
                     PFAAGGTTDLVARLLSDRLGKLLGRAVIVDNRVGAGGNIGIASVARAPADGHTLLLAS
                     TAFLTNPALFIQNPPYDPVRQFAPISELVSAPDLIAVRADSPLDSLAALVARARQQPG
                     ALTFATPGKGNSVHLGGELLWQRAGISLLHVPYNGAAPAIHAVLGGQVDCALTALPPA
                     RALLAAGKLRALAVGSLMPWPGLPGVPAIAGLGYPGYRSETMQALYAPAGTPGTAIAR
                     LASACAMLLGEETVRRQAAEMGFAVVAGSPEALARRVADEVPRWARVAASAKVRAD"
     misc_feature    267166..267972
                     /locus_tag="CNE_BB2p02620"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            268071..268988
                     /gene="pcaH2"
                     /locus_tag="CNE_BB2p02630"
                     /db_xref="GeneID:10920347"
     CDS             268071..268988
                     /gene="pcaH2"
                     /locus_tag="CNE_BB2p02630"
                     /EC_number="1.13.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase beta subunit"
                     /protein_id="YP_004682915.1"
                     /db_xref="GI:339324022"
                     /db_xref="GeneID:10920347"
                     /translation="MSETNASGQRPRASSPRSIPADPQALLQAVLQANQGSANARTRE
                     VLDAAIRHLHAFAGEIGLTYEELHHGLDFLVRIGQATGPKKHEGILLADILGVATLVV
                     LMDAKAALAAGGTEPALIGPFWREEQPVRPNGASIASVDTQGERLRVRGRVLSLDGTP
                     IVGARVETWQAAPSGLYENQDPEQEDMNLRARFETDSDGSFWFDSVKPSGYGVPTDGP
                     CGELLRLQGRHHMRPAHLHFIVIAPGHKVLATQIFDELDPYAYSDAAFGAVGSLLRKF
                     EPDGNGGYRLDLELRVEPGESKVPRPPLP"
     misc_feature    268140..268931
                     /gene="pcaH2"
                     /locus_tag="CNE_BB2p02630"
                     /note="catechol 1,2-dioxygenase, proteobacterial; Region:
                     catechol_proteo; TIGR02439"
                     /db_xref="CDD:233869"
     misc_feature    268140..268904
                     /gene="pcaH2"
                     /locus_tag="CNE_BB2p02630"
                     /note="Intradiol dioxygenases catalyze the critical
                     ring-cleavage step in the conversion of catecholate
                     derivatives to citric acid cycle intermediates. This
                     family contains catechol 1,2-dioxygenases and
                     protocatechuate 3,4-dioxygenases which are mononuclear...;
                     Region: intradiol_dioxygenase; cl17208"
                     /db_xref="CDD:266557"
     misc_feature    order(268575..268577,268599..268601,268701..268703,
                     268764..268766,268773..268775,268779..268781,
                     268860..268862)
                     /gene="pcaH2"
                     /locus_tag="CNE_BB2p02630"
                     /note="active site"
                     /db_xref="CDD:238241"
     gene            complement(269097..270134)
                     /locus_tag="CNE_BB2p02640"
                     /db_xref="GeneID:10920348"
     CDS             complement(269097..270134)
                     /locus_tag="CNE_BB2p02640"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor family protein
                     90"
                     /protein_id="YP_004682916.1"
                     /db_xref="GI:339324023"
                     /db_xref="GeneID:10920348"
                     /translation="MPPRRVVHFPRAPAPPTIPMKRRHFILACAAWQLAAATAAHAHA
                     PDVWPSKPVRIIHGFAAGGPIDNLARLLAAQFQERFGQPAIVEARPGAGGTIAARYVA
                     RSAPDGYTLFLMASGHATAPELYKSLAYDPIKDFAVISMVARSPYAIIANPKAGYDTM
                     GHLLDAARRQPGKIDYGTGGNGTGMHLAAALLQAKTGVRLSHVAYKGGSATALAVVGG
                     EVPLIFTSLAGMSAYVDSGKVKVLAVTTRERFRLYPKVPTIAETVLPGFDVTAWYALA
                     GPRGLRPDVMARLGEMVRVTLQRDDVAESLRMQAAEPWYTSHEAAQRFVAEEVRLWRK
                     VIQDEGLAEMN"
     misc_feature    complement(269112..269930)
                     /locus_tag="CNE_BB2p02640"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(270178..271590)
                     /locus_tag="CNE_BB2p02650"
                     /db_xref="GeneID:10920349"
     CDS             complement(270178..271590)
                     /locus_tag="CNE_BB2p02650"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein 16"
                     /protein_id="YP_004682917.1"
                     /db_xref="GI:339324024"
                     /db_xref="GeneID:10920349"
                     /translation="MNRTVIKNADILTMDAGLGELRADVLIEGDRIAAIGTDLPVHDA
                     EVIDATGMILMPGMVDGHRHVWEIIDMGRLVKSRPAEYAQTYQQWKMRTIVCMTPEDN
                     YLAGLIGGLQAIDSGVTSLFDFAHGQPTEACAMGAAQGLKDSGIAGWFGFQLGVSSSY
                     QAGDTVPLAKADGERIAKTTEVHWATAERLQRELFSDSSALLQLALAPSGNIGSSLDD
                     IRTEWTRARGMGVGMLAAHIHKPEHPLPAGIMGHRDSGIRDLHDAGLLGPDYQATHAN
                     RLTAEELAMLRDSGGMLCATAMGEFPYVMSASKGPSVHGRSRSAGVPTSMGIDISLAL
                     PGDYFEHVRATYWNLYLDPECRALMRACDSEYILDFATAHGAQALRLGDTTGSIQVGK
                     RADLVLLSTERVGFAMAGSLADRVVMFAGTADVDSVWIAGKARKRHGKMIGVDWRALK
                     AQLVEAQQRIGRQAATIRFT"
     misc_feature    complement(270193..271590)
                     /locus_tag="CNE_BB2p02650"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08204"
                     /db_xref="CDD:181288"
     misc_feature    complement(270268..271581)
                     /locus_tag="CNE_BB2p02650"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(order(270604..270606,270769..270771,
                     270874..270876,271399..271401,271405..271407))
                     /locus_tag="CNE_BB2p02650"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(271737..272666)
                     /locus_tag="CNE_BB2p02660"
                     /db_xref="GeneID:10920350"
     CDS             complement(271737..272666)
                     /locus_tag="CNE_BB2p02660"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682918.1"
                     /db_xref="GI:339324025"
                     /db_xref="GeneID:10920350"
                     /translation="MDRLTAMSVFCRVVERGSFTVAGERLDMSTASVSKYVSALESHI
                     GTPLLARTTRRIVLTEAGKAYYEKCTRILDEIEDAERSAGVVQTTPRGLLKVRAPVSL
                     GHANLGRTVAEFTQKFPEVSVEMTLNDRFVDPAEEGVDVAFYIATAPKGSAEGASPIA
                     TMPRLLVAAPAYVEWHGLPAELDDLARHRCLVYTRGIAPNEWRFSPAGGDGKERAVHV
                     TGSFRCNHSLTLREALLEGAGIALLPAFLVLDDLAAGHLHAVLPDWCPQARTLYAAYP
                     QPRRSSPKVREFVSLVSRRFDFGTSFPLRMRDS"
     misc_feature    complement(271779..272666)
                     /locus_tag="CNE_BB2p02660"
                     /note="LysR family transcriptional regulator; Provisional;
                     Region: PRK14997"
                     /db_xref="CDD:184959"
     misc_feature    complement(272478..272657)
                     /locus_tag="CNE_BB2p02660"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(271800..272393)
                     /locus_tag="CNE_BB2p02660"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(271854..271856,271935..271937,
                     271986..271988,272181..272183,272187..272189,
                     272232..272234,272349..272351,272361..272363))
                     /locus_tag="CNE_BB2p02660"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(271959..271961,271968..271973,
                     271992..272006,272100..272102,272286..272306,
                     272310..272312,272322..272324,272331..272336,
                     272340..272345,272355..272360))
                     /locus_tag="CNE_BB2p02660"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            272798..274360
                     /locus_tag="CNE_BB2p02670"
                     /db_xref="GeneID:10920351"
     CDS             272798..274360
                     /locus_tag="CNE_BB2p02670"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein 17"
                     /protein_id="YP_004682919.1"
                     /db_xref="GI:339324026"
                     /db_xref="GeneID:10920351"
                     /translation="MGEPLTMTRKSFLRLSGAGIVAAAVGGTAGAQDVLAPRIQGVAP
                     PAMDTPRRTLIRHADVLTMDPQFRELHGVDVLIDNGRIAAIGKGLAAADAETIDATGM
                     ILMPGMVDGHRHLWQCMDAGRLIKMDPSGYSRAYLGWQRRAMACMTPEDNYLAELIGG
                     LQAIDAGVTTVLDFAHGQPSEETALAAARGVRDSGVSGWFTYQLGRAVAFGPGSTISM
                     ARVHADLNTTTEQSWKTVARLQKEVFSDSSAVLQLGLAPSDATGRPVGEVRKEWERVR
                     ASGVKILAAHLHKPATPTAPGTIGHRDSGIRDLYEAGLLGSDYHASHGNRVTAAELEL
                     LRETGGMLCSTVVGEFPYMLTPHMMASCHGRARHAGVAAGIGIDGPLVVQQDFFEHVR
                     GAFLSLFLEPEGRDLVRAYKSQDSLDFATALGARAVRLGDEIGSVAVGKRADLVLLRT
                     DRIGFAMQGSVADRVANFASLADVDSVWIAGKPRKRNGKMLGVNWSRLKTDLAAAQQR
                     LAARMATVNFTA"
     misc_feature    272945..274300
                     /locus_tag="CNE_BB2p02670"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08204"
                     /db_xref="CDD:181288"
     misc_feature    272954..274270
                     /locus_tag="CNE_BB2p02670"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(273131..273133,273137..273139,273764..273766,
                     273929..273931)
                     /locus_tag="CNE_BB2p02670"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            274555..275628
                     /locus_tag="CNE_BB2p02680"
                     /db_xref="GeneID:10920352"
     CDS             274555..275628
                     /locus_tag="CNE_BB2p02680"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004682920.1"
                     /db_xref="GI:339324027"
                     /db_xref="GeneID:10920352"
                     /translation="MKHNARIVLAHACAVSALASLAPAAHAQSSVTLYGVADTFLEYN
                     NHQRAPAGTASSGGSLVRLNSGGLAGSRWGLRGTEDLGGGMQAIFALESGFNLDTGTM
                     GEAGRLFNRQAFLGVSTKDFGRLTFGRQYTSMFDLLPVFMPLVYAGAYEPMPFLMSPL
                     RIDNAVKYRVDRGPFAAQAHYGFGEQAGSWQGDAAWGGGVSYTSGELGLAAVYDQVNG
                     RDTATGYGRMRKVAVAGTYAPGDWRFTTGYRWAQDTMPTGVTRQRDDMWWAGVGYRVT
                     PFFQVNAAFYYDRMKVREGQANPPNPKQYVLQGIYAASKRTDLYAAVAYARDAGLNFA
                     ALSTLAAGARSQTGAAVGIRHKF"
     misc_feature    274639..275625
                     /locus_tag="CNE_BB2p02680"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(274639..274641,274645..274647,274663..274665,
                     274669..274677,274783..274797,274813..274815,
                     274819..274827,274831..274833,274837..274848,
                     274882..274887,274891..274905,274933..274941,
                     275035..275037,275041..275046,275491..275496,
                     275503..275505,275611..275613,275617..275619,
                     275623..275625)
                     /locus_tag="CNE_BB2p02680"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(274660..274662,274768..274770,274885..274887,
                     274978..274980,275035..275037)
                     /locus_tag="CNE_BB2p02680"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            276300..277877
                     /locus_tag="CNE_BB2p02690"
                     /note="TonB-dependent outer membrane receptor"
                     /pseudo
                     /db_xref="GeneID:10920353"
     gene            278258..278605
                     /locus_tag="CNE_BB2p02720"
                     /db_xref="GeneID:10920354"
     CDS             278258..278605
                     /locus_tag="CNE_BB2p02720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682921.1"
                     /db_xref="GI:339324028"
                     /db_xref="GeneID:10920354"
                     /translation="MDMKQMTLATGADQGAGFEQYRKPTRREAFLATMETIVPWAALC
                     AVIEPCYPKAGNGRPPIGLERMLRIHFLQHWFNLPDLACEEALYDSGCGRQEGNGQQS
                     CSHEGGAEESGAH"
     misc_feature    278426..>278527
                     /locus_tag="CNE_BB2p02720"
                     /note="Transposase domain (DUF772); Region: DUF772;
                     pfam05598"
                     /db_xref="CDD:253271"
     gene            278924..279000
                     /gene="trnM1"
                     /locus_tag="CNE_BB2p02730"
                     /note="tRNA-Met-CAT"
                     /db_xref="GeneID:10920355"
     tRNA            278924..279000
                     /gene="trnM1"
                     /locus_tag="CNE_BB2p02730"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:10920355"
     gene            complement(279111..279485)
                     /locus_tag="CNE_BB2p02740"
                     /db_xref="GeneID:10920356"
     CDS             complement(279111..279485)
                     /locus_tag="CNE_BB2p02740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682922.1"
                     /db_xref="GI:339324029"
                     /db_xref="GeneID:10920356"
                     /translation="MATARAGTRGEALKLLETEGVTVVELDYESGWQDAVELGRLGQK
                     VGIRVEYRGHENIAVRSPAALVAGLLRPKTTFRQRNLYCQFELNNLPADELESLEAKA
                     AKLGDYILAGHLMREVDAQWTE"
     gene            279890..280027
                     /locus_tag="CNE_BB2p02750"
                     /db_xref="GeneID:10920357"
     CDS             279890..280027
                     /locus_tag="CNE_BB2p02750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682923.1"
                     /db_xref="GI:339324030"
                     /db_xref="GeneID:10920357"
                     /translation="MSLTRQAGTSIAAIMPVLHRDQFVGQQAVQLIWFEIIDILRIAK
                     Q"
     gene            280259..280462
                     /gene="cspA"
                     /locus_tag="CNE_BB2p02760"
                     /db_xref="GeneID:10920358"
     CDS             280259..280462
                     /gene="cspA"
                     /locus_tag="CNE_BB2p02760"
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock-like protein CspA"
                     /protein_id="YP_004682924.1"
                     /db_xref="GI:339324031"
                     /db_xref="GeneID:10920358"
                     /translation="MATGTVKWFNDAKGFGFITPDDGGDDLFAHFSEVQGNGFKSLQE
                     GQKVSFEVKQGPKGKQAANIKPL"
     misc_feature    280265..280456
                     /gene="cspA"
                     /locus_tag="CNE_BB2p02760"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    order(280280..280282,280307..280309,280340..280342,
                     280427..280429)
                     /gene="cspA"
                     /locus_tag="CNE_BB2p02760"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(280298..280318,280337..280348)
                     /gene="cspA"
                     /locus_tag="CNE_BB2p02760"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            complement(280851..280882)
                     /gene="rpoD"
                     /locus_tag="CNE_BB2p02770"
                     /note="RNA polymerase sigma 70 (sigma D) factor RpoD"
                     /pseudo
                     /db_xref="GeneID:10920359"
     gene            complement(282893..283201)
                     /locus_tag="CNE_BB2p02790"
                     /db_xref="GeneID:10920360"
     CDS             complement(282893..283201)
                     /locus_tag="CNE_BB2p02790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682925.1"
                     /db_xref="GI:339324032"
                     /db_xref="GeneID:10920360"
                     /translation="MNYESGWQDAIELGRLGEKLGVHVHYRGHESIAVSSPAALVGGL
                     SRPKLTFRQLNLYCQFELSKLPAGELERLEALSSPSACVRRCAVPVRTISGRALRRNR
                     "
     gene            283806..284288
                     /locus_tag="CNE_BB2p02800"
                     /db_xref="GeneID:10920361"
     CDS             283806..284288
                     /locus_tag="CNE_BB2p02800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682926.1"
                     /db_xref="GI:339324033"
                     /db_xref="GeneID:10920361"
                     /translation="MVAPTKTTRVSATAKGKPTAKKLVVPTKKASVLAREAQAAKKHL
                     LKLRADTKKAIEAAKREVAQAVEAAKAAARFEKQAAKDKLAAKKAKAAGAKKATGNKA
                     VATKAVATKAAAKKAASGGKVKVAAKAAPKAAAVKSMPKKRASAKKVVPAVASPVASA
                     "
     gene            284381..284459
                     /gene="trnM2"
                     /locus_tag="CNE_BB2p02810"
                     /note="tRNA-Met-CAT"
                     /db_xref="GeneID:10920362"
     tRNA            284381..284459
                     /gene="trnM2"
                     /locus_tag="CNE_BB2p02810"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:10920362"
     gene            284896..285210
                     /locus_tag="CNE_BB2p02820"
                     /db_xref="GeneID:10920363"
     CDS             284896..285210
                     /locus_tag="CNE_BB2p02820"
                     /codon_start=1
                     /transl_table=11
                     /product="H-NS histon-like DNA-binding protein"
                     /protein_id="YP_004682927.1"
                     /db_xref="GI:339324034"
                     /db_xref="GeneID:10920363"
                     /translation="MATYQDLLAQKQALEAKIEEARSTEVAGVIEQIRELMVRYSLSP
                     EDVAPRRRRGRPASTASAATEKAPLPPKYMDPKTGKTWSGRGRTPAWLGKRPERFLIQ
                     QE"
     misc_feature    284908..285171
                     /locus_tag="CNE_BB2p02820"
                     /note="H-NS histone family; Region: Histone_HNS;
                     pfam00816"
                     /db_xref="CDD:250154"
     misc_feature    285091..285198
                     /locus_tag="CNE_BB2p02820"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; cl19571"
                     /db_xref="CDD:267924"
     gene            complement(285890..286705)
                     /locus_tag="CNE_BB2p02830"
                     /db_xref="GeneID:10920365"
     CDS             complement(285890..286705)
                     /locus_tag="CNE_BB2p02830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682928.1"
                     /db_xref="GI:339324035"
                     /db_xref="GeneID:10920365"
                     /translation="MNHGEGLTTRDLETRLGASRRLISSLVAAGLVTPARGPRGQYVF
                     SFQDVVLIRTAESLHRSSVAPARILRALRRLERLTPNRHLSALRISASSGKISAWDRH
                     GAWLVESGQRLIEFGPDEADVRVVDLTRTRANQATAEEAFARGYALEPVDADAAEAAY
                     RRALEISPGMLNAYLNLGCMLADQERFDEAIRLYEGALSVLPNAPQLHFNLGVAREDV
                     GALQSALAAYERCIELAPDDADAHYNAARLHQELGHFQNALRHFNAFRKLDRP"
     misc_feature    complement(286100..286294)
                     /locus_tag="CNE_BB2p02830"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(285893..286192)
                     /locus_tag="CNE_BB2p02830"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(285950..285955,285962..285967,
                     285974..285979,286055..286060,286067..286072,
                     286076..286081,286166..286171,286178..286183,
                     286187..286192))
                     /locus_tag="CNE_BB2p02830"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(285998..286189)
                     /locus_tag="CNE_BB2p02830"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(285911..285913,285920..285922,
                     285932..285934,285968..285970,286013..286015,
                     286022..286024,286034..286036,286070..286072,
                     286115..286117,286124..286126,286136..286138,
                     286172..286174))
                     /locus_tag="CNE_BB2p02830"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(285899..286081)
                     /locus_tag="CNE_BB2p02830"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     gene            complement(286702..287595)
                     /locus_tag="CNE_BB2p02840"
                     /db_xref="GeneID:10920366"
     CDS             complement(286702..287595)
                     /locus_tag="CNE_BB2p02840"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
                     /protein_id="YP_004682929.1"
                     /db_xref="GI:339324036"
                     /db_xref="GeneID:10920366"
                     /translation="MPARSLASLSLSFGLVSIPVKLYTATETSSAVRFNLLSKDGARL
                     KQQYVSEQTQKVVERADMVKGYEFEKDRFVTFSPDELKALEESASHMVDIVAFIPEHS
                     VDPLYYDKAYFIAPDKRGGKPYSLLREAMSKTGRCAIAKWASKGKSHIVQIRPVEGGL
                     VFQQLLFADEVRNIAELHIEEVAVSDAELKLAMQLIEQASEGQYDPAQYKDEEKVRIL
                     AAIDAKIAGKQIVSPEPVEVTAGGQVIDLMDALRASLSKKGAPAGRAKAAEPSTSRRV
                     GKRGTAPSEPTPIRRNTKKSA"
     misc_feature    complement(286771..287595)
                     /locus_tag="CNE_BB2p02840"
                     /note="Ku-homolog [Replication, recombination, and
                     repair]; Region: COG1273"
                     /db_xref="CDD:224192"
     misc_feature    complement(286819..287586)
                     /locus_tag="CNE_BB2p02840"
                     /note="Ku-core domain, Ku-like subfamily; composed of
                     prokaryotic homologs of the eukaryotic DNA binding protein
                     Ku. The alignment includes the core domain shared by the
                     prokaryotic YkoV-like proteins and the eukaryotic Ku70 and
                     Ku80. The prokaryotic Ku...; Region: KU_like; cd00789"
                     /db_xref="CDD:238408"
     misc_feature    complement(order(287161..287163,287452..287454,
                     287494..287496,287524..287526,287581..287583))
                     /locus_tag="CNE_BB2p02840"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238408"
     misc_feature    complement(order(286831..286833,286840..286842,
                     286924..286926,286963..286971,286984..286986,
                     286999..287001,287080..287082,287086..287094,
                     287173..287175,287230..287232,287272..287274,
                     287302..287307,287311..287313,287368..287370,
                     287377..287382,287392..287397,287401..287403,
                     287407..287415,287425..287427,287443..287451,
                     287455..287466,287473..287475,287485..287496,
                     287512..287526,287545..287547))
