GenomeNet

Database: RefSeq
Entry: NC_015724
LinkDB: NC_015724
Original site: NC_015724 
LOCUS       NC_015724             424140 bp    DNA     circular CON 18-MAY-2017
DEFINITION  Cupriavidus necator N-1 plasmid pBB2, complete sequence.
ACCESSION   NC_015724
VERSION     NC_015724.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603269
            Assembly: GCF_000219215.1
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 424140)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of the type strain Cupriavidus necator N-1
  JOURNAL   J. Bacteriol. 193 (18), 5017 (2011)
   PUBMED   21742890
REFERENCE   2  (bases 1 to 424140)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002880.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 04:49:12
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 7,941
            CDS (total)                       :: 7,853
            Genes (coding)                    :: 7,479
            CDS (coding)                      :: 7,479
            Genes (RNA)                       :: 88
            rRNAs                             :: 5, 5, 5 (5S, 16S, 23S)
            complete rRNAs                    :: 5, 5, 5 (5S, 16S, 23S)
            tRNAs                             :: 69
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 374
            Pseudo Genes (ambiguous residues) :: 0 of 374
            Pseudo Genes (frameshifted)       :: 202 of 374
            Pseudo Genes (incomplete)         :: 215 of 374
            Pseudo Genes (internal stop)      :: 55 of 374
            Pseudo Genes (multiple problems)  :: 88 of 374
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..424140
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /plasmid="pBB2"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1297
                     /locus_tag="CNE_RS36715"
                     /old_locus_tag="CNE_BB2p00010"
     CDS             101..1297
                     /locus_tag="CNE_RS36715"
                     /old_locus_tag="CNE_BB2p00010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018310445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_013954103.1"
                     /translation="MVVKSELTEIDRTVTIGSMSDFSKKLQKLTEELREHILAPRPRK
                     SPPTFTSSQVAEMCGIDRARLHYLATKDGSTLPAGELHGRVRQFTLAETRKWVQQASQ
                     VKPSPLLRKGEADGRVLISANFKGGSCKTTSSMCLAQGLSLRGRKVLLVDLDPQASLT
                     ELCGLYAEKMIVEESTVLPYIYSPDDFTLESVIQETYWDGVDVIPAHPSLFSAEFHIP
                     AMASKSANYRFWTLLRKGLEPLRKKYDYIVLDSAPSLSYLTINGLMAADAMVMPLVPE
                     SLDFISSVSFWSLFSDMADSFKNIEGNKTYDFVSILLSKVDYGVASSAPIVRSWVQRA
                     YGDWMSPIEVPASSVMSNGALALATVFDISKFEGSNKTFQRVRIPFDEYCRWVDEFYA
                     GKWEDA"
     gene            1298..2284
                     /locus_tag="CNE_RS36720"
                     /old_locus_tag="CNE_BB2p00020"
     CDS             1298..2284
                     /locus_tag="CNE_RS36720"
                     /old_locus_tag="CNE_BB2p00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_013954104.1"
                     /translation="MNMRKRMLEQTANLTPANEIKVEVAPQVADRPKTAPGMMAALSA
                     AQLRIQELESQGAASTVPVEKIRPNPWQPRIRFDESSLTELADSIKELGLMQPILVRR
                     FTADNGESYYELIAGERRWRAHQVLGLPEIKALVSDASDADMAVLALAENVSRENLTD
                     YEIGKAMRRVEKEFPDRKRMAESMGMSRSTLYRYFAFDNLPEFIRVDLEKNPSLFSGT
                     AASDTYAVLKKHGEPAVTVAREVWKQLVDGSLEQSKFAKLLEASLLRREATPVTSQRD
                     IHKVYAGKTQAGSITKDSVSFTIKLKSAVLTAAQEERIRTVINELFDGGPQR"
     gene            complement(2889..3275)
                     /locus_tag="CNE_RS40435"
                     /old_locus_tag="CNE_BB2p00030"
     CDS             complement(2889..3275)
                     /locus_tag="CNE_RS40435"
                     /old_locus_tag="CNE_BB2p00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954105.1"
                     /translation="MLQGSMTSRCSVRVVHWGSLIRSRRASRNSALFLLALPLTRAAG
                     RRGTVGDLRHELLGVRGQFLNACRRREALPIQAMGAQIDNPHRIVHVGYVPEHVTALL
                     VKHQLQVGLMMRSNRFQYTQEASMTA"
     gene            complement(5063..6916)
                     /locus_tag="CNE_RS36725"
                     /old_locus_tag="CNE_BB2p00040"
     CDS             complement(5063..6916)
                     /locus_tag="CNE_RS36725"
                     /old_locus_tag="CNE_BB2p00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013954106.1"
                     /translation="MAQHNRVAADTPRYTRADFTALRFRLNRIPTEHILSRVYDEDAL
                     HAAGIETSEQLEARLDAMRDHLVERVCLSNPYLSASLADARRFNRWPKTAIDYLVRAA
                     DQDFSAPQPDDPVSAWLRPIVFRPLRQEGIQTLVQLHGYIALRGRRWYVPVPRLGAGK
                     ARAIERWLQGHAATLGPLQVDDTPRTGWVELGQDLACQLVPLEQVQRIVPALDGHRGR
                     NRAPGFCLIAARHDLDAIHAYLSRFRDRDKTARAYQKELERFLLWCVGVRRMALSSVG
                     ADDCEHYKEFLAQPDPAWIGPKTARTSARWRPFASALKPESQRYAVLVLRGFFAWLVG
                     VRYLGGNPWLLVSDPLTVRREVPIAVEKALPGRLWAALTQPEGLLDQLCGKWPSVPVS
                     APLTAKDTEAPGAQYRLARAVVLLLGCSGARREEAARTLRCHLQPVPEQAGVPAGLWE
                     LALLGKRDKWRTVFLPPRVIAALRAHWADRSHDFENAAQALALLSPVVVPSTRTAQAK
                     HLSLETGDPVLTGMGFSPDGLYQLLTTMLRRIAGDASLPLSEAERDLLRHLTPHALRH