                     /locus_tag="CNE_BB2p02840"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238408"
     gene            complement(287627..290149)
                     /locus_tag="CNE_BB2p02850"
                     /db_xref="GeneID:10920367"
     CDS             complement(287627..290149)
                     /locus_tag="CNE_BB2p02850"
                     /EC_number="6.5.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP dependent DNA ligase"
                     /protein_id="YP_004682930.1"
                     /db_xref="GI:339324037"
                     /db_xref="GeneID:10920367"
                     /translation="MATTPGTSKARARTAERLPNLDRYQKKRNFSVTSEPAGTRQRLQ
                     KANPLRFVVQKHWARRLHYDFRLELDGVLLSWAVPKGPSYDPSEKRIAVHVEDHPLDY
                     ANFEGEIPAKQYGAGSVIVWDRGTWEPIGDPREGMAAGKLLFDLYGEKLAGRWELVRI
                     AKPGDQSEQWILFKKRDAWARPLAEFDVLAALPDSVIAKPLGTLTQASQGSTEMASDS
                     AITDAPLAPLPAKLGPQLANPAPALPTGTGWVIETKFDGYRILARISDARVTLFTRNG
                     HDWTRMLRSLAAEIEKLDISEGWLDGEIVVLRDGMPDFNALQNAIDGHRSDAIVFFAF
                     DLPFWEGRDLRNVPLAQRRAKLGELVGDRSERVRFSEAFDAPPAQIFLAACQLGLEGL
                     MFKRADASYVSARTQTWLKAKCKLRQEFVIGGFSDRSGAVAEVGKLLLGVYADGELRY
                     VGGVGTGWDSATATELRRRLAALEIERSPFSTEARSSRRWGGGREAAVRWVKPTLVAE
                     VEFSEWTPEGQVRQASFKGLRADHPAKSIRREAIQTTVTPHGVSAIKVTNPDRVIDKS
                     TGITKVELVRYYESVAERMLPHLKDRPLSLVRAPDGIDAPTFFQKHAETAMPGLTEQP
                     QSLWPGHAALLTADSAEAIVAAAQMNAVEFHTWNSTARHIECPDRVIFDLDPGEGIAW
                     ETMVEAAMLVRTLLDELGLQSWLKTSGGKGLHVAVPLAPQRSYDEVKAFSRAAVKHLA
                     ATLPQRFTARSGAANRKGRIFVDYLRNGFSQTTAAAFSARARPGLGVSMPVSWEQLTK
                     LKSGAQWTIRDAREYLSFQVADPWQSYWEARQSLTAAIERLS"
     misc_feature    complement(287633..290092)
                     /locus_tag="CNE_BB2p02850"
                     /note="ATP-dependent DNA ligase; Reviewed; Region: ligD;
                     PRK05972"
                     /db_xref="CDD:235658"
     misc_feature    complement(289616..290089)
                     /locus_tag="CNE_BB2p02850"
                     /note="DNA ligase D, 3'-phosphoesterase domain; Region:
                     LigD_PE_dom; TIGR02777"
                     /db_xref="CDD:131824"
     misc_feature    complement(288908..289450)
                     /locus_tag="CNE_BB2p02850"
                     /note="Adenylation domain of Mycobacterium tuberculosis
                     LigD and LigC-like ATP-dependent DNA ligases; Region:
                     Adenylation_DNA_ligase_LigD_LigC; cd07906"
                     /db_xref="CDD:185715"
     misc_feature    complement(order(288917..288919,288923..288925,
                     288965..288967,288971..288973,288980..288982,
                     289148..289150,289208..289210,289241..289243,
                     289328..289330,289373..289381,289385..289396))
                     /locus_tag="CNE_BB2p02850"
                     /note="active site"
                     /db_xref="CDD:185715"
     misc_feature    complement(order(288911..288913,288917..288919,
                     288980..288982,289190..289198,289205..289210,
                     289313..289315,289319..289321,289325..289333,
                     289373..289381,289388..289390))
                     /locus_tag="CNE_BB2p02850"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:185715"
     misc_feature    complement(288539..288901)
                     /locus_tag="CNE_BB2p02850"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain of ATP-dependent DNA ligase LigD is a
                     DNA-binding module that is part of the catalytic core
                     unit; Region: OBF_DNA_ligase_LigD; cd07971"
                     /db_xref="CDD:153440"
     misc_feature    complement(order(288578..288580,288584..288589,
                     288593..288595,288770..288787,288791..288796,
                     288842..288844))
                     /locus_tag="CNE_BB2p02850"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:153440"
     misc_feature    complement(287762..288439)
                     /locus_tag="CNE_BB2p02850"
                     /note="PaeLigD_Pol_like: Polymerase (Pol) domain of
                     bacterial LigD proteins similar to Pseudomonas aeruginosa
                     (Pae) LigD. The LigD Pol domain belongs to the
                     archaeal/eukaryal primase (AEP) superfamily. In
                     prokaryotes, LigD along with Ku is required for...;
                     Region: PaeLigD_Pol_like; cd04862"
                     /db_xref="CDD:240132"
     misc_feature    complement(order(287804..287812,287834..287836,
                     287852..287854,287861..287863,288008..288010,
                     288014..288019,288026..288028,288125..288127,
                     288131..288133,288185..288187,288323..288325))
                     /locus_tag="CNE_BB2p02850"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240132"
     gene            290537..291502
                     /locus_tag="CNE_BB2p02860"
                     /db_xref="GeneID:10920368"
     CDS             290537..291502
                     /locus_tag="CNE_BB2p02860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682931.1"
                     /db_xref="GI:339324038"
                     /db_xref="GeneID:10920368"
                     /translation="MCYSAQIHASYRKYVREFGASVSFEHFVELFWEKRRDGGWSKLP
                     KAMRAAFLSAASDKERAVADLVAAGDKDQARALETELFQQKTRLTGAERALAAKPTKK
                     AENDQRIATDKIARAQRNLADLQRADLMDRDSRIFPGHYAPVMVVQDGQRVVIPMRYQ
                     CRLPGWTPAMERQKLGSYNARRDNLKKAWRQLYGYKHGIMIVNAFYENVARHRMEQRE
                     LAPGEPEENVVLEFRPEPRQDMLVACLWSFSKGGEGEADLYSFAAITDEPPAEVSAAG
                     HDRCIVPVKPEHVEAWLNPDAKNLAALDAILDDRNQPYYEHQLAA"
     misc_feature    290942..291490
                     /locus_tag="CNE_BB2p02860"
                     /note="Uncharacterized ACR, COG2135; Region: DUF159;
                     pfam02586"
                     /db_xref="CDD:251395"
     gene            291572..292018
                     /locus_tag="CNE_BB2p02870"
                     /db_xref="GeneID:10920369"
     CDS             291572..292018
                     /locus_tag="CNE_BB2p02870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682932.1"
                     /db_xref="GI:339324039"
                     /db_xref="GeneID:10920369"
                     /translation="MRVGRPIPAPPQPLCDYCGGKAVLARVGEEAYPYLEDHGPVWIC
                     SPCQAWIGVRARSKQHTPLGRLADAALREKKSRLHDALEPLVTAKMRRDGVNAFEARG
                     KAMKWLIASLHIPVDSPSIHALSLDQCEQAIQFIAEFQASRGREPS"
     misc_feature    291614..291919
                     /locus_tag="CNE_BB2p02870"
                     /note="Protein of unknown function (DUF3268); Region:
                     DUF3268; pfam11672"
                     /db_xref="CDD:152108"
     gene            complement(292039..295188)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /db_xref="GeneID:10920370"
     CDS             complement(292039..295188)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase DnaE"
                     /protein_id="YP_004682933.1"
                     /db_xref="GI:339324040"
                     /db_xref="GeneID:10920370"
                     /translation="MDINAAAGLPAYAELHCRSNFSFLAGASRPEELAERAAQLGYHA
                     LAITDECSLAGIVRAHTEARNAGLRLVVGAWFRLQNADGSPALSFLALARNREGYGNL
                     CELITLARMRAAKGFYVLTPRDLTAPEAPSEHLKGLPDCLIVFTPDYGVAAEKLEAQS
                     AWVSATFAGRAWMGLSLLYKPMDDIHRGTVEAAAARHHLRIVATGNVTMHVRSRKPMH
                     DVLTAIRVHRPVPECGYDLLPNAEQHLRSRLRLANIYPHRYLTESVHIANLCQFSLDE
                     LRYEYPEEVVPDGVTPSDYLRGEAYVGAQRRYPDGIPLAVQQQLEHELALIRDMAYEP
                     YFLTVYDIVRFARSNGILCQGRGSAANSAVCYCLGITEVDPARGNLLFERFISKERAE
                     PPDIDVDFEHQRREEVIQYLYRKYGRDRAALAAAVTTYRPRSALRDTGKALGVDPAIV
                     DLVAKSHHWFDSKADLLKRFGESGLDPDAELSQRWAHMAVSLLGFPRHLSQHTGGFVL
                     ARGKLSRLVPIENAAMADRSVIQWDKDDLDTLGLLKVDVLALGMLSAIRRALDLVMQQ
                     RGEAFELQDIPAEDPKTYEMISRADTVGVFQIESRAQMSMLPRLKPRTFYDLVIEVAI
                     VRPGPVQGGMVHPYLRRRQGLEPVSYPSPEMEQALSRTLGVPIFQEQVMQVAMLAAGF
                     SAGEADQLRRAMAAWKRKGGLERYHERIVTGMLERGYDPEFAESIFRQIQGFGEYGFP
                     ESHAASFALLVYASAWLKCHEPAAFLCAMLNSQPMGFYTPSQLVQDAKRHGVTVLPVD
                     VTVSGWDASLESHEGSVLAVRLGLSQLRGMRREAAERIETTRALRPFASVKDLARRAS
                     LDRHDANVLAAGNALIGLTGSRRQAMWQAAAAVPDKDLLRPADLDEPTPELPQPTEGE
                     EIVSDYRSLGLTLNRHPLALLRHKLAALRFVPADVLATYATRQIARACGIVTVRQRPS
                     TANGVVFLSLEDETGTVSVIVWPSVMEKYRREVLTASLLGVYGQWQCEGEVRHLIAQR
                     FVDLSPMLGSLDTASRNFC"
     misc_feature    complement(292045..295164)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="error-prone DNA polymerase; Validated; Region:
                     dnaE2; PRK05672"
                     /db_xref="CDD:235553"
     misc_feature    complement(294343..295155)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     alpha-subunit of bacterial polymerase III at DnaE2 gene;
                     Region: PHP_PolIIIA_DnaE2; cd07434"
                     /db_xref="CDD:213989"
     misc_feature    complement(order(294565..294567,294571..294573,
                     294964..294966,295039..295041,295114..295116,
                     295135..295137,295141..295143))
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="putative active site [active]"
                     /db_xref="CDD:213989"
     misc_feature    complement(order(294376..294378,294979..294987,
                     294997..294999))
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="putative PHP Thumb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213989"
     misc_feature    complement(293035..294309)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; pfam07733"
                     /db_xref="CDD:254393"
     misc_feature    complement(292543..292818)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:258717"
     misc_feature    complement(292084..292311)
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="DnaE_OBF: A subfamily of OB folds corresponding to
                     the C-terminal OB-fold nucleic acid binding domain of
                     Thermus aquaticus and Escherichia coli type C replicative
                     DNA polymerase III alpha subunit (DnaE). The DNA
                     polymerase holoenzyme of E. coli contains...; Region:
                     DnaE_OBF; cd04485"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(292093..292095,292147..292149,
                     292153..292155,292159..292161,292309..292311))
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(292108..292116,292135..292143,
                     292162..292164,292207..292209,292213..292221,
                     292237..292239,292243..292254,292288..292296))
                     /gene="dnaE"
                     /locus_tag="CNE_BB2p02880"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239931"
     gene            complement(295194..296657)
                     /locus_tag="CNE_BB2p02890"
                     /db_xref="GeneID:10920371"
     CDS             complement(295194..296657)
                     /locus_tag="CNE_BB2p02890"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase, Y family"
                     /protein_id="YP_004682934.1"
                     /db_xref="GI:339324041"
                     /db_xref="GeneID:10920371"
                     /translation="MLRLWICLRLSSLPLEVFRPNWSTELAVAVLDRERVHMASPLAI
                     AAGVKPAMRRGGVQTIAPQTILFDRDGCAELAALKRVTMAMLQFSPNVTASEEAAVLV
                     DISTTLRLFGGVRKLRQRMLAAVRAMGFNPVAGCAPTAEGAWLLARSGGGTALSMPTL
                     VRALVGMPVAILPAARPFDEWLDGLGCRTLGDLRRLPRAGLQRRCGAAILEALDRAHA
                     EAPEVFEWVEAPPSFDAAVDLPDRIENAESALAYIRGLLVQMVGWLTARHLAIKRFAV
                     ELCHERGRAAIAPTKIEIALAEPNWHEEHLVRLLKERLTRLTVEAPMIAVAVSAIETE
                     PVAPPSDSLFPEPGGTPADHARLLELLVARLGADHVRQPCLRADYRPEVANSWQPATD
                     KPPSATLPSGLPRPVWLLSKPMPLIERDHRPFYGSPLRIVSPPERIESGWWGGQLVTR
                     DYFVAEAKDHTCYWIFQERMGSRESDAARWYLHGLFG"
     misc_feature    complement(295662..296642)
                     /locus_tag="CNE_BB2p02890"
                     /note="DNA Polymerase Y-family; Region: PolY_like;
                     cd03468"
                     /db_xref="CDD:176458"
     misc_feature    complement(order(296205..296207,296361..296366,
                     296526..296528,296535..296537,296616..296621,
                     296628..296633))
                     /locus_tag="CNE_BB2p02890"
                     /note="active site"
                     /db_xref="CDD:176458"
     misc_feature    complement(295329..296432)
                     /locus_tag="CNE_BB2p02890"
                     /note="Nucleotidyltransferase/DNA polymerase involved in
                     DNA repair [DNA replication, recombination, and repair];
                     Region: DinP; COG0389"
                     /db_xref="CDD:223466"
     misc_feature    complement(order(295749..295751,295755..295769,
                     295857..295859,295944..295961,296037..296039,
                     296124..296144,296361..296363,296370..296372))
                     /locus_tag="CNE_BB2p02890"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176458"
     gene            complement(296584..297288)
                     /locus_tag="CNE_BB2p02900"
                     /db_xref="GeneID:10920372"
     CDS             complement(296584..297288)
                     /locus_tag="CNE_BB2p02900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682935.1"
                     /db_xref="GI:339324042"
                     /db_xref="GeneID:10920372"
                     /translation="MLSVAPETIHPSLWLASQLARGNARTVPTGYPSLDKELPGGGWP
                     ISCLTELLQRQPGIGELRLLRPALVARSNRPVALLAPPHAPQALALANWGVPSAQILW
                     VEARHTADALWAAEQILRAGTCGALVFWQSHLRNDALRRLHLAAQASDVLFFVVRPTA
                     CAHDASPAPLRLTLEPASDGIRVQFVKRRGPQQESPLNVALQPSPILLYRHAAPVDLP
                     TPVIPAPRSIPAELVH"
     misc_feature    complement(<296782..297231)
                     /locus_tag="CNE_BB2p02900"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4544"
                     /db_xref="CDD:226918"
     gene            297829..298773
                     /locus_tag="CNE_BB2p02910"
                     /db_xref="GeneID:10920373"
     CDS             297829..298773
                     /locus_tag="CNE_BB2p02910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682936.1"
                     /db_xref="GI:339324043"
                     /db_xref="GeneID:10920373"
                     /translation="MGGQGGRTLRTRVYVDGYNFYYGCLKGSRFKWLNLHALFENQIL
                     PSILHMGPGGSPDRHELRPVAVKYFTATIVETAAKGPDSVSSQDAYHTALENYCAGRL
                     QIIKGYFSVSQVRAPKVDHANPGKWPRHCERVDIWKFEEKQSDVQLALHAYHDALTGD
                     VDQVVIASNDTDLAPALQMIRDNTNVVVGLVNPTCDHRRPPNTSLVQLSHWTREHISE
                     QELAAAQLPRVVPRKRGVSLKPTSWYARPDLLTPALTLATKVRGSKGAAFKWLSTPNE
                     HLGGAVPLDLLESDEGAAAVITYMEDWIAKHPKSGDME"
     misc_feature    297859..298470
                     /locus_tag="CNE_BB2p02910"
                     /note="LabA_like proteins; Region: LabA_like; cd06167"
                     /db_xref="CDD:199895"
     misc_feature    order(297874..297876,297883..297885,298261..298263,
                     298330..298332,298336..298338,298342..298344)
                     /locus_tag="CNE_BB2p02910"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     misc_feature    <298246..>298374
                     /locus_tag="CNE_BB2p02910"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     misc_feature    298594..298725
                     /locus_tag="CNE_BB2p02910"
                     /note="Protein of unknown function (DUF2384); Region:
                     DUF2384; pfam09722"
                     /db_xref="CDD:255508"
     gene            299195..299820
                     /locus_tag="CNE_BB2p02920"
                     /note="transposase protein"
                     /pseudo
                     /db_xref="GeneID:10920374"
     gene            299997..300773
                     /locus_tag="CNE_BB2p02940"
                     /db_xref="GeneID:10920375"
     CDS             299997..300773
                     /locus_tag="CNE_BB2p02940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682937.1"
                     /db_xref="GI:339324044"
                     /db_xref="GeneID:10920375"
                     /translation="MHMLTCHSQLSLFSSPLGRESATTGPALLLLACSGTKLDRPAPA
                     MDLYQGVMYESYRAHVRPEASPNVLILSARHGFIDPRDVIAPYDQRMTTQRADEILAD
                     LPAFAASADWPTQVGKVLLAGGKEYRRVMRAALVRQYGALPLTVHETTGGIGTQRSQL
                     GTFLDGLPSVFRDQIGQHANGTPIYRSYGWIEAGSIATLLYRAAPALPARQARVLSVF
                     NGPSGPTADVEVEEFVRGRAKICPRWVSVADLHPSTEESA"
     misc_feature    <300102..>300314
                     /locus_tag="CNE_BB2p02940"
                     /note="Protein of unknown function (DUF328); Region:
                     DUF328; cl01143"
                     /db_xref="CDD:260809"
     gene            300877..301101
                     /locus_tag="CNE_BB2p02950"
                     /db_xref="GeneID:10920376"
     CDS             300877..301101
                     /locus_tag="CNE_BB2p02950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682938.1"
                     /db_xref="GI:339324045"
                     /db_xref="GeneID:10920376"
                     /translation="MGEGRQPPLPPEKRYALLQEIMRYCAWECLLACCFASEDRLERI
                     ADMLDASYPRYACTRGRLAARRNRYGRPGF"
     gene            301140..302135
                     /locus_tag="CNE_BB2p02960"
                     /db_xref="GeneID:10920377"
     CDS             301140..302135
                     /locus_tag="CNE_BB2p02960"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004682939.1"
                     /db_xref="GI:339324046"
                     /db_xref="GeneID:10920377"
                     /translation="MWDGANSVYNCGMTRMDSLWLTNPTQAYRDWQAREAAGADRRPF
                     SARSIVQHQAMFEHFRRHLVVRGATIASFGTADVDAFWQSPDGRNYSQATRTRYVMLL
                     DRLCRHLVFTGVRLDNPAAPLLSAERWPDQEPTPLFLTAAEDARLQAYLLSPPDDVAG
                     LRSRAIVAAFLGTGITAGEARAARLADLWPDATPPYLVVRAHGPRDARTVHLASFAVP
                     ILRAWSARRATLPLDGDLLFTLTPDGRPITDMSLGRIVATALAEIGFSGAEPSPRTLR
                     NTFCRRQLLAGHSCDEVSQMLGLVSNRTCDRIAATLMPEAKRCETLQAAPAEANE"
     misc_feature    301338..301976
                     /locus_tag="CNE_BB2p02960"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(301665..301667,301743..301745,301956..301958,
                     301965..301967)
                     /locus_tag="CNE_BB2p02960"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(301665..301667,301956..301958,301965..301967)
                     /locus_tag="CNE_BB2p02960"
                     /note="active site"
                     /db_xref="CDD:238231"
     misc_feature    order(301665..301670,301743..301745,301950..301958)
                     /locus_tag="CNE_BB2p02960"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     gene            302333..302782
                     /locus_tag="CNE_BB2p02970"
                     /db_xref="GeneID:10920378"
     CDS             302333..302782
                     /locus_tag="CNE_BB2p02970"
                     /codon_start=1
                     /transl_table=11
                     /product="histone-like protein"
                     /protein_id="YP_004682940.1"
                     /db_xref="GI:339324047"
                     /db_xref="GeneID:10920378"
                     /translation="MATKAKPVAKTATKTAAKKAAPAKKDTPVTKAAPAKKAASAAPV
                     AKPLKDTFNKSSLLAHLIAQTELDKKTVQTVLAHLENTIVSAIHKKGAGEFTFPGLFK
                     VSAIQVPATKKRFGKNPFTGQDQWFAAKPASVKVKVRAMKKLKDAAM"
     misc_feature    302489..302770
                     /locus_tag="CNE_BB2p02970"
                     /note="DNA-binding proteins similar to HU domains; Region:
                     HU_like; cd13834"
                     /db_xref="CDD:259856"
     misc_feature    order(302492..302497,302612..302614,302618..302626,
                     302639..302641,302645..302647,302657..302659,
                     302663..302668,302729..302731,302735..302737,
                     302741..302758,302765..302767)
                     /locus_tag="CNE_BB2p02970"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259856"
     misc_feature    order(302501..302503,302510..302515,302522..302524,
                     302549..302560,302564..302572,302576..302584,
                     302588..302593,302609..302623,302639..302641,
                     302732..302740,302744..302746,302750..302752,
                     302762..302767)
                     /locus_tag="CNE_BB2p02970"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259856"
     gene            complement(302851..304617)
                     /gene="rme"
                     /locus_tag="CNE_BB2p02980"
                     /db_xref="GeneID:10920379"
     CDS             complement(302851..304617)
                     /gene="rme"
                     /locus_tag="CNE_BB2p02980"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-phosphoadenosine 5'-phosphosulfate
                     sulfotransferase (PAPS reductase)/FAD synthetase Rme"
                     /protein_id="YP_004682941.1"
                     /db_xref="GI:339324048"
                     /db_xref="GeneID:10920379"
                     /translation="MQTISLFPQGAFDPIEDKADQAIRAALAILEAGHPLVLAYSGGK
                     DSSMVAALALHAAALYHAAGGKPLVVATTGDTLVESPEVAHHYRQELVRMRRFGKQHG
                     FDVITRVVQPSMALTFQVKIFSGRALPSFPGTHGDCSTDLKIAPQRTFRRQLFRSLAG
                     QGRAEPVTLLGTRYAESARRSASMRQRGDSANVPVRNQDSEFVLSPVCDWSDDDIWEG
                     IALYGGSARPCYSDFEDMRRIYAHAAGTSCAVVADAILDGAGSSRPRKCGARLGCHVC
                     QMAEDKSLASMVEYDERYAYAAGLQRLNRFIRNTRFDWSRRHWVGRTISGGYIKIQPD
                     TYHPRMVRELVRYMLQLDYDEQCRAEQAGERPKFELLPLDMLIAVDALQSLNGLGRPF
                     AAWADWRDIHQRGVRYDIPDVSQVAQTAVPTARFLHVGAEWDDTAAPSDWTGLRNPYL
                     ESFTADSPCGPKLQVTTGGRELWALPTAQQFSVDPESALLISEFEVDRLLDVHDAGLA
                     PGQVTAGYRWYAQYGCLTLSHAQRGEHDEIARRTAYKDRLGLTLEYDVGALRSRAVPF
                     EDLPATSQLAWRQAATPQQSLF"
     misc_feature    complement(303430..304515)
                     /gene="rme"
                     /locus_tag="CNE_BB2p02980"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:260331"
     misc_feature    complement(order(304393..304395,304402..304404,
                     304480..304491,304498..304503))
                     /gene="rme"
                     /locus_tag="CNE_BB2p02980"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            complement(304690..304887)
                     /locus_tag="CNE_BB2p02990"
                     /db_xref="GeneID:10920380"
     CDS             complement(304690..304887)
                     /locus_tag="CNE_BB2p02990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682942.1"
                     /db_xref="GI:339324049"
                     /db_xref="GeneID:10920380"
                     /translation="MNLIVDIDIGGRTFQGTAGPAEAAQHLRQLANEIERKVVDFSAC
                     REGKRLGGAEGGCAIAYLADL"
     gene            complement(304897..305172)
                     /locus_tag="CNE_BB2p03000"
                     /db_xref="GeneID:10920381"
     CDS             complement(304897..305172)
                     /locus_tag="CNE_BB2p03000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682943.1"
                     /db_xref="GI:339324050"
                     /db_xref="GeneID:10920381"
                     /translation="MSKIMISAEHAAKLLPRGKKVHTFFKVFGWMGADVDRTKVLAAF
                     ESAQRVEVSPDAACFGHELAVELDGMQTYIDTNQKALRKLVPKAVDA"
     gene            complement(305325..305507)
                     /locus_tag="CNE_BB2p03010"
                     /db_xref="GeneID:10920382"
     CDS             complement(305325..305507)
                     /locus_tag="CNE_BB2p03010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682944.1"
                     /db_xref="GI:339324051"
                     /db_xref="GeneID:10920382"
                     /translation="MNHIPMAVKAELDALREFRKVPAAAYIYVETNAAELAKWDATGE
                     SVSDIADLVLDIVAAR"
     gene            complement(305591..307918)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /db_xref="GeneID:10920383"
     CDS             complement(305591..307918)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease subunit C"
                     /protein_id="YP_004682945.1"
                     /db_xref="GI:339324052"
                     /db_xref="GeneID:10920383"
                     /translation="MRPLKLTLAGFHGVRDGMRRDSVTLDLTTLPPGLIALVGPNGAG
                     KTTLMDNLHPYPIMPSHASKMSADAFSYWDHLCGTRGEKDLEWEHAGKQYRSAFAFRN
                     PGKSRKAEYYLFERGANGDWVPLQLPDGTLSDGKADTYNRCIEAVMGSPEAFFTSVFS
                     AQNRRPIASYQASEIKKLLAELLGIDHLRDLSAKAGEVSKGLVRHLDALQRELVGLSA
                     QRERAARLGREIDQTDAALAVARRDRDGQTADGAKLLQERATLAAKQSASAATEARLR
                     ELRQRETELGARRRQLEADQRALAARSATRRRELEQLIASRKLVLAEGPAILAAAEQR
                     DVLQMAIGQKQGEFATQQQAVGRLEAQHTQHAALSTELQGLEARGKSAALFATSLKGQ
                     ADVIETVPCRADPMHATCPLLAQARDAKGKLAEQVILVQDLRTSYQAKVQAMKPMAEA
                     VALLPAQRAALAAMQSALARDQQELQRLTALAAKKPMLDVAQEGLAQAERDLAALTGE
                     AAASTARHDRDLAEAASQLSLVQRELSGLATEDVTGLLAAMDVRLRQSREAVVALDAR
                     IEALIRQQTSLTTECERVETVLSSLPAVQGKADRLSDEIAQWKLLAKALGNDGVIALS
                     IDDAGPALTRIVNDLLLACYGPRFTIAIQTQTTLANGDKREGFEIEVHDAESDSAKNF
                     AVMSGGQKIWINECLTRGIALYRAQDSGQSFQTLFTDEADGPLDPERKRAFMRMKREV
                     LRQGRYVREFFISHTPDLVDEADGAIDVASLAVAP"
     misc_feature    complement(305609..307918)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: SbcC; COG0419"
                     /db_xref="CDD:223496"
     misc_feature    complement(<307769..307906)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    complement(<307670..307816)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(307781..307804)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(307781..307804)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(307694..307696,307778..307786,
                     307790..307795))
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(307778..307786,307790..307795))
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(307694..307705)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(307670..307678,307685..307693))
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(305615..>305866)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(order(305825..305836,305849..305866))
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(305759..305776)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(305741..305752)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(305651..305671)
                     /gene="sbcC"
                     /locus_tag="CNE_BB2p03020"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(307906..308424)
                     /locus_tag="CNE_BB2p03030"
                     /db_xref="GeneID:10920384"
     CDS             complement(307906..308424)
                     /locus_tag="CNE_BB2p03030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682946.1"
                     /db_xref="GI:339324053"
                     /db_xref="GeneID:10920384"
                     /translation="MMLYPAGPDWAHTFQTALAAPTLAARLADAHGFTRSTQFQPFGT
                     GRGAVIAQRDHLLVLAVHAADDQHWYEVTPSLEMQNLLWSFSHGYASQWSALELKALS
                     GCTAWPDVIALARQQFAAVVRSLERALAGLPERDEPAIVPDMPSYDGDVMELPGDYLA
                     SMTGVEVSECAH"
     gene            complement(308585..310006)
                     /gene="yhaO"
                     /locus_tag="CNE_BB2p03040"
                     /db_xref="GeneID:10920385"
     CDS             complement(308585..310006)
                     /gene="yhaO"
                     /locus_tag="CNE_BB2p03040"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease YhaO"
                     /protein_id="YP_004682947.1"
                     /db_xref="GI:339324054"
                     /db_xref="GeneID:10920385"
                     /translation="MLKAAESLLLAHFSDLHYSTGHLAEADRCFGFAVEHAIAVGSRV
                     GIVSGDSTDHRLDAHTPALRVLAERIRQLSGHMPVVMLQGTFSHEPPGTLDLFRLVGS
                     RFPVYIADRIHQVALRDGVFIASSGALFTPVEIEALLADESPEVIFTCVPTVNKAMLA
                     AAVGATEAATAVGDHLSAYLHAAGTVNRSFRARGIRTMGISHGTVNGCQTEHGVPMAG
                     FDHEFTIGALFDAHCDGFMLGHIHRAQQWDREGRLVAYPGSIGRFHYGEIGDKTYLQW
                     RVAPGLAETTPVVTPARETLCIDFNSPPDMDELARVAASATDKFVRIRWVVDEEHRQA
                     VDRDAIGVLFAKAAEVKLEGRVLPAVRSRAEGISRATSLSEKITRWGELTHVDTNPLL
                     DRLSMLEHAEPQAIADQLLQQLDREGTSEVAALAAPSMSPEFVIEATPAPVEAPAPVI
                     VKPSAPPPAMDWLTDDLFAEAAA"
     misc_feature    complement(309227..309979)
                     /gene="yhaO"
                     /locus_tag="CNE_BB2p03040"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(order(309287..309289,309401..309403,
                     309743..309748,309857..309859,309956..309958,
                     309962..309964))
                     /gene="yhaO"
                     /locus_tag="CNE_BB2p03040"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(309287..309289,309401..309403,
                     309746..309748,309857..309859,309956..309958,
                     309962..309964))
                     /gene="yhaO"
                     /locus_tag="CNE_BB2p03040"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            complement(310146..311477)
                     /locus_tag="CNE_BB2p03050"
                     /db_xref="GeneID:10920386"
     CDS             complement(310146..311477)
                     /locus_tag="CNE_BB2p03050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682948.1"
                     /db_xref="GI:339324055"
                     /db_xref="GeneID:10920386"
                     /translation="MQRAIGYTDFNQPRSLIEERPARPPIIGKIRPGIKVLTKKAKEN
                     EQAVKIHDAGLARGDSFEAIGDEIERKTKLRNALVPKNTAWFTCRSSDFTNPATADEI
                     LQKYGEDRGDGLKLWRFPVIFAFDDWLANMPNQLKVWGTRGLQYFSEYGTDGKRYCKM
                     YAAPEVDQRAQRAKRLFGGRTIILRQDDAIADGVCDPHQCPQYQERKCNLSANFLFCV
                     PEIKGLGLIELPTNSIYVLQKAYAAMQTVALARGGRMAGLQFWLSKKAVEITRIGDDG
                     LPMRQEQMLTMLDAEIDMGALLDGADQMAPALDAASHAVTLLEGTNSAMSATAAPPAS
                     PVADISAMTLAPEPAPIVAPVSHAGPMSSEVDPDDRESVLADLAARLDMAKGQDKMDL
                     LAFARIEYGQGWTKRPKDVDRMIGEMQIALANPMAFREQVRARVREASASV"
     gene            312386..312988
                     /locus_tag="CNE_BB2p03060"
                     /db_xref="GeneID:10920387"
     CDS             312386..312988
                     /locus_tag="CNE_BB2p03060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682949.1"
                     /db_xref="GI:339324056"
                     /db_xref="GeneID:10920387"
                     /translation="MDIAEQPGIFPAHLPQFPPDAVQAAQTESAAPDTGLKPITRLIS
                     EDRISRIVPETATKVQVSFSSVFTRRFLHDDYNFCAAKCSVARGGKVKALDEAFREAE
                     EWFTRVTEWLATKNQVEFSIGYETVALEVPNALAGRLVRLLNQYDKLSSATLFAHIGR
                     SISGAERDTQLDIASRRINIIHTLCIPDNDRFADDGSRLS"
     gene            313647..314084
                     /locus_tag="CNE_BB2p03070"
                     /db_xref="GeneID:10920388"
     CDS             313647..314084
                     /locus_tag="CNE_BB2p03070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682950.1"
                     /db_xref="GI:339324057"
                     /db_xref="GeneID:10920388"
                     /translation="MKDTPLFSVLNRGMSIHGDVAADHGITCLGLVDGNLSSSAGLLH
                     IAAGGIVRGKVEGDHVIVDGIVEGDVAARSTLILNGRVKGEIFYAGTIRLGMNANLES
                     KISRVAAIAAGTGAHVFAREAVVAGSVDPAEMADANTAATPST"
     misc_feature    313665..313964
                     /locus_tag="CNE_BB2p03070"
                     /note="Polymer-forming cytoskeletal; Region: Bactofilin;
                     pfam04519"
                     /db_xref="CDD:252647"
     gene            complement(314271..315512)
                     /locus_tag="CNE_BB2p03080"
                     /db_xref="GeneID:10920389"
     CDS             complement(314271..315512)
                     /locus_tag="CNE_BB2p03080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682951.1"
                     /db_xref="GI:339324058"
                     /db_xref="GeneID:10920389"
                     /translation="MRDRISKQRSQLILSQPFFGALLMRLQLVEDPSCKTFWVNGVSL
                     GYNPAYVATLSDLELRGCLAHEVLHPANGHCWRRGVRDPGRWNHACDYAINPLVLNAG
                     LQLPAGALIDGRFLGKSAEEIYAMLRQEGSEQPQPQQPPQPAPQPQPQQDGSGQGDGS
                     GPPQPDGQDGPDDSSAGGDPSQASPEFSPGEVRQQPQAAQQALANEWKVAAMQAAKAV
                     QMRGKLPGDLSAMVASATRASVDWRSVLHRFAFEQTRSDYSWAMPNRRYTHMGLYLPA
                     LHDQSVGDAVFVRDTSGSVFDETQAQFGAEIEAVFTSLQPRRLFVVDCDTRIAQVQCF
                     ERGEAIELGPIRGGGGTSFVAPFAWLEEQGVHPAFLVYLTDMDGKFPSAPPAYPTLWA
                     STTPLRRIAPPPFGEAVEVIV"
     misc_feature    complement(314682..315503)
                     /locus_tag="CNE_BB2p03080"
                     /note="Putative metallopeptidase domain; Region:
                     DUF2201_N; pfam13203"
                     /db_xref="CDD:257570"
     misc_feature    complement(314292..314660)
                     /locus_tag="CNE_BB2p03080"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     gene            complement(315520..316437)
                     /locus_tag="CNE_BB2p03090"
                     /db_xref="GeneID:10920390"
     CDS             complement(315520..316437)
                     /locus_tag="CNE_BB2p03090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682952.1"
                     /db_xref="GI:339324059"
                     /db_xref="GeneID:10920390"
                     /translation="MNIQDIIKRVMLATFNTSVWRARKFDTRATEEVEANHDTKDIGR
                     FNKKLLTEGATSYKEVCAIANRARAYFDAHSLDYDQLGVRLLPTDMYMEVADRQRQFQ
                     DEFNAATAVFLGDYPRLKDEAREALNGLFDEADYPTQAELAKKFGMRLAVLPFPDASQ
                     FDIALPANVLDGLKTDMDQRVLGAVKTANDDLVGRLFEAVQHFANRLYGATNVRLDVA
                     DKVRELSALLPKLNFSGDPALTRILEDTQQHLARHSGLDLRNSTELRKQVAEKAMEIE
                     AQMAAFMGGPPPSSDATAPASPMFQMLTA"
     misc_feature    complement(<315904..316422)
                     /locus_tag="CNE_BB2p03090"
                     /note="Protein of unknown function (DUF3150); Region:
                     DUF3150; pfam11348"
                     /db_xref="CDD:151789"
     gene            complement(316527..317552)
                     /locus_tag="CNE_BB2p03100"
                     /db_xref="GeneID:10920391"
     CDS             complement(316527..317552)
                     /locus_tag="CNE_BB2p03100"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_004682953.1"
                     /db_xref="GI:339324060"
                     /db_xref="GeneID:10920391"
                     /translation="MKVNPSQLHTLLAAFIPARLPVLITGAPGIGKSDIVASAAKAAG
                     YDLLISHPVVEDPTDSKGLPFPATDGAGAKFLPFGDLATALNSLRPLVWFIDDLGQAS
                     PAVQAAKMQLLLARRIGEHVLPDHVTFVAATNRRSDNAAVSNILDPLKSRFSTIVELE
                     PTIEDWTRWAVTNHVPPVLIAFLRFRPDLLLSSERSKEVENLPSPRGWGHLARQLPLV
                     PPGMEIIVSAGAVGEGAALEFESFRQIYRELPSVDSVLAAPESARIPDKVAAQYAICS
                     ALASVANENNFDRVMVYANRLFEAHLGEFAVMLATDAARRDSRICATPAWINAQGCKL
                     GELLLGN"
     misc_feature    complement(317070..317516)
                     /locus_tag="CNE_BB2p03100"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(317070..317492)
                     /locus_tag="CNE_BB2p03100"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    complement(317454..317477)
                     /locus_tag="CNE_BB2p03100"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(317151..317153,317265..317267,
                     317451..317474))
                     /locus_tag="CNE_BB2p03100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(317262..317279)
                     /locus_tag="CNE_BB2p03100"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(317097..317099)
                     /locus_tag="CNE_BB2p03100"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(317843..319408)
                     /locus_tag="CNE_BB2p03110"
                     /db_xref="GeneID:10920392"
     CDS             complement(317843..319408)
                     /locus_tag="CNE_BB2p03110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682954.1"
                     /db_xref="GI:339324061"
                     /db_xref="GeneID:10920392"
                     /translation="MYVISTGPERVDTRTTLAGVLAYLNLEPGPKPGLRAEGISVRHV
                     ERGAIPVLRLHSGQFAVRPAGDPKAILTSILDEVERFIVRPQGKVLRPHEMSRTSWLA
                     VYAAGRLAVFTNEAVDPDQVADLGAANLDLFAVVEPFDAYEFIRVEFDRRFGYGTNGP
                     EYSPGAGVNSRYEVHVAYALQRGEPVRDCILNAYRHDGDAADAGRHDLHWLRTLIAVP
                     ALRGALSPGKLQSLCDVMRQDELAITDRNAARLIALVKPLPDDCTYVTVDDALYAAQV
                     IPPLAAPVGKPPSGDDAAPVSPLAARLHSLIGAKRYAERLARAQAERARGAMSERCLQ
                     RETALAAIERDHASFSWPNRFALAVMQRDIATLLQTLDTPNDRNTSSKRALREQFGVV
                     LTGVPAVTRRRRIFELCGFSEAEQQHWEAQAQTARTERLQADDAERARERAEASRWSV
                     DGRKMNGREYVDLCINQGFSQIRHFPRGSARVYYIEQPATRTIRRLQAKDGTLDYARS
                     RLAVASASMAVAA"
     gene            complement(319478..319843)
                     /locus_tag="CNE_BB2p03120"
                     /db_xref="GeneID:10920393"
     CDS             complement(319478..319843)
                     /locus_tag="CNE_BB2p03120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682955.1"
                     /db_xref="GI:339324062"
                     /db_xref="GeneID:10920393"
                     /translation="MEEHIIGAGMVSYPAGLQLRVHVYRNNNRPALALICADDYLPYL
                     DLTANVPDQELAEDEVFIAAWNVPNDVLTALLESGWFVPARTIATGYIRGPVWKIQSA
                     DLLAWIADAREDALADMPQ"
     misc_feature    complement(<319658..319795)
                     /locus_tag="CNE_BB2p03120"
                     /note="Domain of unknown function (DUF4313); Region:
                     DUF4313; pfam14190"
                     /db_xref="CDD:258386"
     gene            complement(320102..320572)
                     /locus_tag="CNE_BB2p03130"
                     /db_xref="GeneID:10920394"
     CDS             complement(320102..320572)
                     /locus_tag="CNE_BB2p03130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682956.1"
                     /db_xref="GI:339324063"
                     /db_xref="GeneID:10920394"
                     /translation="MTTLIKVTFTGTTGEETTGKAQYDHASGLVTLPTSFLTLIEQAK
                     AVGIGYALVAHEDGYQFPLLHDGGATYRMDRSRRARRSLLVLAWKAVAEPTKEQRQQS
                     GRFAHTLSAAAVIGAAGYLGTNHTWSIRAVTDVISLVGVGVVLFFAGAILSKGD"
     gene            complement(320582..320962)
                     /locus_tag="CNE_BB2p03140"
                     /db_xref="GeneID:10920395"
     CDS             complement(320582..320962)
                     /locus_tag="CNE_BB2p03140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682957.1"
                     /db_xref="GI:339324064"
                     /db_xref="GeneID:10920395"
                     /translation="MKIPKSFTQPHQPGNAASCANLKRDASRVFRRLACDLGLRQRDF
                     TVRERRHRRHQADLYALHTDSLYVQIAHAPQQNAAHMSFRTCRGRDDHTGGRDNAVCL
                     HSIGSPEGYASLVATLRVVASRRS"
     gene            complement(321157..321537)
                     /locus_tag="CNE_BB2p03150"
                     /db_xref="GeneID:10920396"
     CDS             complement(321157..321537)
                     /locus_tag="CNE_BB2p03150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682958.1"
                     /db_xref="GI:339324065"
                     /db_xref="GeneID:10920396"
                     /translation="MQSITPIQTEGKTVDQVTSLLARTLRAIDLEPEWIIPANHFADA
                     NEAQYGLLPDAVWPAEHARHRFAVSVDRGCSEGWRVHVDHIATAVEGPTGSTALRKLV
                     VAKMFSRDQAWQTARVINRLLDID"
     gene            complement(321731..322225)
                     /gene="sylB"
                     /locus_tag="CNE_BB2p03160"
                     /db_xref="GeneID:10920397"
     CDS             complement(321731..322225)
                     /gene="sylB"
                     /locus_tag="CNE_BB2p03160"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein SlyB"
                     /protein_id="YP_004682959.1"
                     /db_xref="GI:339324066"
                     /db_xref="GeneID:10920397"
                     /translation="MLAHFHVRPACSSVISSSLHLSVLSVAALLSSPNVYRGSDAMRA
                     GSAEQVTVVRVRNVTIAGDSMLSANSGVPAILSTLVGAVLGARVIGNGDGRYIAGALS
                     GTAAGVIGQVAATHLSQRDGVEVIVRTDSGRQLVVAQGADQQFVVGEQLYLVSSGGGY
                     RLTR"
     misc_feature    complement(321737..322132)
                     /gene="sylB"
                     /locus_tag="CNE_BB2p03160"
                     /note="Glycine zipper 2TM domain; Region: Rick_17kDa_Anti;
                     cl10470"
                     /db_xref="CDD:263979"
     gene            complement(322350..322514)
                     /locus_tag="CNE_BB2p03170"
                     /db_xref="GeneID:10920398"
     CDS             complement(322350..322514)
                     /locus_tag="CNE_BB2p03170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682960.1"
                     /db_xref="GI:339324067"
                     /db_xref="GeneID:10920398"
                     /translation="MDAEFYENARRGFGGDDFGERLSLTGLKETLANADCKSVRITVT
                     PRSIRIDAFA"
     misc_feature    complement(322365..>322514)
                     /locus_tag="CNE_BB2p03170"
                     /note="Protein of unknown function (DUF3085); Region:
                     DUF3085; pfam11284"
                     /db_xref="CDD:256392"
     gene            complement(322551..322688)
                     /locus_tag="CNE_BB2p03180"
                     /db_xref="GeneID:10920399"
     CDS             complement(322551..322688)
                     /locus_tag="CNE_BB2p03180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682961.1"
                     /db_xref="GI:339324068"
                     /db_xref="GeneID:10920399"
                     /translation="MPQITLSRSQVESLVAFCDAAKSEKFFIAKDHGAYVGYSTGPKP
                     E"
     gene            complement(322848..323579)
                     /locus_tag="CNE_BB2p03190"
                     /db_xref="GeneID:10920400"
     CDS             complement(322848..323579)
                     /locus_tag="CNE_BB2p03190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682962.1"
                     /db_xref="GI:339324069"
                     /db_xref="GeneID:10920400"
                     /translation="MNQIIQIDPRQLKAIALLAPKQDPRHWLNGVFVEAMARETRLVA
                     MDGQRMGVFRAEKANQLGDAICVSCILPHNVIECVKPVRGKFGLLDLRLDTERPGWAE
                     LVHGGTPFEFVRRDPCYPVYRRAIGPHRGSGEPGQCDPRHLYDFHRVFLALEGKLAAD
                     RGGVYLHHNGTDNTRVSLCGREDFVGTVRPREADGPALLFWAESPVPVARVNPADVPT
                     PDRQPTGCSVKVRFLTIPCLFGKLP"
     misc_feature    complement(323244..323564)
                     /locus_tag="CNE_BB2p03190"
                     /note="DNA polymerase III beta subunit, central domain;
                     Region: DNA_pol3_beta_2; pfam02767"
                     /db_xref="CDD:202381"
     gene            complement(323728..324396)
                     /locus_tag="CNE_BB2p03200"
                     /db_xref="GeneID:10920401"
     CDS             complement(323728..324396)