                     TFATHAVANEMPADVLQRLLGHASLQTTSLYVRAERARGLAAVAKLYPDPT"
     gene            7824..9020
                     /locus_tag="CNE_RS36730"
                     /old_locus_tag="CNE_BB2p00050"
     CDS             7824..9020
                     /locus_tag="CNE_RS36730"
                     /old_locus_tag="CNE_BB2p00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016446673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="WP_085959717.1"
                     /translation="MAPEPPNPRIGRYVSTVAFDETVHAYVPPPLPPEPPLTLAPPLL
                     QRLSEADRAIGRLDGVAMLLPDKALFLYMYVRKEAVLSSQIEGTQSTLDDLLQYENAA
                     PAGKPLDDITEVSNYVDAMMYGLGVLRDPNGLPLCLRLLRDMHARLLQKGRGEAKNPG
                     EFRRSQNWLGGTRPGNAHYVPPPVNEMQTCLSDLERFLQDDSAQIPPLIKAGFLHVQF
                     ESIHPFLDGNGRLGRLLIALFLVEKKVLQEPLLYLSLYLKTHRAQYYRLLQDVRLRGD
                     WEVWTEFFLTGVAETANNAHESAMRIVALFQADRERISASGEQINSMLRLHELLRTHP
                     FLNAAQAQQQTGLSAPTVNKAFESLEKLAIVKEITGKQRGRVFAYTDFLSILDSGTEV
                     QAPPRQ"
     gene            9226..10050
                     /locus_tag="CNE_RS36735"
                     /old_locus_tag="CNE_BB2p00060"
     CDS             9226..10050
                     /locus_tag="CNE_RS36735"
                     /old_locus_tag="CNE_BB2p00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SEC-C motif domain-containing protein"
                     /protein_id="WP_013954108.1"
                     /translation="MNPSYSYPVSRLLTLGQSFEEVNGAPETWKGYAKLGVDNRHIPE
                     LIAVVADEALHTGYGPVPFAPVHAWRILGALKATEALPALVSLLRRIDDDFDDWIASE
                     LPRVFSQMGGQSVDLLAPFAADGRNGSYARGGACRAMGEVASGHPEQRGRCLQVLMTI
                     LRSLEDNEQTLNTEIVSVLLDLNAVESIDLIREAYAKDCVDLDCVGDLEDVEIALGLR
                     TERSTAPKRGEFFQRLRELSNHQEATRPRTAGPKTGRNDPCPCGSGKKYKKCCLEA"
     gene            10330..11475
                     /locus_tag="CNE_RS36740"
                     /old_locus_tag="CNE_BB2p00070"
     CDS             10330..11475
                     /locus_tag="CNE_RS36740"
                     /old_locus_tag="CNE_BB2p00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_013954109.1"
                     /translation="MLNLDLRSMSAMTGMINIALGIILLAFRRAYPASIKGLLPWALA
                     PLLCALSTAFYAMDGQWPAVLVSLGGNALLLSGCALFYFGSQRFYGVPCTWKCWLALG
                     IGCLAGISWFLLVHPDYRIRVLLLTTLLAAICLTHARLSWQHGRGFAPRFMALVLAFQ
                     GLVLLMRAATTLFQDAVDTPRFSPSVIQTTYIAAYCFASLFVCLGLLLTVSERLRAQF
                     EYLAQRDDLTGVLSRRAVLHAGSSELKNRRASGQPLSLLLMDIDHFKRINDQHGHLVG
                     DRVLAHFAQTVGRALRHTDYLGRFGGEEFVVLLPHTGAEAAFAVAERVRQAVEQQTAL
                     AGQPACTASLGLASIEAGEATLDELLARADLALYRAKADGRNRVEAG"
     gene            11787..13361
                     /locus_tag="CNE_RS36745"
     CDS             11787..13361
                     /locus_tag="CNE_RS36745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013954110.1"
                     /translation="MSQVLGGIDQILARVGKRVVSSDARGETITVEARSTVRAAPCPA
                     CHRWSNRLHGRYLRRLEERPMLEQPVVLAVEVRRFKCANAGCPRRTFAENIHALAGRH
                     QRRTQSQARALHALGHALGGEAAARLANVLGLRTSADTVLRELRRAPGRKRKPRPRVV
                     GIDDWAIARGHQYGTIIVDLERREPIEVFAGREGIAVAAWMRAHPSIEIVARDRAGAY
                     SEAVDIALPAATQVSDRWHLLSNLRDNVERLLYRLGPQMRQAAQQVEVGGVTLGRQGV
                     LSRNSRRSWQRLSDQRRATRLALYERVMALRAQGGTMKGIARELSINNRTVHKFVTAG
                     AFPERAPKARGPTPLDPHRSFIEERIAQGCRFPELIWQELKQRGYTGSRASVQSCVVR
                     LLFPQGKAPLVEVPVRTMPCPSARRVFGWLVGWRKLAVEEPRSADHERFVQALCKIEP
                     ASKISSDRMSFGGACMCRFLCRGDGLVRWYAATLRITRCPRIIGRSVPSATTSLAYGD
                     ARYGDAAKRTGRRGSR"
     gene            complement(13504..14601)
                     /locus_tag="CNE_RS36750"
                     /old_locus_tag="CNE_BB2p00090"
     CDS             complement(13504..14601)
                     /locus_tag="CNE_RS36750"
                     /old_locus_tag="CNE_BB2p00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954111.1"
                     /translation="MSSHCVAFPARGRLPASLAATVLFWAGSACAQSSVTLYGRVVGG
                     VDYVNKVATANGRTSDVFRYSSDWGASWWGIRVQEDLGQGLSAVANLESMFSSDDGRT
                     IGDSFFNRYAVVGLSSRSYGTVWLGRAMALTDGELWEVDPFAMQFTSIGTLAYGRNWG
                     PRNNAITYNSPRWGGFSFRAQGSLSGVPGNINAGRQLSGSVSYQSGPLVLKGVYEEIR
                     DANGGFSDLYATSREYALGGAYQAGDVKLFAGYSLIRSGGATVATANNPTAADKHQLL
                     WLGAAWSAAPSLTILGGAYHARLNQDGGNATLLALGANYHLSKRTLLYATVGTVINRG
                     NAAFSVVITPDTKPLPGATQQGVYTGVMHSF"
     gene            complement(14836..15711)
                     /locus_tag="CNE_RS36755"
                     /old_locus_tag="CNE_BB2p00100"
     CDS             complement(14836..15711)
                     /locus_tag="CNE_RS36755"
                     /old_locus_tag="CNE_BB2p00100"
                     /EC_number="1.13.11.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-chlorohydroxyquinol-1,2-dioxygenase"
                     /protein_id="WP_013954112.1"
                     /translation="MRNMTEAELTEVVLQRYQDTPDPRLREILQSLIRHLHAFVRDVR
                     LTEEEWLRGILYLTAVGQISDDKRQEMILLSDNVGVSMLVNMVSAGVAQAATESTVVG
                     PFYVPGTPERQWGESIQQLPCDDAPLFVRGRVLDLAGEPVADAQIEVWQTNSNGMYDI
                     QDPEQPEHNLRGWYRVNADGEFLVRTVRPVRYPIPTDGPIGELLNATSRHPWRPAHLH
                     VKVTAAGCKPLVTHIFDAEDPYLDSDVVFAVKQSLVRKFEPVTASNSSREYGISGPCL
                     ELRYDFTIERTMPAG"
     gene            complement(15727..17097)
                     /locus_tag="CNE_RS36760"
                     /old_locus_tag="CNE_BB2p00110"
     CDS             complement(15727..17097)
                     /locus_tag="CNE_RS36760"
                     /old_locus_tag="CNE_BB2p00110"
                     /EC_number="3.5.4.28"
                     /EC_number="3.5.4.n1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methylthioadenosine/S-adenosylhomocysteine
                     deaminase MtaD"
                     /protein_id="WP_013954113.1"
                     /translation="MLKRTLIRNASVITVDPKLGNLDKGDVLVEGSKIAAVGVGLKAD
                     DAEIIDGTGTIVMPGMVDTHRHVWQTTLRNIAADWTLDQYFAGVRGQLGEHFRGEDIY
                     TANLAGACEALNAGITTVLDWSHNMNTPAHTDGAVQGLRDSGGRFVMCYGNSNAEWLP
                     VSNLPTSRDAYRVKKEHFSRADDLVQMGMALRGPQYATEKVTIDDWALARDIGALISV
                     HVGDGAWGKNRPVAWLAEQGLLGEDVVCVHCNSLADDEFRIMADHGAWASMTPDIELQ
                     MGHGWPATRRLLDVGLAPTLGVDIVTSNSGHLFQVMRTVLLVERAWAHHHADQAGEVV
                     QRLPIDTSDVLAFATLNGARALGMADRIGSLTPGKDADIAMIRADNLEMAPLNNPVGA
                     VVLAGHPGLVDSVWVAGKAVKRHGKLVNVDVPRLIGELERSRDHVLALAGVAPGERFL
                     PAPYSH"
     gene            complement(17201..18892)
                     /locus_tag="CNE_RS36765"
                     /old_locus_tag="CNE_BB2p00120"
     CDS             complement(17201..18892)
                     /locus_tag="CNE_RS36765"
                     /old_locus_tag="CNE_BB2p00120"
                     /EC_number="1.1.99.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase BetA"
                     /protein_id="WP_013954114.1"
                     /translation="MTFYDDLIVGAGAAGSVLANRLSADPQRRVLLLEAGRDIRPGDE
                     PADIRSIFPLSTFNPAYMWPDTLVHWGRANGTAPSFFPQGRLLGGTSQIMGMFALRGR
                     PEDYDDWAAMGAAGWGWDDVLPFFRKLESDHDFSGTMHGCDGPVPIRREPQAQWSPLS
                     ARLHQVAAARGFSHVADMNADFGDGYGTLPISRYPDKRGSAGICYLDAAVRARSNLTV
                     QAGATVSRLLLERRDGALHCTGVACTDAQGQVRQIRARRVLLAAGALRTPALLLRAGI
                     GPGDELTRLGIAPQLERKGVGRNLQNHAILYVVAFLARAGREPGGVRPACATTMRWSS
                     AQHGGTPGDMGMYIRSWLSWHALGHRMASLAPVLNKPWSRGSVTLSAQAPQAQTVVEF
                     DLLSDPRDLARITSAFRFTASLFGELGGICGTPYVLSDARNLSRLMRYNEPTSANAVR
                     AAAAARLIDAMPGFGQRMVAKLSKMTPAAEVLRSDDALADYARRSISGTGHVSGTCRM
                     GAASDPLAVVDPHGRVHGMQGLYVADASVMPTVPSANTHLPTIMVAEKIAQGLLV"
     gene            complement(18889..19791)
                     /locus_tag="CNE_RS36770"
                     /old_locus_tag="CNE_BB2p00130"
     CDS             complement(18889..19791)
                     /locus_tag="CNE_RS36770"
                     /old_locus_tag="CNE_BB2p00130"
                     /EC_number="1.1.1.291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-(hydroxymethyl)glutarate dehydrogenase Hgd"
                     /protein_id="WP_013954115.1"
                     /translation="MNIGWIGAGKMGMPMMASLLAAGHAVRLYEPANIAREQAQALGA
                     TRAQNPADAARDAHAVFSSLPDDAALLTVAPAVFEGTAPGVLYVDTSTVSPQASATVA
                     RAAEAAGVSYLRAPVSGTPVQAHERALTTIVSGPRDAFEAARLLLSRWGPNLRYVGEQ
                     EQARSMKLVLNLMVGATAAMMAEALALGSKGGIRWDDLLDVMASSALASPLLKVKAAQ
                     LRQRDFSPLFSCAQMAKDLRLILAAGSDADVPLPLAALVSQLNAISLAHGRGGEDYIA
                     SVMTAEMLAAAGPVLDDDDTGDAR"
     gene            complement(19788..20888)
                     /locus_tag="CNE_RS36775"
                     /old_locus_tag="CNE_BB2p00140"
     CDS             complement(19788..20888)
                     /locus_tag="CNE_RS36775"
                     /old_locus_tag="CNE_BB2p00140"
                     /EC_number="1.3.1.32"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetate reductase"
                     /protein_id="WP_013954116.1"
                     /translation="MSGMRSFVYSQFAGRVVFGAGAVRDVAEEVRRIGCKRVLVLSTP
                     EQRGPAESVREQLRELAVGVHDGAQMHVPVSVVREAQAVATQLGADGFVTIGGGSTTG
                     LGKMLALESGLPLLAIPTTYAGSEVTPLYGTTQDGAKTTGKNPAVLPRTVIYDPELTL
                     DLPLPVSLASGMNAIAHAAEGLYAVDLNPVVRLMALEGIGALSRALPALRDAPRDTGL
                     RADCLYGAWLCAMVLANVGMGLHHKACHVLGGSFGLSHAEMHAVMLPHALAYNVPAAA
                     PALASLSAALGGSGNAGDAPGEVFTLLDRLHLPTALSALGMPEDGLDRASRLMAERAY
                     PNPRPLEQARLRMLLADAFHGRAPRIDIGSLS"
     gene            complement(20885..21184)
                     /locus_tag="CNE_RS36780"
                     /old_locus_tag="CNE_BB2p00150"
     CDS             complement(20885..21184)
                     /locus_tag="CNE_RS36780"
                     /old_locus_tag="CNE_BB2p00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954117.1"
                     /translation="MHWIIYAVDKPSMLPTRTANVDKHREYLAAHPIRTLISGPLTDD
                     AGTNMTGSFFLVEADSRAEVEAFNRNDPFWSLGIWESVDIHAFYKRVDDRAGAPQ"
     gene            complement(21198..21530)
                     /locus_tag="CNE_RS36785"