                     /locus_tag="CNE_BB2p03200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682963.1"
                     /db_xref="GI:339324070"
                     /db_xref="GeneID:10920401"
                     /translation="MTSVPSRRASAARQNDSAMRDHATTPDESWGFFLRAARVQCWVS
                     SEAKRVIYGSYRGMIELIINESKHNNHLTRVGQLLEAASNVVIVSGWLKKEGVDVLKS
                     ALLAAVGRGATVTVYSNKGDRAEETEQVAIQRLTELGVSHVLVRDFYLHSKIYYFEQG
                     DRYTALIGSANLTRGALCSNEELSVEVSGNLGDTQHTQIFAYLARVKARIPAKASVLA
                     RVAG"
     misc_feature    complement(323788..324168)
                     /locus_tag="CNE_BB2p03200"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(323836..324165)
                     /locus_tag="CNE_BB2p03200"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cd00138"
                     /db_xref="CDD:197200"
     misc_feature    complement(order(323851..323853,323884..323886,
                     323890..323892,323938..323940,323944..323946))
                     /locus_tag="CNE_BB2p03200"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    complement(323944..323946)
                     /locus_tag="CNE_BB2p03200"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     gene            complement(324350..325144)
                     /locus_tag="CNE_BB2p03210"
                     /db_xref="GeneID:10920402"
     CDS             complement(324350..325144)
                     /locus_tag="CNE_BB2p03210"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein"
                     /protein_id="YP_004682964.1"
                     /db_xref="GI:339324071"
                     /db_xref="GeneID:10920402"
                     /translation="MSFEHHIPETMRVNAWKVVVVGAGGTGSALLPALARLHHAMLEL
                     GHPGGIECTVYDDDTVSETNVGRQGFYPNDVGQHKATLLVNRLNLLMGTRWEARPRRI
                     GSQDRFVCDMAVGCVDSRAARKAILGALERGTGGYYLDCGNETDRGQVILGQVRGKRE
                     SRLPHVGDLFPELIDPRGDKADTAPSCSMADALRKQSLVINQAIAVQAFNLLWTLFRT
                     GTLKYSGVFVNLEAGRTNPLPIDPAAWARFGYDLSAKPTRKRGAAK"
     misc_feature    complement(324422..325132)
                     /locus_tag="CNE_BB2p03210"
                     /note="PRTRC system ThiF family protein; Region:
                     PRTRC_ThiF; TIGR03736"
                     /db_xref="CDD:163448"
     misc_feature    complement(324695..325075)
                     /locus_tag="CNE_BB2p03210"
                     /note="Superfamily of activating enzymes (E1) of the
                     ubiquitin-like proteins. This family includes classical
                     ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
                     activating enzymes and other mechanistic homologes, like
                     MoeB, Thif1 and others. The common...; Region:
                     E1_enzyme_family; cl17196"
                     /db_xref="CDD:266547"
     misc_feature    complement(order(324779..324781,324797..324799,
                     324908..324910,324944..324946,324971..324973,
                     324977..324979,325067..325069,325073..325075))
                     /locus_tag="CNE_BB2p03210"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238760"
     misc_feature    complement(order(324698..324700,324716..324721,
                     324776..324778,325067..325069))
                     /locus_tag="CNE_BB2p03210"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238760"
     gene            complement(325144..325785)
                     /locus_tag="CNE_BB2p03220"
                     /db_xref="GeneID:10920403"
     CDS             complement(325144..325785)
                     /locus_tag="CNE_BB2p03220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682965.1"
                     /db_xref="GI:339324072"
                     /db_xref="GeneID:10920403"
                     /translation="MHPMDITLQQSFPSVMVPRFGELAPLEATGERLLIAANGVFLEV
                     SRPWLRLVRRVGQFDVKTAVPYGTAAEATDLRCGKLPAHLIGQFAELARAAMPNETGS
                     WIVWHPATCAFRLVPVTMLSHGRGHLQYDRPALADGEVLVVDCHSHGNFPAYFSSTDN
                     DDDQHDVKFAFVMGNCLAATPSLCLRLCAKGIFEAVDRVPGDWYAAARAQEVV"
     misc_feature    complement(325558..325776)
                     /locus_tag="CNE_BB2p03220"
                     /note="Domain of unknown function (DUF2016); Region:
                     DUF2016; pfam09436"
                     /db_xref="CDD:255365"
     misc_feature    complement(325204..325773)
                     /locus_tag="CNE_BB2p03220"
                     /note="PRTRC system protein A; Region: PRTRC_A; TIGR03735"
                     /db_xref="CDD:163447"
     misc_feature    complement(325258..325545)
                     /locus_tag="CNE_BB2p03220"
                     /note="Prokaryotic homologs of the JAB domain; Region:
                     Prok-JAB; pfam14464"
                     /db_xref="CDD:258607"
     gene            complement(325794..326510)
                     /locus_tag="CNE_BB2p03230"
                     /db_xref="GeneID:10920404"
     CDS             complement(325794..326510)
                     /locus_tag="CNE_BB2p03230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682966.1"
                     /db_xref="GI:339324073"
                     /db_xref="GeneID:10920404"
                     /translation="MAKIHSASRDHDVALQGAILLYGTDLSAFSYATAHRIVTDAQTG
                     RPVIGAGTPLNRRALIQAVRQVAEASLPKGEFLTPNVLSIGPDAITWWCPPGNRRVYF
                     NCEELGDRSAMTPHPGLVFHASPAGFRVFALMEDERPTPESMLYEPPYFNTWDHGKIC
                     IGTAHVPKQIDAASIAGWEGAFFASAFTHPNHGGKRVDYDDGFYAFWRDMLDGRFPTF
                     PKAALIPMNQSLGNLIAGQF"
     misc_feature    complement(325797..326474)
                     /locus_tag="CNE_BB2p03230"
                     /note="Prokaryotic E2 family D; Region: Prok-E2_D;
                     cl14019"
                     /db_xref="CDD:265419"
     gene            complement(326520..327653)
                     /locus_tag="CNE_BB2p03240"
                     /db_xref="GeneID:10920405"
     CDS             complement(326520..327653)
                     /locus_tag="CNE_BB2p03240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682967.1"
                     /db_xref="GI:339324074"
                     /db_xref="GeneID:10920405"
                     /translation="MLFDARPSDEIFIASGPGWTPSRQPPAARRRPAHGFLTLPSLSA
                     EIPARGKLQYGEGADTLRLIRKQFETGVLAARDVQGAASAGDAFAQAMFAWLRRRMPK
                     CKRLNFSFALLDLAAAREQVDQFGWDEDLHAPLYLAIELDEEAVFEIGKRADIMRRAD
                     PALLYTATHLVNEAAGRSLFVRTPDELADMFARWWWECDPTMSDEEAREFLGERFGDA
                     DSSEIERYLPSKVLPVLAPDDAVPAFARRDKSVRIDCLRAPQLEALAGQKRGLPRRIC
                     LALLDLQAVLARTRRSRALNHAQWAEPAYSAATLCMWRGHWVGQILDDHFDSLNCGGD
                     ATMYQSLIPLANTPRAIRRQFKQLADMMDVIAALDRVLTLISE"
     misc_feature    complement(326523..327467)
                     /locus_tag="CNE_BB2p03240"
                     /note="Alpha-helical domain 2; Region: alpha-hel2;
                     cl19908"
                     /db_xref="CDD:268261"
     gene            complement(327756..327974)
                     /locus_tag="CNE_BB2p03250"
                     /db_xref="GeneID:10920406"
     CDS             complement(327756..327974)
                     /locus_tag="CNE_BB2p03250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682968.1"
                     /db_xref="GI:339324075"
                     /db_xref="GeneID:10920406"
                     /translation="MSLTVQQLTREFIYNGMTLMDPGPAFSTDQVRDMYTAQYPELTT
                     ATVDGPVHNGTVMRYTFVRAAGAKGCHA"
     misc_feature    complement(327768..327962)
                     /locus_tag="CNE_BB2p03250"
                     /note="Prokaryotic Ubiquitin; Region: Prok_Ub; cl14020"
                     /db_xref="CDD:209857"
     gene            complement(327986..328444)
                     /locus_tag="CNE_BB2p03260"
                     /db_xref="GeneID:10920407"
     CDS             complement(327986..328444)
                     /locus_tag="CNE_BB2p03260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682969.1"
                     /db_xref="GI:339324076"
                     /db_xref="GeneID:10920407"
                     /translation="MFQELVPLVTACDKVVLTLTMKGDAMAVVVAPVVSKAADAALAT
                     PLALTASPAELDEGFAQAISSVSVSHRSLAEQVEATASILNAATSAQSTKAQKALSKA
                     NSKPVASSSDDADGTDGTDDNAEGEGKAAAPAPQASSPEPSGTNLADLLG"
     misc_feature    complement(328139..328444)
                     /locus_tag="CNE_BB2p03260"
                     /note="PRTRC system protein E; Region: PRTRC_E; TIGR03741"
                     /db_xref="CDD:163453"
     gene            complement(328509..330173)
                     /gene="parB2"
                     /locus_tag="CNE_BB2p03270"
                     /db_xref="GeneID:10920408"
     CDS             complement(328509..330173)
                     /gene="parB2"
                     /locus_tag="CNE_BB2p03270"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome-partitioning protein ParB"
                     /protein_id="YP_004682970.1"
                     /db_xref="GI:339324077"
                     /db_xref="GeneID:10920408"
                     /translation="MQSPTIALGKIRPGRNPRKYFDAAEMAELTDSVRENGVIQPILI
                     RPLGDDGYELVAGERRLRAARAAHGDDYPIPVTIREMTEEEADRLALIENVQRADMAP
                     SEEAVAAARIVGQLKGDREEAAKILGWSRSTLDKRLGLMNCSTSVLDALNTRTIQLGH
                     AELLATLAKDKQDKLLPVIVGEKKSVAELKKTIEAAACSLATAIFDKADCAACPHNSS
                     LQTEMFGEAIATGNCTNRACYTQKTDKQLETVAYGLKDEYPVIRIVRAGDNHTRVQLV
                     VDGPTGVGEDQAKACHACEHYGAAVSALPDSIGKVFRGQCFDTACNSKKIAARLKAER
                     DAKANAQKPAAAAAGSSTTAKGSTKTPAEEKAVTHISETEKVKAYRVALWRKALRREA
                     ASVPETANIYLLAVALSGLSRNIGGDIMGKIFEKLTDEKATSTDLKKNLSTVQELDAG
                     KRVTLTTAMTVAAIEGIEVNHLVALCQYHKLDLRQHWNLQKSKDFLGLLTKSEIKVLA
                     DELGLRAALGDNFAKVFNKSKPDLIEALLNVDGFEYAGKLPKVLRF"
     misc_feature    complement(329889..330158)
                     /gene="parB2"
                     /locus_tag="CNE_BB2p03270"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     misc_feature    complement(328512..330146)
                     /gene="parB2"
                     /locus_tag="CNE_BB2p03270"
                     /note="PRTRC system ParB family protein; Region:
                     PRTRC_parB; TIGR03734"
                     /db_xref="CDD:234336"
     gene            complement(330717..331622)
                     /locus_tag="CNE_BB2p03280"
                     /db_xref="GeneID:10920409"
     CDS             complement(330717..331622)
                     /locus_tag="CNE_BB2p03280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682971.1"
                     /db_xref="GI:339324078"
                     /db_xref="GeneID:10920409"
                     /translation="MGEAKRRKLLAVSDQVTSKPASVGLWPLSNASTQQGLDAWFVQR
                     GIDPSRPRLHDTPEFLRAEAQDPKALNMVARLVETRSYTADELQQAERKILVAAEAVA
                     DRVARDGRHGLCVVASGVLSRILDELGVWNYTAKSNLAIHFPLSVSVTPRYFYSIDQR
                     QFVAPHAIVVAPPFTVVDVTVRHQMYDKDAMAQYLPVMAATKEFRPYRVTPTELVSPE
                     SRAILRRQGMPVETYLARERSAMLELMKQLPSREVTLDGGRLGYGLVAVGGYQERLHE
                     LHGKNCSINGLMPMEIFEQDVLPKL"
     gene            complement(331886..332212)
                     /locus_tag="CNE_BB2p03290"
                     /db_xref="GeneID:10920410"
     CDS             complement(331886..332212)
                     /locus_tag="CNE_BB2p03290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682972.1"
                     /db_xref="GI:339324079"
                     /db_xref="GeneID:10920410"
                     /translation="MPIYGFVSVCSLSIILDCRGQRRRKTLFAPKPRMSPFDGRIHLR
                     YFRFGSGSVQPLAAAKRSSRDDRRSQGADFSNRWLRRRGSAGSPPRLNAAAFRRPRGG
                     ATVSGA"
     gene            332228..333229
                     /locus_tag="CNE_BB2p03300"
                     /db_xref="GeneID:10920411"
     CDS             332228..333229
                     /locus_tag="CNE_BB2p03300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682973.1"
                     /db_xref="GI:339324080"
                     /db_xref="GeneID:10920411"
                     /translation="MRINHAAQICALSASDLEDFVDDWIAQRCKDYSAHELWRGTGDM
                     GRDVTGYVTDRRLEGPWDNFQCKQLSSKLSEHSAFVELGKIFKNSADGAFSLPRAYTF
                     VAPYGLVRNARDYIAHPEKFRQAFLDRWDTYIAEDLVENQVVKLTPKIEAKIKAFDFK
                     KVDWIDATRLAKDPACKPALVAWFDADPGSWVRDVVPDEIQASESAYIGQLLKVYDEK
                     GPGTYSDAAAALACPEVGPNLRIQRTRFFDSVAFERFYRDSTPKEYLANFKDEIYLGV
                     VDVHQGAHTDRFSRLGRVMQQAAVLQPSGVLAKHASPPVKQGTCHLLANEGLLPWDH"
     misc_feature    <332621..>332839
                     /locus_tag="CNE_BB2p03300"
                     /note="Domain of unknown function (DUF4403); Region:
                     DUF4403; pfam14356"
                     /db_xref="CDD:258529"
     gene            333217..333729
                     /locus_tag="CNE_BB2p03310"
                     /db_xref="GeneID:10920412"
     CDS             333217..333729
                     /locus_tag="CNE_BB2p03310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682974.1"
                     /db_xref="GI:339324081"
                     /db_xref="GeneID:10920412"
                     /translation="MGPLGRNAPAHPFNSTLETGIRALVVLEAFYPRRCDLLEMTWLD
                     HLVVHTGDLDGQDVPGSLHPDLPNRAGELLVRRQLVEKSLRLMQQVHLIDVIETEDGI
                     AFGASEDAPSYLDLLQAPYSLALKERAKWMADRFAGMQSAEMRALIESRIGRWTADFR
                     VEELPVGNRK"
     gene            333726..335591
                     /locus_tag="CNE_BB2p03320"
                     /db_xref="GeneID:10920413"
     CDS             333726..335591
                     /locus_tag="CNE_BB2p03320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682975.1"
                     /db_xref="GI:339324082"
                     /db_xref="GeneID:10920413"
                     /translation="MNGIRLRHLVFTGPNIESAELEFDDGLNIIYGASNTGKSFASKT
                     ILFMLGANTSLPETEEVAAYDGAWLGVTLGEQGDFTLYRATRGGHLKLYTGLVKGAPA
                     DNGEVLREKHDQKRTDTVSHRLLDVIGLADKWVVRDGNGKKDSLSIRLLSKYAVVAED
                     DIMSETSPVYLSGSPSERPFERNLFKLLLTGNDDSAAVTVPKETERKAAKTAKIELVD
                     ELLAQLDAELGEEPPVEKETDEQLRRLDQSADGLLTRLQTAQNELDSLVVERRTTVDR
                     CRELEERADELELTLQRFAKLQGVYTSDLERLHSIEEGGYVLVAMAGRDCAVCGAPPG
                     AQIHNHAADEISMAHTAAAAEARKIEREQRELAHVVASLEAEAVGLRKTIEKHNADTE
                     KLDGTIQGLRPQEASLRESYETYNAKRTEILKVLDLYQRRAKLAARRAEIGAMPTKRE
                     GEPAPVGPDSTTMFDFGETVKAVLKAWKFPDADKVQFDGRANDITVGGKSRAANGKGV
                     RAVLHAAFNVAVIVHCIDNKLPHPGFLVLDTPLLTYREPLESKYGDLSPDEAALKATS
                     LAEHFYKHLASLAAHVQVIVIENSDPPSAMNGLARIETFSGKQGNGRAGLLARPA"
     misc_feature    333771..>333926
                     /locus_tag="CNE_BB2p03320"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    333819..333842
                     /locus_tag="CNE_BB2p03320"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(333828..333833,333837..333845)
                     /locus_tag="CNE_BB2p03320"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     gene            complement(336177..336392)
                     /locus_tag="CNE_BB2p03330"
                     /db_xref="GeneID:10920414"
     CDS             complement(336177..336392)
                     /locus_tag="CNE_BB2p03330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682976.1"
                     /db_xref="GI:339324083"
                     /db_xref="GeneID:10920414"
                     /translation="MSLCALCLSQLDRPGHVPPHPKLVKSATLRTTSGENAFAYRCSH
                     CGETLLLASVDGEAPDRWMRLEADDWS"
     gene            complement(337018..337800)
                     /locus_tag="CNE_BB2p03340"
                     /db_xref="GeneID:10920415"
     CDS             complement(337018..337800)
                     /locus_tag="CNE_BB2p03340"
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase class 2 protein"
                     /protein_id="YP_004682977.1"
                     /db_xref="GI:339324084"
                     /db_xref="GeneID:10920415"
                     /translation="MISTTDPHRNRKPRNISDEEWAVRVQLAAAYRLAAKFNLTDLIY
                     THISVRVPGTTDQFLINPHGWFFDEITASCLVKIDTDGRPIADDRFEVNAAGFTIHSA
                     LHQSRHDVECVVHLHTNAGMAVAALECGLLPLNQISMQFYNRVNYHDYEGISLDLDER
                     SRIVKSMGDAHYLILRNHGLLTTGRTVAEAFTRMFYLNRACEIQVQTLSMGQKVTIPS
                     GDVCEHAARQHDDYAYLSTVHLDREWTALLRLLDRDGGDYRC"
     misc_feature    complement(337024..337764)
                     /locus_tag="CNE_BB2p03340"
                     /note="aldolase II superfamily protein; Provisional;
                     Region: PRK07044"
                     /db_xref="CDD:235916"
     misc_feature    complement(order(337126..337128,337183..337185,
                     337204..337206,337216..337218,337237..337239,
                     337270..337272,337351..337353,337393..337398,
                     337420..337428,337441..337446,337450..337452,
                     337594..337599,337603..337605,337678..337680,
                     337702..337704,337714..337716))
                     /locus_tag="CNE_BB2p03340"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(337267..337269,337450..337452,
                     337456..337458,337513..337521,337609..337614,
                     337663..337665))
                     /locus_tag="CNE_BB2p03340"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(337267..337269,337450..337452,
                     337456..337458))
                     /locus_tag="CNE_BB2p03340"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(337823..338188)
                     /locus_tag="CNE_BB2p03350"
                     /db_xref="GeneID:10920416"
     CDS             complement(337823..338188)
                     /locus_tag="CNE_BB2p03350"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_004682978.1"
                     /db_xref="GI:339324085"
                     /db_xref="GeneID:10920416"
                     /translation="MTVTAPAIVRLDQNHRRSRAVIANGMVFLAGQVADDKAGDIASQ
                     AQEVLAKVDALLAEAGTDKGHALTAQVWLADMADFDGFNAVWDAWVAPGETPTRCCGH
                     VALADPAYRVEIVVSALLR"
     misc_feature    complement(337835..338143)
                     /locus_tag="CNE_BB2p03350"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_2; cd06150"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(337838..337840,337844..337846,
                     337850..337852,337880..337906,337919..337921,
                     337931..337933,337940..337942,337973..337975,
                     337979..337981,337985..337990,337994..337996,
                     338096..338101,338105..338107,338111..338113,
                     338120..338122,338126..338128,338135..338140))
                     /locus_tag="CNE_BB2p03350"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(337850..337852,337895..337897,
                     337940..337942,337952..337954,338138..338140))
                     /locus_tag="CNE_BB2p03350"
                     /note="putative active site [active]"
                     /db_xref="CDD:100007"
     gene            complement(338197..339177)
                     /gene="serA"
                     /locus_tag="CNE_BB2p03360"
                     /db_xref="GeneID:10920417"
     CDS             complement(338197..339177)
                     /gene="serA"
                     /locus_tag="CNE_BB2p03360"
                     /EC_number="1.1.1.95"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase SerA"
                     /protein_id="YP_004682979.1"
                     /db_xref="GI:339324086"
                     /db_xref="GeneID:10920417"
                     /translation="MTSSRTSSAVELDGIPSSATAWRAVFVDANPTLAEVSLRIRRDD
                     DLPLAVNRQPDIRPEGLPEALAGAPIAIIDHTHLPTEVAYQCKGLRHVVFLGTGARSY
                     MNPEQLAELGITVHTIKGYGDTAVAECAFALMWAAARNFSRMDREMRAGNWLRSDAVQ
                     LTGKTIGLVGFGGIAQELARLARGIGMRVIAWNRTPKTHADIEFVDLDTLLRGSDVVS
                     LHLLLTDETRGLISAGRIASMRDGAILINTARGALVDEDAMVKALGSGKLAHAGLDVF
                     TVEPMPPGHLLTTLPNVTLSAHSAFRTPEANNNLIEAALDHCRRIVQSSN"
     misc_feature    complement(338209..339105)
                     /gene="serA"
                     /locus_tag="CNE_BB2p03360"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    complement(338212..339051)
                     /gene="serA"
                     /locus_tag="CNE_BB2p03360"
                     /note="Formate/glycerate dehydrogenases, D-specific
                     2-hydroxy acid dehydrogenases and related dehydrogenases;
                     Region: FDH_GDH_like; cl17240"
                     /db_xref="CDD:266580"
     misc_feature    complement(order(338434..338436,338515..338520,
                     338596..338604,338656..338658,338662..338670))
                     /gene="serA"
                     /locus_tag="CNE_BB2p03360"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240631"
     gene            339809..340930
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /db_xref="GeneID:10920418"
     CDS             339809..340930
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="YP_004682980.1"
                     /db_xref="GI:339324087"
                     /db_xref="GeneID:10920418"
                     /translation="MRIGVPTESRVGESRVAATAETVKKLVQQGHQVTLQAGAGLKAS
                     QPDGAYEEAGAQIGDIHAAFDADIVLKVRAPSTEEVPRMRQGAILVGMLGRLDQTNSE
                     LLAQVGVTAFSLEAAPRTTRAQSMDVLSSQANIAGYKAVLIAAQHYKRFLPMLMTAAG
                     TVKAARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPGVKEQVESLGAKFLDVSLLTD
                     EEREIAKGVGGYARPMPSDWLRRQATLVHERAKQADIIITTALIPGQKAPVLLPEEAV
                     MEMKPGSIVVDLAAADGGNCPLTVADEVVERHGVTLIGHTNLASMVAADASALYARNV
                     LSFLTILLNSNDARVLNMEDDIVKACLVSHDGRVRDAQS"
     misc_feature    339809..340906
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    339812..340909
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="NAD/NADP transhydrogenase alpha subunit [Energy
                     production and conversion]; Region: PntA; COG3288"
                     /db_xref="CDD:225826"
     misc_feature    order(339851..339853,340025..340027,340082..340084,
                     340679..340681,340757..340759,340763..340765)
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(339938..339940,340178..340183,340208..340213,
                     340220..340225,340232..340237,340241..340246,
                     340250..340267,340271..340273,340277..340285,
                     340292..340294,340361..340366,340649..340654,
                     340778..340783,340793..340795,340802..340807)
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(340163..340168,340178..340180,340187..340189,
                     340196..340198,340319..340330,340388..340396,
                     340499..340501,340532..340534,340583..340591,
                     340610..340612,340616..340618)
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(340169..340174,340178..340180,340208..340210,
                     340337..340342,340361..340363,340409..340414,
                     340418..340429)
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(340268..340282,340289..340291,340298..340300,
                     340367..340369,340373..340375)
                     /gene="pntA1"
                     /locus_tag="CNE_BB2p03370"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     gene            340945..341286
                     /gene="pntA2"
                     /locus_tag="CNE_BB2p03380"
                     /db_xref="GeneID:10920419"
     CDS             340945..341286
                     /gene="pntA2"
                     /locus_tag="CNE_BB2p03380"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="YP_004682981.1"
                     /db_xref="GI:339324088"
                     /db_xref="GeneID:10920419"
                     /translation="MEVVGHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAIS
                     AIIIVGAMLAAGLTEGGVGRVMGTLAVALAAVNVFGGFLVTQRMLEMFKKKEPKAKAP
                     EAKQALAREGA"
     misc_feature    340966..341220
                     /gene="pntA2"
                     /locus_tag="CNE_BB2p03380"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            341286..342761
                     /gene="pntB"
                     /locus_tag="CNE_BB2p03390"
                     /db_xref="GeneID:10920420"
     CDS             341286..342761
                     /gene="pntB"
                     /locus_tag="CNE_BB2p03390"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="YP_004682982.1"
                     /db_xref="GI:339324089"
                     /db_xref="GeneID:10920420"
                     /translation="MTGLVSMNLVTLLYLVASVCFIQALKGLSHPASARKGNTFGMIG
                     MAIAVVTTLVLIVKLKNEFLAAGTAQSAVGTGLALIFAALVVGGGIGTYVAKKVQMTK
                     MPELVAAMHSLIGLAAVFIAVAAVSEPAAFGISPAGSHLIPLGNRIELFIGCFVGAIT
                     FSGSVIAFGKLAGRYKFRLFQGAPVVFAGQHWLNLLLAVAMVGFGIIFFMSQAWLPFL
                     IMLAIAFVLGVTIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGS
                     SGAILSYIMCRAMNRSFFNVLLGGFGGEAVAAGAAGAQAQRNVKSGSADDAAFLMGNA
                     ETVIIVPGYGLAVARAQHALKELTEKLAEKGVTVKHAIHPVAGRMPGHMNVLLAEAEV
                     PYDQVFEMEDINSEFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTIIV
                     NKRSMAAGYAGLDNELFYMDKTMMVFGDAKKVVEDMFKAVN"
     misc_feature    341301..342755
                     /gene="pntB"
                     /locus_tag="CNE_BB2p03390"
                     /note="NAD/NADP transhydrogenase beta subunit [Energy
                     production and conversion]; Region: PntB; COG1282"
                     /db_xref="CDD:224201"
     gene            complement(342805..343470)
                     /locus_tag="CNE_BB2p03400"
                     /db_xref="GeneID:10920421"
     CDS             complement(342805..343470)
                     /locus_tag="CNE_BB2p03400"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine uptake transporter"
                     /protein_id="YP_004682983.1"
                     /db_xref="GI:339324090"
                     /db_xref="GeneID:10920421"
                     /translation="MLLVLVSVFAFLSLKYLPVAEFTAIAMITPLVITLLATILIGEE
                     VSVQRWMLLLGGFIGALMVVRPGGQQFGWPMLLPLGFVIANATFQLVTSQLAKVDHAG
                     TTHLYTGAVGALVMSLAVPFGWQTNIPWQWWLVLVVMGSCSSLGHFLLIKAYSHAPVA
                     VLTPYLYGQIGFAMLGGWLLFSHVPDLWALVGISIVACSGVLGTCTSARMKLSAAVGD
                     PAG"
     misc_feature    complement(342865..>343470)
                     /locus_tag="CNE_BB2p03400"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     gene            complement(343813..344547)
                     /locus_tag="CNE_BB2p03410"
                     /db_xref="GeneID:10920422"
     CDS             complement(343813..344547)
                     /locus_tag="CNE_BB2p03410"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004682984.1"
                     /db_xref="GI:339324091"
                     /db_xref="GeneID:10920422"
                     /translation="MEISVATSNLEEKPSPKPEARKRTSLSSAAIYERVKNMAATFEL
                     RPGERINEIDLSKQLDVSRTPLREVLNQLMVEGFLERTTNKGFVSRPLDVKQIFDLYE
                     YRLSLETAIGRLACQRATDDEIVQLERSVQEDAAVPEDSDSNQLLALDEAFHMRLAHL
                     TRNDEFVRALSNVNARIHYVRWIDMRNGRRPYTQAEHMQIVQALKARDEVALVKLLEG
                     HIARRKEQITEVIKLGFSEIYTRQRG"
     misc_feature    complement(343852..344511)
                     /locus_tag="CNE_BB2p03410"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(344281..344457)
                     /locus_tag="CNE_BB2p03410"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(order(344290..344298,344302..344307,
                     344335..344337,344344..344349,344353..344367,
                     344389..344394))
                     /locus_tag="CNE_BB2p03410"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(343882..344253)
                     /locus_tag="CNE_BB2p03410"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(344656..346260)
                     /locus_tag="CNE_BB2p03420"
                     /db_xref="GeneID:10920423"
     CDS             complement(344656..346260)
                     /locus_tag="CNE_BB2p03420"
                     /codon_start=1
                     /transl_table=11
                     /product="general substrate transporter"
                     /protein_id="YP_004682985.1"
                     /db_xref="GI:339324092"
                     /db_xref="GeneID:10920423"
                     /translation="MNTLEAPAQASATAAQSSEMRKVILGSSLGTAFEWYDFFIYGAL
                     ATALGPLFFPPSLGQTAAFLASLATFGVGLVLRPFGSLIFGRLGDIVGRKYTFLVTII
                     MMGISTVGVGLLPTYATAGALAPFLLVLLRCIQGLALGGEYGGAATYVAEHARPDDRG
                     RATGWIQLTATAGFVLSLVVVTTTQSLTTAEQFASWGWRVPFLFSIFLLALSIFIRSR
                     LNESPVFLQMKAEGKLSKKPIRDAFGNWANLKYVLLALFGTVAGVTVIWYTGQFFALI
                     FLMRWLKVDPTTAYWMVSIALILGSPFFVLSGRLSDRFGRKKVILFGFISAVALIFPI
                     FKGVTHFANPALERASAEAPVTIHSSECRLRPFSGPETSCEKAREILNNAGVPYTVVP
                     SSESGAVVRVKDLSTENADKISIEKLLASAGYPAKADPAQINRPAVILLIWILVVLGC
                     IAYGPNAAYLVELFPTRVRYSSMSMAYHIGTGYFGGFALYFATLISTTTGDIYSGLFY
                     PLVIATISILVTAFLLPETKGWTLDR"
     misc_feature    complement(<345256..346191)
                     /locus_tag="CNE_BB2p03420"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(344713..346173)
                     /locus_tag="CNE_BB2p03420"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    complement(order(345349..345351,345361..345363,
                     345370..345372,345382..345384,345394..345396,
                     345436..345438,345445..345450,345457..345462,
                     345469..345471,345739..345741,345757..345762,
                     345769..345774,345808..345810,345817..345822,
                     345829..345834,345841..345846,346006..346011,
                     346015..346020,346051..346053,346060..346065,
                     346072..346074,346123..346128,346132..346140,
                     346147..346149))
                     /locus_tag="CNE_BB2p03420"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(346295..347113)
                     /gene="ectD"
                     /locus_tag="CNE_BB2p03430"
                     /db_xref="GeneID:10920424"
     CDS             complement(346295..347113)
                     /gene="ectD"
                     /locus_tag="CNE_BB2p03430"
                     /EC_number="1.17.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ectoine hydroxylase EctD"
                     /protein_id="YP_004682986.1"
                     /db_xref="GI:339324093"
                     /db_xref="GeneID:10920424"
                     /translation="MLTEEQIKFYDENGFLVLRDVFTPEELRALQQDAVVLRSDKRGH
                     PDANVLEKDGETVRAAWAVELDSEACARAYRLPRVLGAIKQLLGETYLHQSRLNYKAA
                     GKGDIFQWHQDYASWIHDGVPHGGHRDMLTVLITLDDSTPDNGPLRFIPGSHKHGLIE
                     PFYDTTTTSYPLHIVPDEYMEKHFSQSPIYECVFPAGTMVFFCGNLVHSSKENHSNDG
                     RRNLYFAYSRDGNRPTGAATRKHKNNYIMNPSPFTLQEVDDDSLARYAAGVVAA"
     misc_feature    complement(346388..347110)
                     /gene="ectD"
                     /locus_tag="CNE_BB2p03430"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     cl17312"
                     /db_xref="CDD:266621"
     gene            complement(347193..348680)
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /db_xref="GeneID:10920425"
     CDS             complement(347193..348680)
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /EC_number="1.2.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP+ dependend succinate-semialdehyde
                     dehydrogenase GabD"
                     /protein_id="YP_004682987.1"
                     /db_xref="GI:339324094"
                     /db_xref="GeneID:10920425"
                     /translation="MQTKMENLRKVIRNAAVLRTGHLIDGDWYENIERNEFEVCNPAN
                     GEVLATLPSATNAQATAAVSAAHRAQPLWASKTAKERAAILMKWYELILANREDLAIL
                     MTLEQGKPLAEARGEVLFGASFVSWYAEEAKRIQGEVLQTYSADRRVLILRQPIGVVV
                     AITPWNFPSAMITRKCAPALAAGCSIVLKPSEETPLSAIALCALAREAGIPPGVINLV
                     MAGRDDAAALGRVLLSDDRVRKLSFTGSTATGKHLMRLAADNVLKLSLELGGNAPLIV
                     FDDADLDRAAEGALASKFRNMGQTCTCANRILVQRGVYQAFAEKLVEKVRKLRLGPGT
                     EENVTQGPLINSRAVEKVRAHIEDAVAKGARVIQGGHVSAKGPLFFEPTVLADVNPEM
                     QICSDETFGPVAPLLAFDTEEEALTLANATQYGLAGYFYTRDLSRAFRMAERLELGAI
                     GINEAVISSEAVPIGGVKQSGIGREGAHHGIEDFLEIKQVTIGGL"
     misc_feature    complement(347205..348566)
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(347205..347225,347259..347261,
                     347274..347276,347292..347297,347304..347306,
                     347322..347342,347346..347348,347355..347357,
                     347361..347363,347373..347378,347382..347384,
                     347586..347588,347724..347726,347736..347738,
                     347907..347909,347916..347918,347928..347930,
                     347964..347966,348219..348221,348234..348242,
                     348258..348284,348288..348293,348300..348302,
                     348423..348425,348450..348452))
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(347289..347291,347403..347405,
                     347481..347483,347487..347489,347778..347780,
                     347874..347882,347922..347927,347934..347936,
                     347943..347954,348105..348110,348114..348116,
                     348159..348161,348183..348197))
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(347778..347780,347787..347789,
                     347880..347882,348183..348185))
                     /gene="gabD"
                     /locus_tag="CNE_BB2p03440"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            complement(350411..351394)
                     /locus_tag="CNE_BB2p03450"
                     /db_xref="GeneID:10920426"
     CDS             complement(350411..351394)
                     /locus_tag="CNE_BB2p03450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682988.1"
                     /db_xref="GI:339324095"
                     /db_xref="GeneID:10920426"
                     /translation="MNRRTLLTCVLTGTLAFFGQNAVLAAQPYPTRGPIRLVVPFAPG
                     GTTDIIARLLANKLSTELKQTVVVDNRSGGGGVIGANEVVRAAPDGYTLGMATASTVA
                     ANPAINPKVPYNPLTDFTPISNVAATPNVVAVTASFPARSFQTFVAEVKKHPGKYSHA
                     SAGVGGQGHLMMEMLKSAAHLEITHVPYRGSGPAISDTVAGQTQVIYDNIPSILPFIR
                     DGKLVPIAVAAPKRVAALPNVPTFDELGLRQVNRMAFYGLVGPKGLPQDVVAKLSSAV
                     ARVIASPDFAKRIEETGSVTIGNTPQQFAVQIDAEYKALRKLVVEQNLKPD"
     misc_feature    complement(350423..351247)
                     /locus_tag="CNE_BB2p03450"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(351631..351771)
                     /locus_tag="CNE_BB2p03460"
                     /db_xref="GeneID:10920427"
     CDS             complement(351631..351771)
                     /locus_tag="CNE_BB2p03460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682989.1"
                     /db_xref="GI:339324096"
                     /db_xref="GeneID:10920427"
                     /translation="MKSATLRTASGENAFAYRCLQCGETLLLAAAEADAPDRWTCLDA
                     ED"
     gene            complement(351931..352311)
                     /locus_tag="CNE_BB2p03470"
                     /db_xref="GeneID:10920428"
     CDS             complement(351931..352311)
                     /locus_tag="CNE_BB2p03470"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_004682990.1"
                     /db_xref="GI:339324097"
                     /db_xref="GeneID:10920428"
                     /translation="MTSAVTHIQRHHTNARLSKIVRHGGLIYLCGQTARGSPVATGDI
                     GTQTAEVLSRVDALLSEVGSDRTRLIAVTIYLRDMADFVGMNEAWEAWLAGKQAEAPA
                     RTTVEAALATEGLRVEMTVVAAEA"
     misc_feature    complement(351940..352269)
                     /locus_tag="CNE_BB2p03470"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_2; cd06150"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(351946..351948,351952..351954,
                     351958..351960,351988..352014,352033..352035,
                     352045..352047,352054..352056,352087..352089,
                     352093..352095,352099..352104,352108..352110,
                     352219..352224,352228..352230,352234..352236,
                     352243..352245,352249..352251,352258..352263))
                     /locus_tag="CNE_BB2p03470"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(351958..351960,352003..352005,
                     352054..352056,352066..352068,352261..352263))
                     /locus_tag="CNE_BB2p03470"
                     /note="putative active site [active]"
                     /db_xref="CDD:100007"
     gene            complement(352308..353768)
                     /gene="ooxA"
                     /locus_tag="CNE_BB2p03480"
                     /db_xref="GeneID:10920429"
     CDS             complement(352308..353768)
                     /gene="ooxA"
                     /locus_tag="CNE_BB2p03480"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="opine oxidase subunit A"
                     /protein_id="YP_004682991.1"
                     /db_xref="GI:339324098"
                     /db_xref="GeneID:10920429"
                     /translation="MKAPRNVDHTAGANVGGGFTHDLVIIGAGPAGMTAAATASAYGL
                     RTVLLDEQRRPGGQIYRNVTAAPAAVAELLGPDYRHGTKLAQRFAASGVEVHHNTLVW
                     DVENDLTVYAQQSGRSFHVRAPQLLVATGAMERPSPMPGWTLPGVLNAGAAQIALKTS
                     AQVPDGNVMLVGGGPLLLLVACQLLQAGAKIAGIVDTTPASNRTRALPHLVGALGAPK
                     MLGKGLRMLWNLRRARIPVWKQCTGVRIEGDERVQAVSFTVGSATCRIAADTVLLHHG
                     VVPNTQISRLLRVKHDWSDEQLAWQPVLDDWGQTSLPGFRMAGDGAAIAGALAAEASG
                     AIAAIGAAAALGKFDMTRAEHLAGPWRARLASQRPIRPFLDALYRPPEWLTDCADETV
                     VCRCEEVTAGNVREMARLGCEGPNQTKFFSRCGMGPCQGRMCGITVTQVLAKALNRTP
                     VEVGAYRIRAPLKPVSLGSVAALAQPTKPVDSTSKQ"
     misc_feature    complement(352827..353705)
                     /gene="ooxA"
                     /locus_tag="CNE_BB2p03480"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox_2; pfam07992"
                     /db_xref="CDD:254568"
     misc_feature    complement(<353583..353696)
                     /gene="ooxA"
                     /locus_tag="CNE_BB2p03480"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(352431..352598)
                     /gene="ooxA"
                     /locus_tag="CNE_BB2p03480"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:252526"
     gene            complement(353765..354076)
                     /locus_tag="CNE_BB2p03490"
                     /db_xref="GeneID:10920430"
     CDS             complement(353765..354076)
                     /locus_tag="CNE_BB2p03490"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase alpha subunit"
                     /protein_id="YP_004682992.1"
                     /db_xref="GI:339324099"
                     /db_xref="GeneID:10920430"
                     /translation="MFKQISLPRADQPQTVLINVDGREISVTVGQSLAMALLGAGISP
                     FRHTAVSGAPRAPLCLMGVCFDCLVEVDGSQNVQSCMVEVREGMRVRLPSGSRRVGAQ
                     T"
     misc_feature    complement(353804..354037)
                     /locus_tag="CNE_BB2p03490"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:257830"
     gene            complement(354060..355175)
                     /gene="ooxB"
                     /locus_tag="CNE_BB2p03500"
                     /db_xref="GeneID:10920431"
     CDS             complement(354060..355175)
                     /gene="ooxB"
                     /locus_tag="CNE_BB2p03500"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="opine oxidase subunit B"
                     /protein_id="YP_004682993.1"
                     /db_xref="GI:339324100"
                     /db_xref="GeneID:10920431"
                     /translation="MTSRHIDTLVIGGGVVGMSVAYGFARAGDSVCVLDGSDDAFRAS
                     RGNFGLVWVQNKGLGRPAYARWTMLAARMWPSLATELAELTGVDVELHQPGGLSMSFD
                     EKTLTASSEKLNALAKDLGITYPYEVLDASGLRKLTPQIGPEVVGAIYCELDGHVSPL
                     RTLRALVHGFKARGGQLVSNVSVDKIEHKLGEFRVTVGAETFTSGRVVLAAGLGNGEL
                     APQVGLAAPVRPIRGQILVTERVEPFLRYPCHFVRQTGEGTVQIGDSKEDVGMDDGTT
                     LPELARIAARAVRCFPMLADVNLVRTWGALRVMSPDGYPIYDASTECPGAFVVTCHSG
                     ITLAPAHAGPLVDWMRTGIEPADLLDFKAKRFHVQAN"
     misc_feature    complement(<355071..355175)
                     /gene="ooxB"
                     /locus_tag="CNE_BB2p03500"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(354132..355157)
                     /gene="ooxB"
                     /locus_tag="CNE_BB2p03500"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    complement(354135..355103)
                     /gene="ooxB"
                     /locus_tag="CNE_BB2p03500"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(355289..356347)
                     /locus_tag="CNE_BB2p03510"
                     /db_xref="GeneID:10920432"
     CDS             complement(355289..356347)
                     /locus_tag="CNE_BB2p03510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682994.1"
                     /db_xref="GI:339324101"
                     /db_xref="GeneID:10920432"
                     /translation="MRRTLPAERSWTWPFSVVAELRSKRVLRLARSLAVAGFTVSAVL
                     GATCVNAEPHSYPTRPIKLVVGFPPGGSSDATARLLAAALSVKLGQQVVVENKAGANS
                     IIATQYVRSQAADGYTLLSVSSSFAINPALQKLNYNIYKDFAPVALLGVIPLWLVTPN
                     TVPVKSVQDLVSLAKAQPGKLPYASYGPGSAGHLASELLLSLTGTSMVHVPYKGSGPA
                     LVDVMSGQVTMMMPTVASSISLVREGKLRAIAVSSKNRVAAVPDIPTISESGVPGFEL
                     VAWESIQAPAGTPTEIVAKLNTAIRDIIATPTFREKLIKLGIEPQSSKDPAEVAKFIR
                     GEAEKFAKIVRERDIKPE"
     misc_feature    complement(355301..356095)
                     /locus_tag="CNE_BB2p03510"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(357550..357822)
                     /locus_tag="CNE_BB2p03520"
                     /db_xref="GeneID:10920433"
     CDS             complement(357550..357822)
                     /locus_tag="CNE_BB2p03520"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin 2 protein"
                     /protein_id="YP_004682995.1"
                     /db_xref="GI:339324102"
                     /db_xref="GeneID:10920433"
                     /translation="MQCVEGDWVDSPGHTHAKSAFIYATVLEGEIRSQVNDGPVTTYK
                     TGQNFSELPGDRHKVSANGSETKPAKLLAVFVVDTNETDLTTPFGN"
     misc_feature    complement(357562..>357792)
                     /locus_tag="CNE_BB2p03520"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(358065..359678)
                     /gene="gatA"
                     /locus_tag="CNE_BB2p03530"
                     /db_xref="GeneID:10920434"
     CDS             complement(358065..359678)
                     /gene="gatA"
                     /locus_tag="CNE_BB2p03530"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="YP_004682996.1"
                     /db_xref="GI:339324103"
                     /db_xref="GeneID:10920434"
                     /translation="MHPQLSNHSAHRKPYQRARTILIAALIAAPSWAGAGMPADKILD
                     MGLAELRSALDSGAITSAELVGAYLKQIETYDRPADGIHAVLAINEKAMEQATAWDAR
                     RAQHGANQRNAPLAGIPFLAKDNFDVAGMPNTGGSLALNGSIPATNAFVVQKLLDQGA
                     ILLGKTNMSELAASYGWYGYSSVGGQTLNPFNPLRTADGSSSGSAAAVAAKFAPFALG
                     TDTTGSIRSPASVTGTVGMRTTLGLVSRSGIIPMSLTADVAGAITRTVEDQAIVLDVI
                     QGQDKSDAATEDVARPQESLTTGLGIESLAGKTIAVVDNFDGANHEVDDIKRRSVAAM
                     EKAGARIVHVRLPQVYETLQPALLGPIGAAEFRPQFEAYLAGLPGGQPRDLREFMRRL