                     /old_locus_tag="CNE_BB2p00160"
     CDS             complement(21198..21530)
                     /locus_tag="CNE_RS36785"
                     /old_locus_tag="CNE_BB2p00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954118.1"
                     /translation="MSTPMYFMVIGTDKPDSLALRVATRARHRDWLRGGHERVTVVAS
                     GASLAGESTVMNGSLLIVAAASHEDVVAFSHADPYFSAGLFASVDIRRWDWTFGNPNG
                     PTPSLNPV"
     gene            complement(21527..22315)
                     /locus_tag="CNE_RS36790"
                     /old_locus_tag="CNE_BB2p00170"
     CDS             complement(21527..22315)
                     /locus_tag="CNE_RS36790"
                     /old_locus_tag="CNE_BB2p00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citryl-CoA lyase"
                     /protein_id="WP_013954119.1"
                     /translation="MSQANRDNPTSALCRHNAEAIWYRDQNLVDDLLGKQPFVATACR
                     HILGHELAPGQLALVEAILIVLMEHGMTPSAISARLIYMSSPESLQAGVAAGLLGVGS
                     AFIGTMEECARMLAVIADAGQPDAADTAARTLAQRLVSEKRTCPGFGHHLHKPDDPRA
                     IALLALAERHGVAGRHTAALRRLAAALDEARGRHLTINATGAVAAILGDIGVPVGAMR
                     GFALLSRTAGLVAHLLEEQETPSGRFIWNLVDRAIPFSAQEEGA"
     gene            complement(22312..23820)
                     /locus_tag="CNE_RS36795"
                     /old_locus_tag="CNE_BB2p00180"
     CDS             complement(22312..23820)
                     /locus_tag="CNE_RS36795"
                     /old_locus_tag="CNE_BB2p00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011494107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="WP_041229371.1"
                     /translation="MYPIDFFWRAADRYPARIAVRSPAADLTFAELAARVGSLAAAFA
                     RIDPEPGSRLAIGAANSVDHLVALLAAIAAGKVWVPLNPRNGTPELERILAFTEPSIV
                     VLDAAMRERLPGVSGHMAPLEDIEKVIREHAGSARPALNLGLDATQAIKFTGGTTGVP
                     KGVMQPMRAWNTTVLTQWHEFDFHADDRFLVSAPLTHGASTYVLAVLGSGGGLVFPPD
                     TSAPTLLDWTAQAGVTSLFLPPTAIYALCAEQTRAPRDVSSLRLLIYGAAPMPPARIQ
                     ETQRVFGNVVATTYGQTEAPTVLTCMRPDQLADPRNLGSVGRPSMNTLVAIMGKDGTL
                     LGPGQEGEIVARGDLLMTGYWRMSEQTATTIVDGWLHTGDVGAFDERGFLFIKSRVRE
                     VIISGGFNVYPSDVEEAIGRHAAIYESAVVGIADDKWGEAVHAAVQLRPGASVSPEEL
                     IGFVKREIGAVKAPKVVHIFDTLPKSPVGKTLKDEVVRRIHQQAATQTGSKA"
     gene            23885..24673
                     /locus_tag="CNE_RS36800"
                     /old_locus_tag="CNE_BB2p00190"
     CDS             23885..24673
                     /locus_tag="CNE_RS36800"
                     /old_locus_tag="CNE_BB2p00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954120.1"
                     /translation="MSNIRMILRAPSRSMPPMSQFLQAPQPQYLAVANELMEDILAGR
                     LAVGDHLPPEPELVRKYKLSRYGVRLAIKALIDLGLVSRQQGIGTRVLSNQTRARYNQ
                     TIAGLDDIARYAQETNFRILSKGLLSSDEARVPLVSAGAEKWLHIAGLRTTQGRGLPI
                     SLADIYVSPKYARLPKLGATLNVPVHALIERQYGVRVTRVDQDIQGALVSKDEARLLD
                     VDPGAAALRIVRTYYVAEEVIEVTLSVHPSERYSYKQTFELEGR"
     gene            complement(24753..26195)
                     /locus_tag="CNE_RS36805"
                     /old_locus_tag="CNE_BB2p00200"
     CDS             complement(24753..26195)
                     /locus_tag="CNE_RS36805"
                     /old_locus_tag="CNE_BB2p00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate export family protein"
                     /protein_id="WP_013954122.1"
                     /translation="MKTILRGPWVAGRLPACPAFGLALAAASCGALAQALSPPTAETP
                     AYRFLRYDDDYRYLQDPARRSDPWDPVKYIPLGAHGAFLSLGGEIRERFEDYSAANFG
                     VPGRTADSYLLHRILLHADLHAGDRLRGFFQLGDHLAPGKDIAAPPYEDRLDLQQGFI
                     DWRVPISADVPSDPNLRVGRQEMAFGSQRLISVRDAPNVRRAFDGVRLGGAASDMRID
                     AFATRPVLLKAGNFDDQPNHAQGFWGVYATFPRTFIPASGADLYYLGFENSRALYSIG
                     SGVERRHSVGTRIFGTGGQWDWDWEALAQFGSFGQQTLRAWGFSTDTGYTFAISDWKL
                     RTGIKATVGSGDHDANDGKLGTYGGLFPKLAYFNQAGLLGASNVLDLQPSITLKPMAQ
                     LRFTISWDLIWRETTRDAVYTAAAIPIAGTAGRPGGYTGSQLAFDVFWQVDRHIAINA
                     GLVHVDVAKVLSAVGGHNTLFTYVSAAYTF"
     gene            complement(26439..27116)
                     /locus_tag="CNE_RS36810"
                     /old_locus_tag="CNE_BB2p00210"
     CDS             complement(26439..27116)
                     /locus_tag="CNE_RS36810"
                     /old_locus_tag="CNE_BB2p00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008646397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013954123.1"
                     /translation="MSSPANFNGKRPVIDPADTAMLLIDHQSGLFQTVGDMPMPELRQ
                     RAAALAKMATLSKLPVITTASVPQGPNGPLIPEIHENAPHAKYVARKGEINAWDNPDF
                     VAAVEATGRKTLIIAGTITSVCMAFPAISAVADGYKVFAVVDASGTYSKMAQEITLAR
                     VVQAGVVPMDTAAVASELQRSWHRDDAQQWAEIYTKIFPAYQLLIESYMKAQDVQKSG
                     EVLDSAR"
     gene            complement(27198..28064)
                     /locus_tag="CNE_RS36815"
                     /old_locus_tag="CNE_BB2p00220"
     CDS             complement(27198..28064)
                     /locus_tag="CNE_RS36815"