                     DGYTDKGTRTINPGRYKGLVENLETGATNSPAYIRMLSVVIPSLRRELVELMAQGRYD
                     ALFFPTIGCSAPVVPGKTDPTFVCKSYAYAAAKIASATGFSEITVNGGRSASNIPVGV
                     SFLGKAGDDAKILKIGAAFERIRRSERKH"
     misc_feature    complement(358071..359561)
                     /gene="gatA"
                     /locus_tag="CNE_BB2p03530"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     gene            complement(359762..360769)
                     /locus_tag="CNE_BB2p03540"
                     /db_xref="GeneID:10920435"
     CDS             complement(359762..360769)
                     /locus_tag="CNE_BB2p03540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004682997.1"
                     /db_xref="GI:339324104"
                     /db_xref="GeneID:10920435"
                     /translation="MNLMAIHSKLSRRALLSAAVLATAVLATGSVLAETFPAKPIRLI
                     IPAPPGGGTDGMARLTANALTESVNWAFVPENLPGAGGNIGFDQTFKAPRDGYTLAMG
                     ESSNMVVNQFLYRRIPFDIEKDMLPIALIAKVPLVLIVSASGPHANVGTLVAAGKKAS
                     LSFASSGNGTLAHLVGEMWKRKAGINMQHIPYRGAAQAMTDLIGGQVDLFFASIPVAL
                     PMIQGGKVRALAVTADKRVPVLKDVPTMAEVGYKDIEASVVFGLVGPAGIPSTVVSRI
                     NAEVNKALVRPAVAQQLAAMGVERTAGSFGGNPESLGRLLREERAKWAPVIKTSGATV
                     D"
     misc_feature    complement(359774..360604)
                     /locus_tag="CNE_BB2p03540"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(360957..362339)
                     /locus_tag="CNE_BB2p03550"
                     /db_xref="GeneID:10920436"
     CDS             complement(360957..362339)
                     /locus_tag="CNE_BB2p03550"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="YP_004682998.1"
                     /db_xref="GI:339324105"
                     /db_xref="GeneID:10920436"
                     /translation="MPKGNEHQASTDMKPSNSRDIGLHLGRYVADLDARTIDARTQET
                     VLRCVLDALASAASALEQPGVKAAQQAAQTMYGAGGSPMWFTGRTATDAGALFANSAA
                     TAALDLDDGYRKARGHPGAATIPAAMALVHARPDIAVQDFMAAVVAGYEVGIRMAMAR
                     PGYAPSGTWSGFAVVATCGRMLGASAEIIAQALAIAAQTAPALPALAGLVGSDVKEGI
                     AAGAVSGWAALELAMAGYAGPAAVLEDGRLFDSDTALRDLGGQPLINGTYFKPFGCCR
                     HIHAPLDALLHLQRLHGLAARDIERMEVHTYRATFNLSNKPVPETLVEAQYSVPYCLA
                     LCALHGADALLPLDTRRLYDAEVSDLAKRITVVHDAAIESLFPARSPAWVAVTLSNGQ
                     LLESPLTDPRGDPDHPLSWEDLERKLQVATRATLSPASQQGVLEGMAGLRAGAWDPLL
                     LALSAPARTT"
     misc_feature    complement(361044..362270)
                     /locus_tag="CNE_BB2p03550"
                     /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
                     /db_xref="CDD:260693"
     gene            362477..363385
                     /locus_tag="CNE_BB2p03560"
                     /db_xref="GeneID:10920437"
     CDS             362477..363385
                     /locus_tag="CNE_BB2p03560"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR family"
                     /protein_id="YP_004682999.1"
                     /db_xref="GI:339324106"
                     /db_xref="GeneID:10920437"
                     /translation="MKVDMNMRHIEAFRAVMISGSVVGAAKLLNVTQPGVSRTIALLE
                     MRLGYALFQRKGRRLVPTSEAEALYREVEHLYVGIDRITQVAYDIRYHRAGALRLASL
                     PALAQWLIPAVLAKFLEARPQVRIFVQTLPSTQIAELVATRQFDLGVVELPMSRSGVS
                     VRNLPPSPIVAVLPFEHRLAAREKVSLRDLAGERLVLPSPQSYLRYQIDDAFNRQSIV
                     PDVVAETPTSPLVCALVAEGAGIGLVSAWAPSPHGDTRTVQRPLDELLQSQYACLRPE
                     GAVPMVLAEEFQSLLSAQMDAMAPGH"
     misc_feature    362492..363373
                     /locus_tag="CNE_BB2p03560"
                     /note="DNA-binding transcriptional regulator LysR;
                     Provisional; Region: PRK11013"
                     /db_xref="CDD:236819"
     misc_feature    362495..362674
                     /locus_tag="CNE_BB2p03560"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    362765..363349
                     /locus_tag="CNE_BB2p03560"
                     /note="The C-terminal substrate-domain of LysR-type
                     transcriptional regulators involved in the catabolism of
                     opines and that of related regulators, contains the type 2
                     periplasmic binding fold; Region: PBP2_LysR_opines_like;
                     cd08415"
                     /db_xref="CDD:176107"
     misc_feature    order(362807..362812,362816..362821,362828..362830,
                     362840..362842,362846..362866,363140..363157,
                     363173..363178,363182..363187)
                     /locus_tag="CNE_BB2p03560"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176107"
     gene            364321..365460
                     /locus_tag="CNE_BB2p03570"
                     /db_xref="GeneID:10920438"
     CDS             364321..365460
                     /locus_tag="CNE_BB2p03570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683000.1"
                     /db_xref="GI:339324107"
                     /db_xref="GeneID:10920438"
                     /translation="MEDEALLDSLLYRGEGDALDFKKMQYAFEGADDNHKSELLKDIL
                     AFANAWRDTTAYIVIGVNDAREVVGLDKDIDDSRLQQFINGKVNRPIRFHYRSLLYKG
                     TTIGIYTIPLQDRPFFSVRDFGKVAAEAVYVRRGSATALAKPDEIAKMGAAAVQAHRP
                     RLSMRIFGADGEVSASESLAAVVNDLRIPEASEIPDHVDTSPASRFGLTDHFMNEDYF
                     RQVAAYIRQREGLVKFGLLIENLGDAYADDVKLTFRVPASEGFQLMAGDDLERTPRTH
                     WDAVRSHRWSGTVDPSVEISSNADTLTATIWLGKIHAGDRRTTVDLYFSHPPASLSHA
                     DVTVHADQLKAPLSFSIPLSFQVNTPPQVTVEQLLEIAHRFDESE"
     misc_feature    364363..364737
                     /locus_tag="CNE_BB2p03570"
                     /note="Divergent AAA domain; Region: AAA_4; pfam04326"
                     /db_xref="CDD:252528"
     gene            complement(366213..366458)
                     /locus_tag="CNE_BB2p03580"
                     /db_xref="GeneID:10920439"
     CDS             complement(366213..366458)
                     /locus_tag="CNE_BB2p03580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683001.1"
                     /db_xref="GI:339324108"
                     /db_xref="GeneID:10920439"
                     /translation="MKTEDCTLAIGEGVATVKRRGTRGTTVANILGTVEANGIEVICL
                     DRLVHGIFEDKLDGWCAGGAVTTLLSRPIGPRQPTSC"
     gene            complement(366455..368947)
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /db_xref="GeneID:10920440"
     CDS             complement(366455..368947)
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase superfamily II"
                     /protein_id="YP_004683002.1"
                     /db_xref="GI:339324109"
                     /db_xref="GeneID:10920440"
                     /translation="MGACSTCQRALSGRKGGGRTSIAVFARFRMRASDFVRQTVSDLT
                     QALPTLELQTEDRLYGEPWLGHQLLDDQGPAITRPVTSQKRVRISHDGRRIVLGFDCG
                     FVEAMVLNRLLERRIVSLEGQRLPRGFRYAGTGRLDLEAYLVQPDPIGALGELVGMVK
                     AAGGEPEFAQGFLEHFRQRLRRSMRQALPLRHAVWTTGVCAADTIVGTATKTHLVDSS
                     VWGGPVIKAGQAVRFDRQSDGRYQYQVRDKSYVVSLDEITTRYSVEKSAQAWEIVHEG
                     LATRYPGQASRLRKRLLALGIDRWLDWEFQQEDLVELLLKPNGAVAAWEQGCGKSRLA
                     AGLILLSGVKHGLIVVEARLIAEMGAELEQVMPASDVQVIQSPEDLVRLGRINLIAYE
                     RLRMPVDRQASRRITYAHRLRRRIGLLVADEGERLSNPASDQSRALWQLSAKRRYILT
                     GSPIANYPRDIFGLIAFTGGDGTAAQPYGYRRGYLEANWLASVQHAERGIDRFRSDFV
                     VLEWVTWEFAESLQDGAKREVPKIGNLPRYRQMLAPHVKRRLVCEPDVARYIRIEQPT
                     VEIVETSWDPAHLSLYLSTADEFAQWYREIRKDGRPNNLIAILARIRAVHFAANYPQH
                     GVDGVGGLAQLTSKQRAVIERLEAIAGEGKQAILFAENPGVVNLIASQLKAKGVETVP
                     FHGGIPIAKRVADKDKRFVGGNATGLLCTKASGRAGYNLPNADYVLFYDRSWTWRIEY
                     QAMRRALRWNRKGQLKVVYFHLPGSIDTYQDQMVAHKRDAMEAGLDWATPELEDEAFL
                     HMDTLLDEFVDDLAKLHGREARDQRELLKEAA"
     misc_feature    complement(366668..>368053)
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /note="Superfamily II DNA/RNA helicases, SNF2 family
                     [Transcription / DNA replication, recombination, and
                     repair]; Region: HepA; COG0553"
                     /db_xref="CDD:223627"
     misc_feature    complement(366686..367036)
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(366809..366817,366893..366898,
                     366956..366967))
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(366704..366706,366713..366715,
                     366725..366727,366788..366790))
                     /gene="helZ"
                     /locus_tag="CNE_BB2p03590"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            369666..371162
                     /locus_tag="CNE_BB2p03600"
                     /db_xref="GeneID:10920441"
     CDS             369666..371162
                     /locus_tag="CNE_BB2p03600"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase family IS605"
                     /protein_id="YP_004683003.1"
                     /db_xref="GI:339324110"
                     /db_xref="GeneID:10920441"
                     /translation="MRATWSASDGSSLHDGPSNPAASTASCTASIVVHNRPRPVHDYE
                     PRNGTQRPLPMLLADTIELVTSQREVDYFVRAAGCARFVWNWALAEWNRQRAGGGKPS
                     AMALKKSFNAIKYQQYPWMADIHRDAHAQPFANLSKAWSKFFSDIKSGIKAHAPRFKK
                     KGQCKDGFYVANDKVRFDGQSVVLPLIGRVAMREALRFPGRVIGAAVSRRADRWFISV
                     QVEVADDVAFVPRTGNGVVGVDLGINSAVTLSTGETFEGPKPLKAALRRLRIRSRRLS
                     RKVEMAKPGRAAFSRDFVGPRRPNTKPRPARSSGQIDSAARLARLHARVANIRQDFLH
                     KATTRLCRENQVIGLEDLNVRGMLRNDRLARSLSDMGLGEFRRQMEYKAKRYGTHLVF
                     ADRWFPSSKLMSCCGHKLDKLTLSERRVVCPACGMSHDRDHNAAINLERLATETALPV
                     ASDSATNRTARGMSPIAGGKVTSVRDEVGQQGASGREGNGAHSCARFS"
     misc_feature    369828..369965
                     /locus_tag="CNE_BB2p03600"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    369888..371033
                     /locus_tag="CNE_BB2p03600"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    370020..370736
                     /locus_tag="CNE_BB2p03600"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    370782..370988
                     /locus_tag="CNE_BB2p03600"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            complement(371224..371703)
                     /locus_tag="CNE_BB2p03610"
                     /db_xref="GeneID:10920442"
     CDS             complement(371224..371703)
                     /locus_tag="CNE_BB2p03610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683004.1"
                     /db_xref="GI:339324111"
                     /db_xref="GeneID:10920442"
                     /translation="MKEIDLGSRPRDERAFAAPGEQYYRELATIAALAYRRMLDRVFW
                     HPPADVLRFEVRAIPASNGTEYTVTAILDGIGEVWFDYDSLPARWDSIAVFEVSWSLS
                     QLHAAEHGMECVSFEKPGGRPGNELMPDYSSTQDPAEAARDRWKVLNRLRKATERLG"
     gene            371888..372373
                     /locus_tag="CNE_BB2p03620"
                     /db_xref="GeneID:10920443"
     CDS             371888..372373
                     /locus_tag="CNE_BB2p03620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683005.1"
                     /db_xref="GI:339324112"
                     /db_xref="GeneID:10920443"
                     /translation="MRFTRYERHNPIDFNARRQAAFARKQARERERYPLLADHVAAEQ
                     HSVDEEIARRTVRADSFEQGMRDYYARSWRDARRIYFAQSEAVRAVIRAKWSAWVGPT
                     TSTYFAWMVDVESGNQARRLADCRDRDAAARAARTPRSQCRNSWLSDMRRWPQLPLAP
                     R"
     gene            372464..373595
                     /locus_tag="CNE_BB2p03630"
                     /note="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:10920444"
     gene            373953..374474
                     /locus_tag="CNE_BB2p03650"
                     /db_xref="GeneID:10920445"
     CDS             373953..374474
                     /locus_tag="CNE_BB2p03650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683006.1"
                     /db_xref="GI:339324113"
                     /db_xref="GeneID:10920445"
                     /translation="MAPAQGSDGSLLARGVHLRPTPCPCPGATYSCDHAASQRCTAGG
                     QVIEGQAMPRDHQLTTPEAFDAAYAKAISLVHAHRAASVPLVQRHLRIGSDAARRLLA
                     RMARETTFVRPMLSGLYIYTPEPLANELKSLHGFVAEVLARSAKGPLDPDTIRSLGEK
                     HALQNYLQAGGCQ"
     misc_feature    374130..>374273
                     /locus_tag="CNE_BB2p03650"
                     /note="Ftsk gamma domain; Region: Ftsk_gamma; cl09645"
                     /db_xref="CDD:263830"
     gene            374939..375580
                     /locus_tag="CNE_BB2p03660"
                     /db_xref="GeneID:10920446"
     CDS             374939..375580
                     /locus_tag="CNE_BB2p03660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683007.1"
                     /db_xref="GI:339324114"
                     /db_xref="GeneID:10920446"
                     /translation="MRARFPPTRPSMADDLLICAHCGSQPRFIANRFEAVITCTGCGI
                     TTPPESLEAGHDQAHTVLRGIWNTRLTPRPPEQHELSAIVRKELSSSDLGTVLALIAR
                     NEDDWETRGPLFAAMAEKLLQPEPFLQELVPAEALLKDASRYRKLMRRAKLIHIDGRP
                     WVRIEPIDALPATVSEELFGGTIILEEFLARVLDTTPDAGEGVASPQGMQPKP"
     gene            375632..376570
                     /locus_tag="CNE_BB2p03670"
                     /db_xref="GeneID:10920447"
     CDS             375632..376570
                     /locus_tag="CNE_BB2p03670"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA non-specific endonuclease"
                     /protein_id="YP_004683008.1"
                     /db_xref="GI:339324115"
                     /db_xref="GeneID:10920447"
                     /translation="MQKPLFLAAAIAATFVGSTISTAVSTAAYAKGPATDCPHIFGTN
                     GKPRVASSASASRTQFLCFRGYAVQTSATTRTALWSAENLTAPAVLAARSVPRGSDFY
                     EEAEIPAADRARLSDYGRGTGLDRGHLSPSGDFPDLASQAESFSLANIVPQAAASNRR
                     LWSHIETSTRRMVREYGQAFVVTGPAFDPAQAARLNGRISISTYMWKAVFVPGVGAAA
                     YVARNDATPQYSVLSIAELASFAGVDPFPRLDKSYRDSPMALLAPTPHPGEKTGRKVS
                     LATLTSTAVERPDQSVAQEPRHSSVLPFVRAVLNHN"
     misc_feature    375824..376387
                     /locus_tag="CNE_BB2p03670"
                     /note="DNA/RNA non-specific endonuclease; Region:
                     Endonuclease_NS; pfam01223"
                     /db_xref="CDD:250457"
     misc_feature    order(376004..376009,376013..376015,376103..376105,
                     376127..376129,376139..376141)
                     /locus_tag="CNE_BB2p03670"
                     /note="active site"
                     /db_xref="CDD:238043"
     misc_feature    order(376004..376009,376139..376141)
                     /locus_tag="CNE_BB2p03670"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238043"
     misc_feature    376103..376105
                     /locus_tag="CNE_BB2p03670"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238043"
     gene            376583..376738
                     /locus_tag="CNE_BB2p03680"
                     /db_xref="GeneID:10920448"
     CDS             376583..376738
                     /locus_tag="CNE_BB2p03680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683009.1"
                     /db_xref="GI:339324116"
                     /db_xref="GeneID:10920448"
                     /translation="MDRIKQIIHVLRTDKEARLQTAGVVAFVLFLCWWGATGHFDNDP
                     WLPNFLR"
     gene            complement(377486..378640)
                     /locus_tag="CNE_BB2p03690"
                     /db_xref="GeneID:10920449"
     CDS             complement(377486..378640)
                     /locus_tag="CNE_BB2p03690"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator Fis family"
                     /protein_id="YP_004683010.1"
                     /db_xref="GI:339324117"
                     /db_xref="GeneID:10920449"
                     /translation="MRQAIALDVRGLLARYDMPTRMKAEIEVAVAGNVKRILSQTRIS
                     HKNASIKTQERRMYTVCRSFVELRACGFHIESPYSLRHKHVQALVDYWVSQKQSGGTI
                     ENKLSHLKAFCQWIGKHNLIRTIGDYVDRKEHGLVRSYVTTTDKSWSGNGIDATAKIA
                     EIGAEHPRVAIQLKLQAAFGLRIEESFSLKVSTALRNLDTMRVVDGTKGGRAREVPVQ
                     LRLAVLGEAAALVDPSSGSTTPASYSINEWRSHYNGVLRKYGIYKKGLGVTSHGLRHQ
                     WLQEYYKTLTGVDAPVKGGKALDLEAHRQAIQAVVEAAGHSKASKTGAYLSTFSAMAR
                     KDKPQVNPDQAKEALVAAGGNKAKAAQALGISRQALYRLLDRHQAGGKSV"
     misc_feature    complement(378275..378496)
                     /locus_tag="CNE_BB2p03690"
                     /note="Phage integrase, N-terminal; Region:
                     Phage_int_SAM_2; pfam12834"
                     /db_xref="CDD:193309"
     misc_feature    complement(377663..378148)
                     /locus_tag="CNE_BB2p03690"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(377666..377668,377828..377833,
                     378017..378019,378092..378097))
                     /locus_tag="CNE_BB2p03690"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(377666..377668,377693..377695,
                     377819..377821,377828..377830,378017..378019,
                     378095..378097))
                     /locus_tag="CNE_BB2p03690"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(377666..377668,377693..377695,
                     377819..377821,377828..377830,378095..378097))
                     /locus_tag="CNE_BB2p03690"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(377666..377668,377819..377821,
                     378095..378097))
                     /locus_tag="CNE_BB2p03690"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            379740..380741
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /db_xref="GeneID:10920450"
     CDS             379740..380741
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid segregation protein ParM"
                     /protein_id="YP_004683011.1"
                     /db_xref="GI:339324118"
                     /db_xref="GeneID:10920450"
                     /translation="MKLSTVAIDVGYGNTKSAFPLGSDIATNMFPSLAPIASTTSLTP
                     HSGSILRSRDVVNVLVDGARYEVGPEVSLSAPRGNTGRSLSEDFVTTANYAALLAGAL
                     HYSKATEIDRLVLGLPVHNTQKYAGYLKDRFSGELEFGWGPIHVRSVLPLPQPLGTLI
                     TFIQQSGKQYDPDNSYLVIDVGYFTTDWVVARGYTMDDSRSGGVPGGASSIYQQVASL
                     IAKAEGEPVDSIERIDKAIREVKPMLFFNKDLDVRPFLEEAIAVSRASVKEVQARVGR
                     TEDIRAIILTGGGANLYAPAIKAAFPRNTVQVMDAPCFANVRGFYTIGSARQMSKSS"
     misc_feature    379752..380702
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /note="Plasmid segregation protein ParM and similar
                     proteins; Region: ParM_like; cd10227"
                     /db_xref="CDD:212669"
     misc_feature    order(379764..379766,380277..380279)
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    order(379770..379781,379785..379787,380280..380288,
                     380598..380603,380613..380615)
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    order(379842..379844,379848..379850,379935..379937,
                     379944..379952,380025..380027,380193..380195,
                     380262..380264,380313..380315)
                     /gene="parM"
                     /locus_tag="CNE_BB2p03700"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            complement(381875..382093)
                     /locus_tag="CNE_BB2p03710"
                     /db_xref="GeneID:10920451"
     CDS             complement(381875..382093)
                     /locus_tag="CNE_BB2p03710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683012.1"
                     /db_xref="GI:339324119"
                     /db_xref="GeneID:10920451"
                     /translation="MSFKGFSVIVGRLQIRAMRQMASGTVPACQSDAETYHVYRRNAD
                     GSTQLQHMEADFDAAFTYCAGKQRPTLH"
     gene            complement(382205..383278)
                     /locus_tag="CNE_BB2p03720"
                     /db_xref="GeneID:10920452"
     CDS             complement(382205..383278)
                     /locus_tag="CNE_BB2p03720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683013.1"
                     /db_xref="GI:339324120"
                     /db_xref="GeneID:10920452"
                     /translation="MTRLSVIVKHWTPAQWDALIMQYLPANVLTDKFWRGRPGPCPIC
                     GGQDRFTYDNKRGRGDWVCRHCKDGEPMAGDGLELIRRLRGMSFAELANELEGNRPPC
                     PLPQVARPATPKAPMSDEAKAKRIQRVWANAAPLVPGDAAMRYLAARVPGLVAPRPSA
                     LRLATMDYYHDGELMGRYPTIVAQFTLPDGRTATVHRTALDPAKPAKAYIVTADGEIL
                     PAKRNDVSALPTAGGAVRLMSPRDGVLGVAEGLETAYAAHMLFGVPTWYCLNRVLLNR
                     FVVPQGMGIHTLHIFADFDEIDPKTGKSPGMADALALAKRVRNEGLTVHLHRPMVRGT
                     DFCDQWLTANRLQGIAGQRAACA"
     misc_feature    complement(383048..383173)
                     /locus_tag="CNE_BB2p03720"
                     /note="Zinc-binding domain of primase-helicase; Region:
                     Prim_Zn_Ribbon; smart00778"
                     /db_xref="CDD:129016"
     misc_feature    complement(382229..382549)
                     /locus_tag="CNE_BB2p03720"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     gene            complement(383505..384023)
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /db_xref="GeneID:10920453"
     CDS             complement(383505..384023)
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein Ssb"
                     /protein_id="YP_004683014.1"
                     /db_xref="GI:339324121"
                     /db_xref="GeneID:10920453"
                     /translation="MASVNKVILVGNLGADPEVRYMPSGDAVANIRIATTDRYKDKQS
                     GEMKEATEWHRISFFGKLAEIAGQYLKKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVA
                     DQMQMLGSRQDGNAGDDDGYGQRSTRQSQGQQPARQSQGEQGGQQRQSAAPGQQPGSS
                     DGFDEDSDDIPF"
     misc_feature    complement(383508..384020)
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    complement(383700..384005)
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(383730..383732,383739..383741,
                     383772..383774,383799..383801,383862..383864,
                     383868..383870,383913..383921,383994..384005))
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(383721..383723,383727..383729,
                     383766..383771,383775..383777,383781..383783,
                     383805..383810,383847..383849,383853..383855,
                     383859..383861,383865..383867,383871..383876,
                     383910..383915,383934..383936,383964..383966,
                     383982..383990))
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(383706..383708,383787..383789,
                     383793..383795,383799..383801))
                     /gene="ssb"
                     /locus_tag="CNE_BB2p03730"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            complement(384048..384812)
                     /locus_tag="CNE_BB2p03740"
                     /db_xref="GeneID:10920454"
     CDS             complement(384048..384812)
                     /locus_tag="CNE_BB2p03740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683015.1"
                     /db_xref="GI:339324122"
                     /db_xref="GeneID:10920454"
                     /translation="MAFIQRFLGALQDALQPRPAETAPAGAQAVGTGARNEVHIEIGG
                     VPNLFRDEGERIVHFIAVFDPRPTPTRFGQKLLPDPVPYWSVAGEHPGAELSGVIATA
                     IREHAPPAVRMEMPGGNGAAQSSHEAQPGAQRAPAATPKVSERRDHASSVYRGTIAFW
                     GEAEFPDRKRIGGTYTSFALKLETATGAVETLQGEGLKDAIAEAGCQLGDRVEVRRLK
                     KVKVPAFHRKSGKPKLDDNGQQVLWDKWLWSIARSH"
     gene            complement(384821..385249)
                     /locus_tag="CNE_BB2p03750"
                     /db_xref="GeneID:10920455"
     CDS             complement(384821..385249)
                     /locus_tag="CNE_BB2p03750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683016.1"
                     /db_xref="GI:339324123"
                     /db_xref="GeneID:10920455"
                     /translation="MEMKPAAWQLDFFGEAAPVANDPPKREPLPDPMYWSEAVRDQMI
                     DALISLACDSRRGDNLPESLADCADLMRARMHDKAVEKDDFDMTLGWIFGYWDGALPY
                     AYVCAVSGIDPEVLQDIILNHPRLKRDLEEVRRMRCGTLL"
     gene            complement(385347..385652)
                     /locus_tag="CNE_BB2p03760"
                     /db_xref="GeneID:10920456"
     CDS             complement(385347..385652)
                     /locus_tag="CNE_BB2p03760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683017.1"
                     /db_xref="GI:339324124"
                     /db_xref="GeneID:10920456"
                     /translation="MESLANLLRSPVRLFFTLMAIYVASQSALCAFFLVIVAGSWCYH
                     KLIGRGHTVPTPRDVVMPKPQAAVAEPEQSKAPQVPTYAKSPVVVPLKRQDAARRAA"
     gene            386394..387563
                     /locus_tag="CNE_BB2p03770"
                     /db_xref="GeneID:10920457"
     CDS             386394..387563
                     /locus_tag="CNE_BB2p03770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683018.1"
                     /db_xref="GI:339324125"
                     /db_xref="GeneID:10920457"
                     /translation="MDKNSKFELTEPPRQPSILDLAREQLAPHFDQTAIARIVQAGEE
                     IAIARERIFSEHVIIGSRLTQIQQIMCTSLTAHRSDPAQAANEARMLLYRFADHSLKI
                     PKWSAKRYVQIYERFMHHNDALTFLNVGELNILKRHDITADEVALVVKAKKANETFSR
                     NEILPFIDRYRALAAEMETLETQLAGTEEELSASMAQQDQNQFELKYLKEQIAVAGRS
                     TEAQQAALIEAQTALASQSANVDALQTAVEMVNREKADLQRQISEMKIRVEVKEVPVV
                     PERYASVTQAIEDAQARLQQVTRELQESEAQLANRRGAVAANELPAPASTTPPAERHI
                     GLRLDGLIADFDALRDKFQSCRQARELRDHRNTISTLAASVATFHQELLTAAKTA"
     misc_feature    <386904..>387506
                     /locus_tag="CNE_BB2p03770"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     gene            387574..388755
                     /locus_tag="CNE_BB2p03780"
                     /db_xref="GeneID:10920458"
     CDS             387574..388755
                     /locus_tag="CNE_BB2p03780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683019.1"
                     /db_xref="GI:339324126"
                     /db_xref="GeneID:10920458"
                     /translation="MTRRHTKKFHEQFLHPAWVQDRTLSANLRLSTAMVNTLAVKPMF
                     EMIFGAKKDDVQALRDSVEQSSTVLGSPFLAFAPTLETPADWACFTEGSTSTLTFDRL
                     ARMTPELTPVDKMLLEHYNRLYIGALYDVLNMSVLASPLLGISNELADYLRTVPQHRV
                     ELAISSRAIPLFKWRFANPVFWAEASGGRMSSELMAHYLMVQSPVKADKLPHSGAWGG
                     LRIARPLQEAYAEAFVYFKCRAKGVASLFNMNVTTVRQMYLRIHGESSPSGHSPTSCA
                     WYLDSAGKRLQSTFHLWLFRSALSADASIPEAFIAAVNIAKHMFGDESKVPAERAFHL
                     LRSMATEHELDVRTCRSCGTAYVTAIGDLAHSVLCPCCSGTLSSPNVGRVGRTRPRKK
                     R"
     gene            388945..389139
                     /locus_tag="CNE_BB2p03790"
                     /db_xref="GeneID:10920459"
     CDS             388945..389139
                     /locus_tag="CNE_BB2p03790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683020.1"
                     /db_xref="GI:339324127"
                     /db_xref="GeneID:10920459"
                     /translation="MFVARQKRVSLKDYLAKYPHCRTNRGIACAHCNSGSIRMWRNSG
                     LLSNRDQHLCNHCGSYLYDS"
     gene            389379..390209
                     /locus_tag="CNE_BB2p03800"
                     /db_xref="GeneID:10920460"
     CDS             389379..390209
                     /locus_tag="CNE_BB2p03800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683021.1"
                     /db_xref="GI:339324128"
                     /db_xref="GeneID:10920460"
                     /translation="MKTTLKLGLSAISLATLLALAACGGGGGGDETPAGAPATTPPSA
                     PTPTITVQGSAPAVSADPLAVVFVPQTETSTRSVLQSIASNAFPAQFQKAPNDGAYTQ
                     LGIDASSLITLNGGTVADVAGNGDFAIGRWTNGSNSIGSISANQGAHYVVGKPLALVR
                     TPGPTAKLTCTYLSGTRPTSVSGNFTPGSVNSATATIDLNGPALDSFMIDVNIGADAH
                     AASTATGTTISGVLQASGVLHHVQVMGNDPNKPYLAIGYAMPTPSSGDVTGVVVMKCQ
                     "
     gene            complement(390317..391573)
                     /gene="pilV"
                     /locus_tag="CNE_BB2p03810"
                     /db_xref="GeneID:10920461"
     CDS             complement(390317..391573)
                     /gene="pilV"
                     /locus_tag="CNE_BB2p03810"
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin, conjugal transfer protein PilV"
                     /protein_id="YP_004683022.1"
                     /db_xref="GI:339324129"
                     /db_xref="GeneID:10920461"
                     /translation="MFLTEAAFQLTIAAAGMAVMIHNTNNLVDDALAMGTGQYMANVA
                     SAVNTYVFDNMTVLAGSPSGPTTIAAGSVTATVANPLHPTVQDLINLKLLPIGFSDVS
                     PLGLTFRVDLTPTNCSTGLTNCTIPGAMYSTTAYRDSAGRVRIDQLASVIATAGVDAG
                     MSYAESPAVITGMAASWSAPNPLAGSQPGVLMMRVGNTSLLAQSMNQFYKRDGSLNLT
                     GPMDANNQGMNRVGNFQSNGSVSAAGDVAAGSNVSGNGVYGNYMQSNGDLRAIANVSA
                     NGVYGNYVQSNGSAYVAGLISSGSQISAGGNVTSAGSVLSSGYLYAAGAVVPSTGGGQ
                     QVWEGWGCGDPQGAIRSDPNGKILSCQNGVWRNSSGGAGLVDFAFVTGCDANGNSGAL
                     YRFYFANGATKDLFAPNGGTCGSGGG"
     misc_feature    complement(390485..391450)
                     /gene="pilV"
                     /locus_tag="CNE_BB2p03810"
                     /note="Bacterial shufflon protein, N-terminal constant
                     region; Region: Shufflon_N; pfam04917"
                     /db_xref="CDD:113681"
     gene            complement(391733..392371)
                     /gene="pilS"
                     /locus_tag="CNE_BB2p03820"
                     /db_xref="GeneID:10920462"
     CDS             complement(391733..392371)
                     /gene="pilS"
                     /locus_tag="CNE_BB2p03820"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein PilS"
                     /protein_id="YP_004683023.1"
                     /db_xref="GI:339324130"
                     /db_xref="GeneID:10920462"
                     /translation="MTDATKTLTADQAALHVAPATTGQPALMNPKTAPAGQRNRRTRK
                     QWGGGVLDEYGFYLLLAGIALVAILVLFSRNQTDSQVQQLTTELNGVVGKVKTSYRGQ
                     YNKVSIGALINNGVFKDLTTMTESGTTVILQPGGGALTVAPAQLLSANDSLQWTIPQQ
                     PDAACISIVASYQGSAGKILVNGTTIKAVGGSVDPSKVACSGGSNTIDLFIA"
     misc_feature    complement(391751..392137)
                     /gene="pilS"
                     /locus_tag="CNE_BB2p03820"
                     /note="PilS N terminal; Region: PilS; pfam08805"
                     /db_xref="CDD:255048"
     gene            complement(392436..393662)
                     /gene="pilR"
                     /locus_tag="CNE_BB2p03830"
                     /db_xref="GeneID:10920463"
     CDS             complement(392436..393662)
                     /gene="pilR"
                     /locus_tag="CNE_BB2p03830"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin corregulated pilus biosynthesis protein E"
                     /protein_id="YP_004683024.1"
                     /db_xref="GI:339324131"
                     /db_xref="GeneID:10920463"
                     /translation="MMQNLIKRFAGVFSRKVGTPALRAGDRVFADKLFWAKYRFRSMR
                     ATYYYDLAKRIQHMPGEPIANHFAKDAARRAGEPLGILAAHWLSRSEGIDGQMQRSRV
                     TEIFRGTVPDEDIPILAVAEDGGDIREGLETLARNLTALGEARAGIALTLAGVLMTLV
                     ILHAYLAAMAFLVGPKVDDSFRTMLDVSQYGPIGKTFHNTTTFLRHWGWLVVLLEVVA
                     CVWVLRALKSYVGPHRAWLDRKVLVFDFFRRFQSAQFLAGLSAVTKRFGGDLRSLADG
                     LTLMRANAYPYLSHHIERMELNLEYNPNEGGKVFDTGLFDRDTSYRIQDIAEYESDLS
                     KMLHTVADDLLVTTPKLMLQRAAQFNRRATIVLIILITGLAFMPAFMAQEMKVRTQLA
                     GMAGKRPVQPAPSTQP"
     misc_feature    complement(392637..>393332)
                     /gene="pilR"
                     /locus_tag="CNE_BB2p03830"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PulF; COG1459"
                     /db_xref="CDD:224376"
     gene            complement(393659..395503)
                     /gene="tcpT"
                     /locus_tag="CNE_BB2p03840"
                     /db_xref="GeneID:10920464"
     CDS             complement(393659..395503)
                     /gene="tcpT"
                     /locus_tag="CNE_BB2p03840"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin corregulated pilus biosynthesis protein T"
                     /protein_id="YP_004683025.1"
                     /db_xref="GI:339324132"
                     /db_xref="GeneID:10920464"
                     /translation="MGLFSKREKSDGFGGGGSGVTVVTGGAAAFVPGTPGAPGGPAAA
                     RPVPQGSEIRTDEIATVDDLPEFVRTLYDELDMAPSLRHVICPVLVEAAASADGRGRF
                     ALILTRDMANSDVTEEILRQLRLRFDPAAPVMHLAAAQVMVALSRGSVEPTGGSDKLA
                     VGAGRRPASALWQNFDAVGRFALREGASDLHWEVEDQGGYSKVRLAIDGYLVDPPEFR
                     METGVMLDTLSHVWQKGKGGSQGVFSRVLPQQTSIRAKIDGQPVVFRWASMQSATGHV
                     TVMRMHREEVATKRVDFVDDLGYFEQQAQLLDRNTMQLGGGTVLVGVVGSGKTTTAHA
                     IMQRLPAWMNKMAIEDPVELLAEGTHHFSVSRTLDGANRDEDPFIAAKRQIKRMNPHF
                     VMVGELRDHESAGLFRDVAGAGLRALTTVHAPSALTAPDRLSDGELRIPRSVLATPGF
                     VNLYVYQALLPKTCPCGLCGADMKRMLGADKLRQIERLFQFDVEGIRLRNPQGCDLCR
                     RPNLPDLNGARGRTVVAEMFEPDELDLSFIRDAKNIELAAYQRSKRQVGFDVSDSTGK
                     TVFEVAMYKVFAGIVDPREAEKLTSLDAYEARRQRELARATNTMGIHA"
     misc_feature    complement(393941..394771)
                     /gene="tcpT"
                     /locus_tag="CNE_BB2p03840"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(394313..394318,394454..394459,
                     394463..394465,394517..394522))
                     /gene="tcpT"
                     /locus_tag="CNE_BB2p03840"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(394316..394330)
                     /gene="tcpT"
                     /locus_tag="CNE_BB2p03840"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(395513..396211)
                     /locus_tag="CNE_BB2p03850"
                     /db_xref="GeneID:10920465"
     CDS             complement(395513..396211)
                     /locus_tag="CNE_BB2p03850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683026.1"
                     /db_xref="GI:339324133"
                     /db_xref="GeneID:10920465"
                     /translation="MRATPFPLSFPLRRAAVAAFALLVAGPVLADDDKSLTQKLIDAD
                     AKVALQKLQQELDKGAPPPAVSAAPTGAAAKPAAERAPQTIALYGVDGRSAGGGMTLR
                     SYVRWGDQVYPAKVGAKWRGYIVSAITESGTTFTRGKARVFAPLVQDDAAVLVDTPQT
                     GSASTAARTGPLPNQGMPTGQGTPPFFPLPPIGPAPGAASVPTPPPTLPPVSVSAMGA
                     PTALASPPATVAQR"
     gene            complement(396225..397568)
                     /gene="pilO"
                     /locus_tag="CNE_BB2p03860"
                     /db_xref="GeneID:10920466"
     CDS             complement(396225..397568)
                     /gene="pilO"
                     /locus_tag="CNE_BB2p03860"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase PilO"
                     /protein_id="YP_004683027.1"
                     /db_xref="GI:339324134"
                     /db_xref="GeneID:10920466"
                     /translation="MILDIHGKKLVFGMQWRTLTGSDAPSALAANIAREVRAARIWHE
                     DQALHMGYLDTADAQAKIKDKLYSGAAAIARVPELVPNALFVFRLEAPGQAPVYLVCG
                     IVKGRPRVGFDQVVRDEKTLAQLAVDFPAKCDGEFKLVGNMPELLPLLPPERHVMHVP
                     YTLDMLVAHAGPAALLKKPRTTSQRKRVLTLAVLAGSAAVSWPYGKAEYDAYQRRLHP
                     PPPQKTPAERYADDLAARAARPVALTGVALPAWAQWFANDVPLQVGGWSLASIQCADV
                     VTPKANCALTYEIRQGAKGLTNQTFVASLPDAFRAPVFQANDTKAVVSAQVPVGEVRN
                     LGAVLEQPPKAMALRVGFGSQLQTLRPVATKAELKELLIFGTVPPEGPASLLHPVLSA
                     TWEISGPLRNVTEFAAFPPNVTVKALDLVVNLDAAPDIKQSKFMLTVKGDAFARD"
     gene            complement(397565..399367)
                     /gene="pilN"
                     /locus_tag="CNE_BB2p03870"
                     /db_xref="GeneID:10920467"
     CDS             complement(397565..399367)
                     /gene="pilN"
                     /locus_tag="CNE_BB2p03870"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilN"
                     /protein_id="YP_004683028.1"
                     /db_xref="GI:339324135"
                     /db_xref="GeneID:10920467"
                     /translation="MKLNRLFRPTAGAVLVCSTLAGCVSPQLQRDIRQAADDARAEQM
                     ARTESLYAQMRRDRTAVEAEQEVLKPYLVGKPVPTARNVTLPLALRNNVDTWVMFPER
                     VMPLAVAAQRITMATGIPVKIESDVYLPSNLLMPRSLMTQAGGQVRNQNGTAGGNPLS
                     TTGLGPAPTTNGPLPGALLAGGANATAANQATPLIETALNVEFKNSEKMPLANMLDLI
                     ATRLGINWEYNASKGVIRFYRLTTKMWQLPMKAGTSSFTTEFKQSAQGGSNANVGGGG
                     QATQIDAAVKSEAKELDDMDGIRKSIEPALTMVGRAELNPATGILTLKDTKEAVEAAD
                     EIVRKQIAIYSRMVYVKFQTIDFTVTDNGEAGADWNAVLTKALEHIPSFTFTALSPAS
                     LVSSNAGSFGLGITSGGWNGTQAIVNALKQYGTVTTSVTIPMALRNRHGAQYNNRRQF
                     TYVSSTTPASTTVGGTGGIPGITTSTGTVGFKLTLFPDATTRDDVNLTLAFDQSALDG
                     PIETFTSGSGINQQSVQVPKIVAKGIPAQDLIVRNGQTVIVTAFDQTDSQFSHRTLGE
                     YLPTILGGSLTASKSRTFTLVLATVMVQDQGEAQ"
     misc_feature    complement(397589..399163)
                     /gene="pilN"
                     /locus_tag="CNE_BB2p03870"
                     /note="type IVB pilus formation outer membrane protein,
                     R64 PilN family; Region: pilus_B_mal_scr; TIGR02520"
                     /db_xref="CDD:233909"
     misc_feature    complement(397583..398113)
                     /gene="pilN"
                     /locus_tag="CNE_BB2p03870"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            complement(399379..399999)
                     /locus_tag="CNE_BB2p03880"
                     /db_xref="GeneID:10920468"
     CDS             complement(399379..399999)
                     /locus_tag="CNE_BB2p03880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683029.1"
                     /db_xref="GI:339324136"
                     /db_xref="GeneID:10920468"
                     /translation="MFQSLFPARLSRTLVAASALPLCAMAQAAVPASTSASASPFGVD
                     AAGQFEPAAPLAGAGWQLLAANAKRVADKPAAPNAAPSVAVPATDRTAIPVPATPVAT
                     VAATRAAAPAAPAALITWTVSPADANFRQLIEAWASRAGWSAAPWELEKDVPIVGSDV
                     FDGDFKAAVRRVLSSTEMTDYIIKPCFYSNNVVRVVKLTTKCDLSQ"
     misc_feature    complement(399409..399645)
                     /locus_tag="CNE_BB2p03880"
                     /note="Toxin co-regulated pilus biosynthesis protein Q;
                     Region: TcpQ; pfam10671"
                     /db_xref="CDD:256114"
     gene            complement(400034..400483)
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /db_xref="GeneID:10920469"
     CDS             complement(400034..400483)
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683030.1"
                     /db_xref="GI:339324137"
                     /db_xref="GeneID:10920469"
                     /translation="MIRRLAAGVAALTLCTAASVLASGNAYADCLDDAAAYHRLSPVL
                     LRTIARHESGMRANAINRNTNGTEDIGLMQINSVHLPRLARYGITRDKLFDPCVSAYV
                     GAWILRDCLDRVGATWAGVGCYNAGAHDKRMRYANRIYQTLLSTQPK"
     misc_feature    complement(400073..>400435)
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(400064..400360)
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(400112..400114,400166..400168,
                     400256..400258,400328..400330))
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(400328..400330)
                     /gene="pilT"
                     /locus_tag="CNE_BB2p03890"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(400480..401784)
                     /gene="pilL"
                     /locus_tag="CNE_BB2p03900"
                     /db_xref="GeneID:10920470"
     CDS             complement(400480..401784)
                     /gene="pilL"
                     /locus_tag="CNE_BB2p03900"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilL"
                     /protein_id="YP_004683031.1"
                     /db_xref="GI:339324138"
                     /db_xref="GeneID:10920470"
                     /translation="MMKPLLISVLALAASGAAVAADTDPLDFDYQVVARASERPALIF
                     NDGQSTYIQPRAGQLVTADGAQQNGPYWVIDGVPDVVRYSVNGQSVIARWKRANGFTG
                     EPANPVGDLPGSLAGFSGRIALIGQHGDLALVRAGRSVMPLAAMVKSLAPAGWSGTAQ
                     KDIALTEDVSLQRAAGENWLQALGRVLEQRNLYAEVDFERQHVTLRATAPKAFAVDSR
                     RRADAPAASSLAAAPAPVAAELVSTSVPTSATAASATTRAAAPAPAVGTAAEPLTLAT
                     AFDANAIRDTKTGRIEIRFDQKPGELLFHDGAGKRLSTEWRDEDKALSLATVDRFTVR
                     GGGKAVEVARVPGIHYLFAQQNEAGLSRVFEKDGATYLSFDKSMGSISVFDESRRGSG
                     EHKDRYYKFNGISTRLTVVADGNVVQVDRVPEVRFYERAVTQ"
     misc_feature    complement(401512..401718)
                     /gene="pilL"
                     /locus_tag="CNE_BB2p03900"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cl11423"
                     /db_xref="CDD:264360"
     misc_feature    complement(order(401512..401523,401545..401547,
                     401653..401670,401683..401703))
                     /gene="pilL"
                     /locus_tag="CNE_BB2p03900"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            complement(401781..402587)
                     /gene="trbN"
                     /locus_tag="CNE_BB2p03910"
                     /db_xref="GeneID:10920471"
     CDS             complement(401781..402587)
                     /gene="trbN"
                     /locus_tag="CNE_BB2p03910"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretory pathway exported protein TrbN"
                     /protein_id="YP_004683032.1"
                     /db_xref="GI:339324139"
                     /db_xref="GeneID:10920471"
                     /translation="MIKPSAAVLLALAMSGAGAQTIEAMVSPTALVVSDAAGARVVTL
                     TGKPVLFCGLDSFLGWSARWIGATLRMEGGQAPAVVVQGQAVPLTALLARDGWLRPER
                     LDDGAQVALVERRGGWACAPKTEAFAQMSEKVDPRILAGIAMNESAYRGRPWPWTLNV
                     AGRGMFFATREDAHATIERLLAAKRCDFDVGIMQINWCYHGKRFASAWDALSPATNIR
                     AAEAILTDNLQRSGSPMKAVAWYHSADPARGGPYFARFMTHFQQLKAPQP"
     misc_feature    complement(<401841..402182)
                     /gene="trbN"
                     /locus_tag="CNE_BB2p03910"
                     /note="lysozyme_like domain.  This contains several
                     members including Soluble Lytic Transglycosylases (SLT),
                     Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:260275"
     misc_feature    complement(402150..402152)
                     /gene="trbN"
                     /locus_tag="CNE_BB2p03910"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238249"
     gene            complement(402580..403833)
                     /gene="trbI"
                     /locus_tag="CNE_BB2p03920"
                     /db_xref="GeneID:10920472"
     CDS             complement(402580..403833)
                     /gene="trbI"
                     /locus_tag="CNE_BB2p03920"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="YP_004683033.1"
                     /db_xref="GI:339324140"
                     /db_xref="GeneID:10920472"
                     /translation="MKQPVTDVSDAKERLTSGKVPRNIVTTLGVVAAVLVGTLGYFYQ
                     SSMESDLAKQAEDKKAKKLQERTSTPDNGGLDQLIRQQQDEARKQAAQQAAEATRPEP
                     AKAPVMTAKDFVQPATAGPAAAELKQANDLDTVMTSPIFKSDGKAMRRDVKRQPDLSG
                     VVDPAQMRAQQLAAVGGMNGTGGVGGAGGMPGMGGPEGGNTAPTSSDGQFLRGAAATS
                     FTRTGFAGKLAPCTVSQGFVIPATFVGGLNSDKPGEFRATVTNDVYDTVNGTCKAIPA
                     GATLVGTYSSDIAIGQERILAAFVRMQLPNGKWVPLLGMGGADPNGYAGISGDVNNHF
                     FKIFAGALIIGVLEQHFNDSATATTVGPNGLTTFGNTAGQVAAQTAQTILNRNQNIRP
                     TITTKPGQKLLVQVKHDIVLEPYRD"
     misc_feature    complement(402583..>403167)
                     /gene="trbI"