                     /old_locus_tag="CNE_BB2p00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012352499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="WP_013954124.1"
                     /translation="MKRVLGVYSAPRPHWVGDGFPVRSMFSYQGYGKQLSPFLLLDYA
                     GPADFGPAGAPRGVGMHPHRGFETVTIVYKGEVAHRDSTGQGGVIGPGDVQWMTAGAG
                     ILHEEFHSDAFTESGGALEMVQLWVNLPARDKMTRPGYQAILDREIPAVALPGEAGTV
                     RVIAGEYAGHAGPARTFTPMHVWDLRLRQGGLTELPVPSGWNAALIVLRGTVRVNDSA
                     VAGEAQMVLLDSAGTGTCIEASTDAVAILLAGEPIDEPIVGYGPFVMNSQQEIAQALT
                     DLNSGRFMQMAS"
     gene            28197..29102
                     /locus_tag="CNE_RS36820"
                     /old_locus_tag="CNE_BB2p00230"
     CDS             28197..29102
                     /locus_tag="CNE_RS36820"
                     /old_locus_tag="CNE_BB2p00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005300168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954125.1"
                     /translation="MQDLNELYYYVQSVEHGGFAPAGRALGMPKSKLSRRIAMLEERL
                     GVRLIHRSTRQFTVTEIGRTYYEHCKAMLVEAEAAQEAIELTRAEPRGVMRVTCPVAL
                     LQVHVGAMLAEFMVRHPHVTIHLEATNRNVDPVAEAVDVAIRVRPPPLQDSDLVIRVL
                     AERKQCLIASSQLIKVLGMPRVPPDLGSWPSLGLGMPRPDHVWKLFGPDGAVADVHHQ
                     PRFVTGDMVALRNAAHAGVGVAQLPVMMVARELAAGSLVRLLPQWAPRAEILHAVFPS
                     RRGLLPSVRLLVDHLADGFAGMMEE"
     gene            complement(29197..30678)
                     /locus_tag="CNE_RS38995"
                     /pseudo
     CDS             complement(29197..30678)
                     /locus_tag="CNE_RS38995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012427968.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
     gene            complement(30746..31582)
                     /locus_tag="CNE_RS36830"
                     /old_locus_tag="CNE_BB2p00270"
     CDS             complement(30746..31582)
                     /locus_tag="CNE_RS36830"
                     /old_locus_tag="CNE_BB2p00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954126.1"
                     /translation="MNLGNTSFLDGIAAPGFLFELSTSYYRATRIRDNDGNAAPGSPR
                     VETAAIVPHIAYISPDVTLLGGHLGGEVLLPLVYANIRPGSGTGDHDFAAGDIQFSPF
                     IVQWTGQTLFGMPFFQRFDLLFSAPTGQYDANGMANAGTHLWTVTPYYAFTLMPTGKL
                     EISGRLNYQWNGKNTRPAPALHASSVQPGDALYLNLSASYAISNGLRIGVAGYMLGQI
                     GEDRIDGIRQSDSRERVFGAGPGILIQGDAWQVFLNAYKEWGARNRPQGSKIVLRVLA
                     PF"
     gene            complement(31782..32171)
                     /locus_tag="CNE_RS36835"
                     /old_locus_tag="CNE_BB2p00280"
     CDS             complement(31782..32171)
                     /locus_tag="CNE_RS36835"
                     /old_locus_tag="CNE_BB2p00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein DoxX"
                     /protein_id="WP_013954127.1"
                     /translation="MADYYLLSGRVFIAFMFVLSGANKLVFFNHGLDEVRSRNLPFPR
                     VALSLTILVQLSCGLAIMGGYQTAIASFLLAIFTLATAVVFYDFWNQKGAQRTVLFTG
                     FLEHISIIGGFVILMAAGPGNLVLRFS"
     gene            complement(32287..32925)
                     /locus_tag="CNE_RS36840"
                     /old_locus_tag="CNE_BB2p00290"
     CDS             complement(32287..32925)
                     /locus_tag="CNE_RS36840"
                     /old_locus_tag="CNE_BB2p00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013954128.1"
                     /translation="MASETIRDPASDHLLTPQNSAFVIIDYQPVQVNSIASMDRQLLI
                     NNIVGTSRAAVAYKLPIVHSTVNVKTGLNKPPIPQLQKVLGDFPTYDRTSINSWEDVE
                     FRAAVEATGRKKLIMTALWTEACLTFPALDALKEGYEVYVVADAVGGTSVAAHEAALR
                     RIEQAGGKMISVAQLFCELQRDWSRSETVPAFIDLFIQTGGTAGIQFSYDRT"
     gene            33169..33465
                     /locus_tag="CNE_RS36845"
                     /old_locus_tag="CNE_BB2p00300"
     CDS             33169..33465
                     /locus_tag="CNE_RS36845"
                     /old_locus_tag="CNE_BB2p00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013954129.1"
                     /translation="MDDFYVLVVLYAKPGREAELREKLRAVVEPSRGDAGNLRYEMFE
                     QQDDPRRFIFVEHWESPATQEAHHTQTDHIRRFQEEGSDAVESVELFYRMKLVT"
     gene            complement(33499..34401)
                     /locus_tag="CNE_RS36850"
                     /old_locus_tag="CNE_BB2p00310"
     CDS             complement(33499..34401)
                     /locus_tag="CNE_RS36850"
                     /old_locus_tag="CNE_BB2p00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_013954130.1"
                     /translation="MTDQEADRNMKPNGPAIVRVLATALLLTAAALLGYSLWQHYMYS
                     PWTRDGRVRADVVNIAADVSGLVSRVPVRDNQEVRKGDLLFVIDQERFRQALAQAEAQ
                     VQARKAELDMRHRQAMRRMNLDSAVVSSESREDISAQEKQARANYDASLAALDTARLN
                     LHRSEVSAPVDGYVTNLNLHAGDYVSAGAARMALIDKHSYWVYGYFEETKLPNVHVGA
                     RAEVRLLSGGKPLEGHVESIARGIADRDNPTTANLLADVNPVFTWIRLAQRIPVRIHL
                     DAPPRDLLLAMGTTCTVTILPERR"
     gene            complement(34417..34617)
                     /locus_tag="CNE_RS36855"
                     /old_locus_tag="CNE_BB2p00320"
     CDS             complement(34417..34617)