                     /locus_tag="CNE_BB2p03920"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    complement(402598..403143)
                     /gene="trbI"
                     /locus_tag="CNE_BB2p03920"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            complement(403848..404741)
                     /gene="trbG"
                     /locus_tag="CNE_BB2p03930"
                     /db_xref="GeneID:10920473"
     CDS             complement(403848..404741)
                     /gene="trbG"
                     /locus_tag="CNE_BB2p03930"
                     /codon_start=1
                     /transl_table=11
                     /product="mating pair formation protein"
                     /protein_id="YP_004683034.1"
                     /db_xref="GI:339324141"
                     /db_xref="GeneID:10920473"
                     /translation="MSQSLRSRFSVVGLTAAMCLMLSAGPGFSADKPSRKAPPPPLPG
                     LGIGDMADAMNPMNPFNGGVEPVALPGDSRLVVFPYSPDQIFRVLTAPLKVTTIEFAP
                     DEQIVGDPAWGENIRWSFETDGANHLYVKPSGPGLVNTLSVNTNKRSYEFTLVSSPLG
                     GIFYQKVRFRVQGAFGAKAKARAEHGAGAAEREPPNSAPDAVAVSPDKLNFDYRVEGG
                     AAFKPETVFDDGTAIWMRIPRGADWPVALYKDGSDYVVANFIRRGEFLVMQRLADEIA
                     LRSGDTEVKVLRGKRRILGLF"
     misc_feature    complement(<404025..404558)
                     /gene="trbG"
                     /locus_tag="CNE_BB2p03930"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cl11423"
                     /db_xref="CDD:264360"
     misc_feature    complement(403872..404126)
                     /gene="trbG"
                     /locus_tag="CNE_BB2p03930"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    complement(order(403881..403901,403914..403916,
                     404061..404078,404091..404111))
                     /gene="trbG"
                     /locus_tag="CNE_BB2p03930"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            complement(404758..405465)
                     /locus_tag="CNE_BB2p03940"
                     /db_xref="GeneID:10920474"
     CDS             complement(404758..405465)
                     /locus_tag="CNE_BB2p03940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683035.1"
                     /db_xref="GI:339324142"
                     /db_xref="GeneID:10920474"
                     /translation="MPLFSRRNESKKVLSPAPGMYAGEDVTQFLFDRTARVVVERNHW
                     KLATLVAALVAVAAVITRQPPEPVVRVVGVSADANGKPVARELDAYQPKALEIQVAFR
                     DVVTRMFTIEPVLTPEIENSRIFQNINGVKKQMVGAARKQFEDWLSEDAPFRAIAQSP
                     SLVREVQVTNIALLPDNTVAVEFVTSTREEGAKPRKQRYAMTFRYQIDPPKSDAALTG
                     NPFGIYPVFFSIQKSAA"
     misc_feature    complement(404770..405384)
                     /locus_tag="CNE_BB2p03940"
                     /note="VirB8 protein; Region: VirB8; pfam04335"
                     /db_xref="CDD:252532"
     gene            405726..406898
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /db_xref="GeneID:10920475"
     CDS             405726..406898
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="YP_004683036.1"
                     /db_xref="GI:339324143"
                     /db_xref="GeneID:10920475"
                     /translation="MLAPLSVSGGFQDALQGSAESSRKSHIFRPHTQTLNENNSGMSA
                     PAAHPTLQFDQLEASAVAMFFEALGPIKAYVEASDIAEVMINHADSVWIERHGELRRL
                     DIRLDPAMIEGAVRALAASVQKSAVRGTDQGIINAGYQGMRIAAVMQPTAIDGNALSI
                     RRHREQNLSLSDYVEMGAFSARVARNTADDKPIFDGPVEDEALKAALTQLVVQRKNIL
                     VAGGTSSGKTTLLNALVAEIPHSERVLSIEDTMELKMTVPNKVRLLSNADTRVTTQQL
                     VALSLRFRPDRILVGEVRGGEAYDLLQALNTGHDGGMASLHANNARSALSRLESLAML
                     GIPAGSRWELDDMRKLIAECFHYVLHLRRTCEMRHVSEVLEIQGFKNNDYVVNRVF"
     misc_feature    405897..406895
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /note="Flp pilus assembly protein, ATPase CpaF
                     [Intracellular trafficking and secretion]; Region: CpaF;
                     COG4962"
                     /db_xref="CDD:227297"
     misc_feature    order(406386..406391,406401..406409)
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(406389..406391,406401..406409,406461..406463,
                     406467..406472,406596..406601)
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    406584..406598
                     /gene="trbB"
                     /locus_tag="CNE_BB2p03950"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            406993..407268
                     /gene="trbC"
                     /locus_tag="CNE_BB2p03960"
                     /db_xref="GeneID:10920476"
     CDS             406993..407268
                     /gene="trbC"
                     /locus_tag="CNE_BB2p03960"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin"
                     /protein_id="YP_004683037.1"
                     /db_xref="GI:339324144"
                     /db_xref="GeneID:10920476"
                     /translation="MGAALMLCAQSAMAADLGIFSGLTNMICSIQALVSGPIIFVIGV
                     VVIILGAIGIANSESTIVKVVMTAIVGIGLAAAAIPIAKNLGLTQYC"
     gene            407271..407600
                     /gene="trbD"
                     /locus_tag="CNE_BB2p03970"
                     /db_xref="GeneID:10920477"
     CDS             407271..407600
                     /gene="trbD"
                     /locus_tag="CNE_BB2p03970"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrbD"
                     /protein_id="YP_004683038.1"
                     /db_xref="GI:339324145"
                     /db_xref="GeneID:10920477"
                     /translation="MRQHAVSRSLSLPRMLGGAVRGLAIANGTITALLCYATYTGGFW
                     TVAGFFLLGLCVHLFLRWLTTSDPWWNLVLNVYNHYGDVYESAPWHGKFSPRFRRPYG
                     FDSDLPC"
     misc_feature    407286..>407474
                     /gene="trbD"
                     /locus_tag="CNE_BB2p03970"
                     /note="Type IV secretory pathway, VirB3-like protein;
                     Region: VirB3; cl01501"
                     /db_xref="CDD:260966"
     gene            407594..410038
                     /gene="trbE"
                     /locus_tag="CNE_BB2p03980"
                     /db_xref="GeneID:10920478"
     CDS             407594..410038
                     /gene="trbE"
                     /locus_tag="CNE_BB2p03980"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrbE"
                     /protein_id="YP_004683039.1"
                     /db_xref="GI:339324146"
                     /db_xref="GeneID:10920478"
                     /translation="MLKRRPMQEIAPWMTLVTPDLVLNKDGSLLATFDFDGIDADSPN
                     TLDVSAARDQLDQACRSFDSRVTAWWRLRHRRTRDYIGGTFPATSDARLDALNREHMT
                     SGKYFRNSHSLALAYTPENGIDKVFERMAYHMTVGGKNFAIAAFETAKDVLLARNAFA
                     FDLQRTEADAKRFESMLDAFTGGVTKLGLTRLSMQDSLAALHQTVNPTVPPRRVRFPV
                     TLLDTHLTESEVISGADKLFFESAHGKRFAAVVAVKEWMGFQEAALDVLTQIDAELDI
                     CILYRFLDTHKATHYIEKIRRFYKMASFNLWSIAKQMAAKEETQNDEGREQLAAEAGD
                     ALRRLTAEGQQHGFVNISVIVYGDTEAECEDAVSEVVGAITNAGFGPIREKANLLPAW
                     NSTLPGRWDKQRRLQFVETPAVSDIAPLRSVRPGPTRNNWLTDLSGVETPPLTYLPTR
                     HRTAQRLDMHQPGGNGHLLVLGPIGAGKSVMLNFLVTQAGRQRARRIRFDKDRSTRIP
                     TLLAGGKFVDVTGRFQAATQTNPLSLLTDAANFAYVTDWLVLAIEDDDFRCTPQQRTD
                     LFQAVQILARFPRERWTLSNLCTQLHATLRERLQIWVKGGQYGHFFDHVEDAFEVSDD
                     LSIEMGDLFTNFPRAAALFMDYAFYRISQSMGTRYTIIEVEEAGFFFTNPRFYARLET
                     WIVTIRKLNGAIWMATQSLQQVARVADFEILKDNIANIIYLPNSQAITSKELYRDVFG
                     LTLDQVKMITEAVPNRDYYWTTKTQSRMLQTAFSKEMVAMLRSDGYAQEVLDRHHASG
                     LPDWQDRYVREVLTRG"
     misc_feature    407594..409939
                     /gene="trbE"
                     /locus_tag="CNE_BB2p03980"
                     /note="type IV secretion/conjugal transfer ATPase, VirB4
                     family; Region: VirB4_CagE; TIGR00929"
                     /db_xref="CDD:233193"
     misc_feature    408209..408808
                     /gene="trbE"
                     /locus_tag="CNE_BB2p03980"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     misc_feature    409631..>409795
                     /gene="trbE"
                     /locus_tag="CNE_BB2p03980"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; cl17375"
                     /db_xref="CDD:266658"
     gene            410081..410845
                     /gene="trbJ"
                     /locus_tag="CNE_BB2p03990"
                     /db_xref="GeneID:10920479"
     CDS             410081..410845
                     /gene="trbJ"
                     /locus_tag="CNE_BB2p03990"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbJ"
                     /protein_id="YP_004683040.1"
                     /db_xref="GI:339324147"
                     /db_xref="GeneID:10920479"
                     /translation="MNKVLAGVLASAALTASSLAHASGWPVFDAANFIKNTMTAAQAL
                     KTEIYENTNIVYQNKMMLNQLQQAVGLDSVAMATQAMGIQEDFQKHQRYGQAMQELYG
                     SLANNADFLSNVQGLVASSGKTPDQWFRDQRTLLETGDKTAKRLFGLGQDVTKNNEKL
                     AQRRRDLQQDLNMNQTAQATAQLTNQMLDVMAGQNADLLQLIGAKTQADAVKDQKVNA
                     DTAEKTAAAEQLARQQADELQKLRQQVFSRGTLSGK"
     misc_feature    410093..410770
                     /gene="trbJ"
                     /locus_tag="CNE_BB2p03990"
                     /note="Conjugal transfer/entry exclusion protein
                     [Intracellular trafficking and secretion]; Region:
                     COG5314; cl02193"
                     /db_xref="CDD:261213"
     gene            410847..411848
                     /locus_tag="CNE_BB2p04000"
                     /db_xref="GeneID:10920480"
     CDS             410847..411848
                     /locus_tag="CNE_BB2p04000"
                     /codon_start=1
                     /transl_table=11
                     /product="TrbL/VirB6 plasmid conjugal transfer protein"
                     /protein_id="YP_004683041.1"
                     /db_xref="GI:339324148"
                     /db_xref="GeneID:10920480"
                     /translation="MGYSAPLRLLLCAILVALSLVSGPATAQPSGETSNIASSLTPAA
                     GSTGEALSSTIRELLALRDGLLDGGIAISRTTAPEAGKFAWALTVLTLVIAGFRFTAH
                     RNPVGAWVEFIESLTVLGIFAAMYLSFDSFGTGIFKWFDQLARSMSAGNYDTGSLLAY
                     TAGKFLDSFFKAFRVAAWYDKLDVIFSCLGLLIAFALTAAASIVYTYFVMIGQLQAAV
                     GLAIGLIAVSLGFSEYTRKYFWAWFDFMVTASMYVVTAAIIANLVAASTGETIQKVAD
                     IGTSTAAAGWKAASLSVLVLLISFEIPKLAGSLFGTGGGVSGGAAMGLAKGAWKLGK"
     misc_feature    411111..411773
                     /locus_tag="CNE_BB2p04000"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; pfam04610"
                     /db_xref="CDD:252701"
     gene            411860..413125
                     /locus_tag="CNE_BB2p04010"
                     /db_xref="GeneID:10920481"
     CDS             411860..413125
                     /locus_tag="CNE_BB2p04010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683042.1"
                     /db_xref="GI:339324149"
                     /db_xref="GeneID:10920481"
                     /translation="MNQHLPQDASTLLASHEQRIALIRQYANEANPADFDAKWLVVLR
                     ACASWFSTMPLQPDQHSEPGGAFRATVEVAYFAMRLSGGQKFAADQPSERRRRLEPQY
                     LYALFLAACCSWLDEPCRHFHIVREDTGEQWLPAAHGAFHTWLAGNAYRVIRLEAPLP
                     VERMRSALLARSILGAESLSWLDGPVLSELFGAINPAPMPTGFEAQLHKIVRQAVAAA
                     RDYEQKARRAVFAPDTTVPPSAEQLAAAATPGVPAVSDTRSPAGRVPEPVAPTPSAAA
                     AAAALFQAPVAPAEPVVATALAPHAETATPLAPPTPAPAAIDAAAIGRARRDAPDPFM
                     ALLGGSRMMSEFFRALAQDVTAGKIKVVWAEKGLVLPKKMLGNYGIASDTLIENLRKL
                     SLLYAMQGTDLILAERIGTLILPRPNTLA"
     misc_feature    411869..>412597
                     /locus_tag="CNE_BB2p04010"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cl17215"
                     /db_xref="CDD:266561"
     gene            413160..414986
                     /gene="traG"
                     /locus_tag="CNE_BB2p04020"
                     /db_xref="GeneID:10920482"
     CDS             413160..414986
                     /gene="traG"
                     /locus_tag="CNE_BB2p04020"
                     /codon_start=1
                     /transl_table=11
                     /product="channel-forming protein TraG"
                     /protein_id="YP_004683043.1"
                     /db_xref="GI:339324150"
                     /db_xref="GeneID:10920482"
                     /translation="MFEARAAAGWALALMLIATSGMPHAGYFAALCVGMLLLRGTQVW
                     RALAFRMAISTKWLAKIRIDRLLTASATLRESDDAMYLGTGFEWTQKHCQIAHDILRM
                     PASEIPGLPRWLPTKIARAVEARFAPPESIRDHTPQGQSWIHGMEPKKAPVPLHYKAL
                     GGHTAVGGTTGAGKTRTYEIIATQVIHNAEDVLIIIDPKNDRDLKDRVKQECERTGRK
                     FLYWKQAAPSESIRLNPLENWSQPSEIPSRIAQLMEEGPFRDFAFLFIDRAVKGELYV
                     GDKPNLRSILNYAQSGINSLLERCLKRFFPESGMADWEDEVNGFMQKLGQKSGATLLD
                     GMVQLYLQRFANVGRGHESIDGLVSTFTHDRDHYMRIIASALPLLQMLATGETGLMLA
                     PKADDFEDDREIWDIDKIIKQKAVLCVGLDSMSNSIVAKAIASMILSDIASVAGTIYN
                     FYDKPPGVVLIIDEVAEAINEQVIQILNKGRGAGFKAFVAFQSRSDLEAKLGNAAKML
                     QVLANLNNQIILRLEDTDTAQWFSDKVGETGITNIVQSSTTSTGSEAHVGEFSGSVSR
                     SRQLEKVPLIPVRLITQLPNLQYFLRVSGGAVYQGRIPIIEG"
     misc_feature    413232..414977
                     /gene="traG"
                     /locus_tag="CNE_BB2p04020"
                     /note="conjugative coupling factor TraD, SXT/TOL
                     subfamily; Region: SXT_TraD; TIGR03743"
                     /db_xref="CDD:234339"
     misc_feature    413610..414947
                     /gene="traG"
                     /locus_tag="CNE_BB2p04020"
                     /note="Type IV secretion-system coupling protein
                     DNA-binding domain; Region: TrwB_AAD_bind; pfam10412"
                     /db_xref="CDD:255970"
     gene            414995..415501
                     /locus_tag="CNE_BB2p04030"
                     /db_xref="GeneID:10920483"
     CDS             414995..415501
                     /locus_tag="CNE_BB2p04030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683044.1"
                     /db_xref="GI:339324151"
                     /db_xref="GeneID:10920483"
                     /translation="MTSLFRQIVKEHKLSAKLSPVFICFPELDDVCTRLVDFIGLNFI
                     VRDDPLVKEMLMDALAGFKAERKDGYGNVAFMRGLFGRAHELYAKRYAAFKGEKYNVW
                     APFLEPIPLFEGRQAPGYVCRMVDEPCPEPITPRSAAFQLAARVLKGPTFRRYFEEYD
                     VCGQLAHC"
     gene            415536..415718
                     /locus_tag="CNE_BB2p04040"
                     /db_xref="GeneID:10920484"
     CDS             415536..415718
                     /locus_tag="CNE_BB2p04040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683045.1"
                     /db_xref="GI:339324152"
                     /db_xref="GeneID:10920484"
                     /translation="MRAWVRANDAEASVPGQFAQGRHAFAMAMVKLEQSRPAQFWGGL
                     LAFVAIPFLALHALVR"
     gene            415720..416337
                     /locus_tag="CNE_BB2p04050"
                     /db_xref="GeneID:10920485"
     CDS             415720..416337
                     /locus_tag="CNE_BB2p04050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683046.1"
                     /db_xref="GI:339324153"
                     /db_xref="GeneID:10920485"
                     /translation="MSNSRFVSHLRLWLIVTPVLLATLAPMLPDDGHFEVDGAEQASV
                     ESLFGEARAEDIASRANARFGAWFADSGAIRRSYSGSANQSLISDGGAAGVAASWMRH
                     FWMEMYRSIYRATVAGNWAWGALFFAVAMLNDGAVQRRIRAAAAGVASPVGFHLAAHG
                     LLIALGVSASALLLPFSLPASVWTVATACVGVLAWRLAASFHVNR"
     misc_feature    415789..416325
                     /locus_tag="CNE_BB2p04050"
                     /note="Domain of unknown function (DUF4400); Region:
                     DUF4400; pfam14348"
                     /db_xref="CDD:258521"
     gene            416416..417300
                     /locus_tag="CNE_BB2p04060"
                     /db_xref="GeneID:10920486"
     CDS             416416..417300
                     /locus_tag="CNE_BB2p04060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683047.1"
                     /db_xref="GI:339324154"
                     /db_xref="GeneID:10920486"
                     /translation="MTTNTDTAVVTQDDALLAATMDALAPNTAIEEPADAAPGTNPGV
                     TDGADDGSIERELADMETAADSLRKEGLISADEAEEKKAEVANTRKRFRELKPEDRAV
                     IIRRRREIGAQILTRQLAGAAVVPVAIKLNHTRLRPLFEQWWPFMNRMSINLQRFGGA
                     TFGKGELSTVETYFERELTRMEDYVDEQLRVAEAYRDQRESEMRARNDIVFEPTVTLP
                     SLNLTVEAYSRFSMRVLGVLAKFDRTMDQFDFMVWNGIRDQSDINDEVASFLRKFHPL
                     GLRSYMTHLKLMTTVRAV"
     gene            417475..419265
                     /gene="uvrD"
                     /locus_tag="CNE_BB2p04070"
                     /db_xref="GeneID:10920487"
     CDS             417475..419265
                     /gene="uvrD"
                     /locus_tag="CNE_BB2p04070"
                     /EC_number="3.6.4.12"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="YP_004683048.1"
                     /db_xref="GI:339324155"
                     /db_xref="GeneID:10920487"
                     /translation="MASTGEAPKTTSNSSFNLQSWTRMLAELNPAQREVVELRRHCVA
                     VACPGAGKTKTIATKAAMLLAEPKATVGAVTFSKDAALELRERILALAGPATKKRLLA
                     GTFHSLAYKQLGRRDGGAPDIATEGDRTGLLIQVLSDVGLDWKVEDGIAAIEAIKTNF
                     GQVQSGSAEELLYRGYQDSLDRNGKIDFQDMLRLAVEGMQNGTIEPYPFTYLLVDEFQ
                     DTDPLQYQWIALHARAGSIVTVVGDDDQSIYGFRSALGFRGMESFIRQFDAQPVVLGN
                     NYRCHAEILGAADRIIRNNRDRIPKELVAHKGPGGQVRFQRFPDEYAEAVAAMEHLAV
                     ALRNGQSAAILARTNRILDPVEAVCRSHGVKYYRASGKSILSRPEAALMCNLLELVQK
                     TKSTGVDALLSFVGIGTQELRLLHSKGRASTEQRQRKELLELGLSEASTDRYRELMKR
                     LAEWRSLCDRQFYSLVLEGAREWMMQHTDADPARRAITTTYDVLSRLNGPFSDRLEFL
                     RRDNNEPAPDALILTTMHSSKGLEWDRVWIIRAEETVVPDEKSTESEERRLFYVAVTR
                     AREDLRLSMAKKNPTSRFVLEAGIDVAIAT"
     misc_feature    417553..419247
                     /gene="uvrD"
                     /locus_tag="CNE_BB2p04070"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    417598..417801
                     /gene="uvrD"
                     /locus_tag="CNE_BB2p04070"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <418972..419193
                     /gene="uvrD"
                     /locus_tag="CNE_BB2p04070"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            419654..420883
                     /gene="repA"
                     /locus_tag="CNE_BB2p04080"
                     /db_xref="GeneID:10920488"
     CDS             419654..420883
                     /gene="repA"
                     /locus_tag="CNE_BB2p04080"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepA"
                     /protein_id="YP_004683049.1"
                     /db_xref="GI:339324156"
                     /db_xref="GeneID:10920488"
                     /translation="MKFSFDGLPIARRTTMCGGTSHAPNPVAADGRQPKAARLDAGRL
                     PERILRAIALVYESDGLRTLHITNRQVLATLVRFALNQKDPSALAFIKKATIAQHLGI
                     SEATVYRALGALENAGLIERERQRRTRAQLEVVGRIGFSAKLLRCIGIASPQFQSTVH
                     VPARSDESRTSACLASVSGVNKTMQSSTKKHPGSGSSLRIDGRAVPMDLAPLVRDQSL
                     KMSALFLLMRLARTAGHRLSDVVSAAGNALGPLRGRELFAYLKSLLERPVDYGHVVRT
                     RKLREDDERAAEARATQERQQIAELVERYRGKRVSAPDGSTYEVDSASIVITDANGHR
                     SSLAHDRARAWLIELDKVAGGLAPAVAQPAQARQRSSVVAHAAIEDIRRLMRARQAPQ
                     YVSRRPVRPDAGVCRSA"
     misc_feature    419780..419986
                     /gene="repA"
                     /locus_tag="CNE_BB2p04080"
                     /note="HTH domain; Region: HTH_22; pfam13309"
                     /db_xref="CDD:257646"
     misc_feature    <419939..>420040
                     /gene="repA"
                     /locus_tag="CNE_BB2p04080"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(419960..419971,419975..419980,419987..419992,
                     419996..420001,420017..420025,420038..420040)
                     /gene="repA"
                     /locus_tag="CNE_BB2p04080"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            420868..421409
                     /locus_tag="CNE_BB2p04090"
                     /note="transposase IS5 family"
                     /pseudo
                     /db_xref="GeneID:10920489"
     gene            complement(421569..422936)
                     /gene="repB"
                     /locus_tag="CNE_BB2p04110"
                     /db_xref="GeneID:10920490"
     CDS             complement(421569..422936)
                     /gene="repB"
                     /locus_tag="CNE_BB2p04110"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepB"
                     /protein_id="YP_004683050.1"
                     /db_xref="GI:339324157"
                     /db_xref="GeneID:10920490"
                     /translation="MDSASQQLALALFEDFGPRGRSVTEAPKDLGFRRSNAFVKIIDL
                     SLAGRRLIDVAYFLVAEDQEVRREYRVDVGLFKWLLATTSNNRRHLGKLVREAQKAAI
                     ELNEIDVEDPSKDRWGAVPLMGSAFIEKGEFIFELPERLQRAIKNPKSSHFLSLRYVF
                     KSVHSKVLYDRLQQFMVEGITPWFEVQALRAWLECEKKTYDLFKHFRSKVLEVAISEI
                     REVTGLHIEMLTLNVPGSKKIGQVRFRLNAIEQPNEQKTAFIVLRNVYETLRKEFALN
                     QSEFNEIITNRDLYNDERIHQAMEYTRHNVKVGKVKVRAGGYFMKALREGYLLGELDK
                     QIHHQSAIAESTRKAADQEMAEREARVKAAGAERDQREADLGWEAYNKLSAEQQSDMI
                     AEFCQSQAAKLLARRLKVGSLNVHEHINDPNVRSTFGGFVASRMHKAAKAAKRVGAAA
                     SASLI"
     misc_feature    complement(422205..422834)
                     /gene="repB"
                     /locus_tag="CNE_BB2p04110"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
CONTIG      join(CP002880.1:1..424140)
//
DBGET integrated database retrieval system