                     /locus_tag="CNE_RS36855"
                     /old_locus_tag="CNE_BB2p00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1656 domain-containing protein"
                     /protein_id="WP_013954131.1"
                     /translation="MPREIALSSILMPSLLPVFIGCLLLYLLVDRLLARLGFYRQVWH
                     PALFRVSLFVAMFSGIGLGLWR"
     gene            complement(34636..36114)
                     /locus_tag="CNE_RS36860"
                     /old_locus_tag="CNE_BB2p00330"
     CDS             complement(34636..36114)
                     /locus_tag="CNE_RS36860"
                     /old_locus_tag="CNE_BB2p00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein FusA"
                     /protein_id="WP_013954132.1"
                     /translation="MRLEAMPQSCAAVAGRFLLLAGACLALLTGCANTGGIVPASTPV
                     DAATVDPGSALRATQQDAGWPQRAWWTRLGDHSLDALVAHAVAGSPDMRIAQARSELA
                     LSQAKIAGAAIEPNFNAGGAFGRTRFPRLATPQPLGGHTTWNNHLAVDLSYDLDLWGR
                     NRAALQGALDNVQAAAADARMAQLSLETSVVRAYIDLALQYALLDVSQANLARQTRIY
                     DIIRKRASRGLASELELSQTHTPIPALQAQVQQSERAIALVKNQLAVLSGDGPGAGDR
                     LPRPALVLEAPIAVPASLPAELVGHRPDVVAQRWRVEAAAQGMKVAKADFYPNINLVA
                     SIGLASAAFGNFFTFVDRDAIGHNVGAAISLPIFDGGRRQGNYGAATRNYDIAVETYN
                     KTVLAAFQSVADEVISLQSLTQQQAGIQDALRSARQAYGLAERGYRSGFTDYLNVLAA
                     DNELRRQQFSLALVQAARLDAWALLMQALGGGFDSTAVAEQP"
     gene            complement(36104..38266)
                     /locus_tag="CNE_RS36865"
                     /old_locus_tag="CNE_BB2p00340"
     CDS             complement(36104..38266)
                     /locus_tag="CNE_RS36865"
                     /old_locus_tag="CNE_BB2p00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FUSC family protein"
                     /protein_id="WP_013954133.1"
                     /translation="MTAAAKSIAPVRTWLADAASAWWQADRGRLVHASKTVAAVLLAT
                     WLSMRLELASPRTAMVSVVILMMHQHSGMVLARGFYRALGMLVGSFAALLLFFVFPQE
                     RVLFLLGLSMWIGLCVCGATYYRNYQSYGFVLSGYATCIAAVPSIANPYAIFENVVVS
                     LSEVSVGIACAGLVSGLVFPQRVAAMLLAAGQQHIATFTGFIRDALQGRQTAAGLGAL
                     HLRLAGERAQLESLRSAVVFEDPEMRANNALMIRLNHDFLDALARFHTIHQLRARMAK
                     AVDHRAGDALDALFGRLAAVLPPTAGRTRLELAEIGTLHDNLLGLNAALPSHIAAASA
                     TLSDAPPLSTDRFAAGASALRDAVADLLSYTGNFLALRSPGVASAPRPRAQARRRANP
                     ANRAFALASGVRATAAVLASAWLWIVSGWAGGSSGVIAATIAIALYSIMPQPTAIARQ
                     MLIGCALAWLAGLFFNFFLLPHLDGFLLLAVALAPFIALGSYVGTFPPRAAIGLGFGI
                     YFCFLGNLSNPMVFNPAGYLDSGIATLLGIAIASLAFATIVPQGGHWLAEQYLKQLRT
                     MVATDICRAPLGGLRLHFETHIRDFIQFAGSRPAAGRAGQAELLGWAFAALEIGLGMI
                     ALREATAQGSRPAAWESRQENLLAAISALFLAPSPRGFERALQAMEDAIGWTVDHASR
                     PAAEARAILHTMRLSLLDDALPLVVASSTNETGTPDAP"
     gene            38521..39480
                     /locus_tag="CNE_RS36870"
                     /old_locus_tag="CNE_BB2p00350"
     CDS             38521..39480
                     /locus_tag="CNE_RS36870"
                     /old_locus_tag="CNE_BB2p00350"
                     /EC_number="1.13.11.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="WP_013954134.1"
                     /translation="MSNTMAEATASLSSDCAPCPGKPVLERIPTRPAEVGEGLVIHRA
                     LPNRQRRMVGAWCFLDHAGPIEFPDGQGLNVGPHPHIGLQTFTWMIEGEVLHRDSLGY
                     EQLVRPGQVNLMTAGNGIAHAEHSVGTGGRLHAAQLWIALPEDRRHMAPAFQNYPDLP
                     SVTSGGFDITVLAGTAFGQTSPVAVHSPLVGMDLATGQAASTAVPADPAFEYAALTLS
                     GEAVVEGEVLGPDTLLYLGTGRQQIAVRSDGAAELLLIGGVPFGEGIVLWWNFVARNA
                     AEIEAATHDWNSGSSRFGEVAGDVGARLVAPDVTGMHLKPQRR"
     gene            39757..40707
                     /locus_tag="CNE_RS36875"
                     /old_locus_tag="CNE_BB2p00360"
     CDS             39757..40707
                     /locus_tag="CNE_RS36875"
                     /old_locus_tag="CNE_BB2p00360"
                     /EC_number="1.13.11.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metapyrocatechase 2"
                     /protein_id="WP_013954135.1"
                     /translation="MNTNGAQPGTAAAGPRYAVHSIDHYALEVPDLAVAEHFLDAFGL
                     TLRHNAGWLEAYATDGHCWARFHEGEHKRLAYLSFNCYAEDLAGIRQQLADAGAAFVN
                     DAPHGQAGGIWFFDADGNLVQVKAGPKTSPDAKIKAGLESTPAGQRGALVRSQVQKVH
                     PRRLSHVLLFSPNVPNLVAFYRDALGLRLSDRSADIIAFTHAPHGCDHHLLALVKSSA
                     KGWHHAAWDVASVNEVGQGAAQMANAGYTRGWGTGRHVLGSNYFFYVLDPWGSFCEFS
                     ADIDYIPAGHDWPTGDFAPEDSLYQWGPDVPDYFIRNTEA"
     gene            40815..41678
                     /locus_tag="CNE_RS36880"
                     /old_locus_tag="CNE_BB2p00370"
     CDS             40815..41678
                     /locus_tag="CNE_RS36880"
                     /old_locus_tag="CNE_BB2p00370"
                     /EC_number="4.1.1.68"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="WP_013954136.1"
                     /translation="MKLATFLLDGRARVGVVSADGVLALPEAAGNDVCALVAVGTDSE
                     RWRALYAQATPVADADSLTWLPPVGRPPKILCVGLNYADHTKESPYEQPDYPTLFLRV
                     ATSLVGHNGAIVRPLVSDSLDYEGELAVIIGKGGRHIAREEALGHVFGYSIFNDGSVR
                     EYQFKSPQWTVGKNFDATGGFGPFVVTADELPPGAAGLQLETRLNGQMVQSASTSDML
                     YDVASLIAIISEAITLEPGDVIVAGTPSGIGWARKPQLLMRHGDVCEVSIEGIGTLSN
                     PIFDESAPQAR"
     gene            41711..43486
                     /locus_tag="CNE_RS36885"
                     /old_locus_tag="CNE_BB2p00380"
     CDS             41711..43486
                     /locus_tag="CNE_RS36885"
                     /old_locus_tag="CNE_BB2p00380"
                     /EC_number="1.14.13.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dichlorophenol 6-monooxygenase"
                     /protein_id="WP_013954137.1"
                     /translation="MKTIEVPVLVVGAGPAGLTTTALLATYGVRTLTITKYQGTANSP
                     RAHITNQRTMEVFRDLGIEDRVLALATPNALMSNNVWATSFAGTEIARLQTWGSSEQR
                     KADYATASPSPMCNAPQHLLEPVLLDCARERGAEFLFNTELTQISQTADEIMALLTDR
                     ITGEITQVKARYVVGADGGASTVVPQCGFEMEGQMGLGAAVNCWLEVDLAKFCEHRPG
                     VLYWMTQPGNDYWVGSGTYICVRPWNEWVLLFMYDPARGEPDLSEEAVIRRARATIGD
                     DSLPIRVKAVSKWQINHVAAKDMRKGRVFIAGDAAHRHPPANGLGTNTSIQDAFNLAW
                     KLAHVIRGNADDSLLDTYSAERQPVARRVVDRAMQSVRNMLPIAKALGFEPGQSEAQG
                     WQNVDELFGDTERGRERRRALEEAVRLQNYQFNCHGVEMGQVYASDAVVSDGRPRDPY
                     TRDPDLYYHPSTSPGGVVPHAWLELSKERVSTLDLVGHGRFTLLTGVGGAGWRRIAAD
                     VSAALDIDIEVVSIGGPNCDAHDVYGTWSELRSISDSGAILVRPDRFVGWRRENIDAH
                     AAQALEHAIRDILGRPDQAGRRQAA"
     gene            43553..44344
                     /locus_tag="CNE_RS36890"
                     /old_locus_tag="CNE_BB2p00390"
     CDS             43553..44344
                     /locus_tag="CNE_RS36890"
                     /old_locus_tag="CNE_BB2p00390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954138.1"
                     /translation="MPRTKSATTVAGEAAISSPEAPDLGGRTWASVLEQSVREDIING
                     KLPAGSKLRLKELAERYQAGVIPLREALSRLCTTGFVLAIDQKGFRVAPLSADELLDI
                     TRVRQQIDTSALRDAIEAGDIGWEAEVVAAHHRLTRIPMVLRGKDGSLNPEWEEAHAA
                     FHEVLVSGCRSAWLRRFSIVLRDQTARYRFLSLAVPKAARTRDVAAEHEAIVNAIVAR
                     NAREACRLLGGHFQATTDLVLKYLEQQKTKPATARKPAVATELAT"
     gene            44581..45159
                     /locus_tag="CNE_RS36895"
                     /old_locus_tag="CNE_BB2p00400"
     CDS             44581..45159
                     /locus_tag="CNE_RS36895"
                     /old_locus_tag="CNE_BB2p00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyloxyacyl hydrolase"
                     /protein_id="WP_013954139.1"
                     /translation="MPVNKQTKRRGLLQAAAAFPLAACLAMLPVAAGAATFSMQAGYG
                     RDNGHGVEKYEVAGHWEDIVQWQLSSRFSLALDGEVNIANWRALSREPSSQLMEFGVS
                     PIFRLNYDGEYASPYLEASVGFRVLSHTEIADGHRMGSAFQFADMVGVGVAFGKGRRF
                     SVGYRFQHLSNASIKEPNPGTNFSMGYVRYRF"
     gene            45429..48107
                     /gene="aceE"
                     /locus_tag="CNE_RS36900"
                     /old_locus_tag="CNE_BB2p00410"
     CDS             45429..48107
                     /gene="aceE"
                     /locus_tag="CNE_RS36900"
                     /old_locus_tag="CNE_BB2p00410"
                     /EC_number="1.2.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
                     /protein_id="WP_013954140.1"
                     /translation="MAQALPNSRNDDIDAQETTEWLDALDSVIAYEGAGRAHYLIGQL
                     IEHAHHVGIYLPFSANTAYVNTIPLDAQARSPGDQDLEHRIRSYIRWNAIALVLRAAR
                     DTNVGGHIASFASAATLYEVGFNHFWRASSEQRGGDLVFFQGHSSPGFYARAFLEGRL
                     TTEQMDNFRQEVGGKGISSYPHPWLMPDFWQFPTVSMGLAPIMGIYQARFMKYLEDRG
                     FGQHGGRKVWVFCGDGEMDEPESRGALGMAGREKLDNLIFVINCNLQRLDGPVRGNGK
                     IIQELESEFRGAGWNVIKVVWGSKWDALLARDKAGILARRMMECVDGDYQTFKAKDGA
                     YVREHFFNTPELKALVADWSDDDIWALNRGGHDPHKVYAAYHAAATHQGQPTVILAKT
                     IKGYGMGEAGEAQNITHQQKSMRVEALMHFRDRFKLPLSDQQLDELPYLSFEEGSREH
                     TYLHERRKALGGYLPARRRRGPSLPVPALSAFDAQLKASGEGREFSTAMSFVRILNTL
                     LRDKALGRRIVPIVSDESRTFGMEGLFRQIGIWSQQGQTYTPQDATQLSFYKESKDGQ
                     ILQEGINEAGAMADWIAAATSYSTHGEPMIPFFIFYSIFGFQRFGDLAWAAGDQRARG
                     FLLGGTAGRTTLNGEGLQHEDGHSLVWGGTIPNCVSYDPTFAYELAVIIQDGLRRMVQ
                     EQEDVYYYITVMNENYEHPAMPEGAEADILKGMYLFRRGKDDREDGPRVQLLGAGTIF
                     REVIAAAELLEQDWDVQADLWGCPGFTELAREGNAVARWNLLHPGTAPRRSHVEQCLA
                     PTKGPVIAATDYVRVLADQIRPFVPRRYAVLGTDGYGRSDTREQLRHFFEVDRYWITL
                     TALKALADEGALDGAVVQQALHKYGIDPEKPYPLGV"
     gene            complement(48136..49098)
                     /locus_tag="CNE_RS36905"
                     /old_locus_tag="CNE_BB2p00420"
     CDS             complement(48136..49098)
                     /locus_tag="CNE_RS36905"
                     /old_locus_tag="CNE_BB2p00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954141.1"
                     /translation="MQLRTEEIEAYLLVVELGSVSGAARHMALSKSVVSKRISDLERS
                     LGVTLLQRSTRRVQPTESGRHFYEQARAAMAQLTRAAESISKTSQELCGELRILAPMS
                     FGTLWLSPLISEFAKAHPRLHVVMELDDRLVDTGYERYDVAIRITRLGDSALIARKLA
                     VSRRILCCSPEYAAHAGLPESIDDIARHACLSYSNSPPGQIWAFRGHTPQAAPKIIAP
                     RGVFTANNGEVLRDAALGGHGIAVLPLFIVSRELAAGRLIEVLPDEAPIDDGVFAVYP
                     RTAYTSQKIRTLIQFLQQSLSSPPWEPRCESAAGTLDVKPVLSV"
     gene            complement(49359..49571)
                     /locus_tag="CNE_RS36910"
                     /old_locus_tag="CNE_BB2p00430"
     CDS             complement(49359..49571)
                     /locus_tag="CNE_RS36910"
                     /old_locus_tag="CNE_BB2p00430"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229373.1"
                     /translation="MPFGISPVFRRNDVAGYATPCLEAHRENALGAQAEIHDRPRYVT
                     GDMIAMPLAAVAGVGVCQLPVMRVWD"
     gene            complement(49571..50278)
                     /locus_tag="CNE_RS36915"
                     /old_locus_tag="CNE_BB2p00440"
     CDS             complement(49571..50278)
                     /locus_tag="CNE_RS36915"
                     /old_locus_tag="CNE_BB2p00440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013954143.1"
                     /translation="MAPASNLFFKAGYCMESQPDSSANAAHRPPLRMTRRGEEKRALI
                     LSIAADMFLEHGYDGVSLDEIVKACGGSKTNVYSYFGGKDGLFVAVVERLCDRFLEKT
                     ETSLDLSRCNAAEGLQKIAHSFLQSLLEERHLAFLRLIFAESRRFPALGNAWYTRGPA
                     ATCAYVAGFLATQQVAGARLSASPEVSARLFHGMVLASVLHRTLATGVRPDDSETDAL
                     VNDAIALIVAEGAPGAA"
     gene            50491..50811
                     /locus_tag="CNE_RS36920"
                     /old_locus_tag="CNE_BB2p00450"
     CDS             50491..50811
                     /locus_tag="CNE_RS36920"
                     /old_locus_tag="CNE_BB2p00450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954144.1"
                     /translation="MKTRMIGAVAMLVMASAAQASVRSPTDGARAAQASLPVAEALQR
                     SQTGHMADEQFRKIAVRKADPYLDGAARPVDPATDGALRQVGPFTDGALARIVGVDPF
                     TDGA"
     gene            50963..51760
                     /locus_tag="CNE_RS36925"
                     /old_locus_tag="CNE_BB2p00460"
     CDS             50963..51760
                     /locus_tag="CNE_RS36925"
                     /old_locus_tag="CNE_BB2p00460"
                     /EC_number="2.3.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012351988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citryl-CoA lyase"
                     /protein_id="WP_013954145.1"
                     /translation="MTDTKPTRPAGRTAIAYVDTHGVSVHGKDLSQEIIGKTGFTEYF
                     LFLLTGRQPDAKLVAITDACLVAIAEHGLVPSVQAARMTLAAAPDALQGAVAAGVLGC
                     GSVILGASETAGQLLGEVLSGKEAGTLAESAHSVVRALRQARRPLPGFGHPTHKLGDP
                     RAHRLLAVARELGVAGDHVAALEAVAAVVPEYYSKPLPLNVSGAIPAVLLDAGYPATA
                     LKGVPMLARVASLIAHLQEERQQPIGFILSDAAEHAITYSAAPAQAS"
     gene            51757..53400
                     /locus_tag="CNE_RS36930"
                     /old_locus_tag="CNE_BB2p00470"
     CDS             51757..53400
                     /locus_tag="CNE_RS36930"
                     /old_locus_tag="CNE_BB2p00470"
                     /EC_number="6.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="WP_013954146.1"
                     /translation="MKPLIPNAGGAMVAPLEVLRQYRAHDFTLADFLAARVEAHPDKP
                     ALLFEGETWTYRQLDARIARVASWLAQEMQVGAGDRVGVLSANHPSTVVLMFALARIG
                     ATMVPANPDYRLDEALYVFRHAQVCGLVCSPATLETAAAIAAELGGAIWLRANESGSH
                     NVPTLEQSIAAHAGAYADGAGSAADTALIIYTSGTTGFPKGAMHSHRGYVLTAEAFIG
                     RLHLQPDERVMCVMPLFHINALMYSVGGALACGGCLVLLRRFSASSFWRFAAETGATE
                     VNLVAAAGSILARRPREEFVPGHRLSKMFIAPQTKEMVQVMKREFHVPRLIECYGMTE
                     IPGVIANPFNGPHKLGTMGLVSPHPDPAVPVPEARIVDDDGHDVAPGAAGELLIRTPT
                     LMQGYYRDAAQTEAAFRDGWFATGDLVRQDSDGYYVFVARKKDVIRRKGENVSGAELD
                     RIFGEHPAVEEAAAIGVPADLGEEEILLAVQFRPGQSVEPGELLAWARDRLAVHKLPR
                     YVVAVDAIPHTPTHKPAKHKLKADGTLFARATDMAAASH"
     gene            53423..54262
                     /locus_tag="CNE_RS36935"
                     /old_locus_tag="CNE_BB2p00480"
     CDS             53423..54262
                     /locus_tag="CNE_RS36935"
                     /old_locus_tag="CNE_BB2p00480"
                     /EC_number="1.13.11.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 4,5-dioxygenase subunit beta"
                     /protein_id="WP_013954147.1"
                     /translation="MNNPDNHTLQRAFDAMCEDAPGADPVLQAQFRVALKHFHAMLDE
                     LKLTDEQLYRIATWMGKVAQQDELIMLCDMMGLTMRALDLARTDDHATPQNVTGPFPK
                     DEIAEGSNPCHIATEDEPGQRLEVRGRVLDAATGKPVPGAMMIVWQPNQFGRYENEDD
                     SQSEDNLRGKLRCEADGSFQVFTVRPGGYIIGREDTEVGVLMKRLGRNRQRAPHIHYR
                     VMQPGYRTLTSQLYFAGDPANPVDCIFSTIDDHIVDALPHPERDGYQLVNLDIVLQPE
                     AAQ"
     gene            complement(54281..55135)
                     /locus_tag="CNE_RS36940"
                     /old_locus_tag="CNE_BB2p00490"
     CDS             complement(54281..55135)
                     /locus_tag="CNE_RS36940"
                     /old_locus_tag="CNE_BB2p00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010808953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013954148.1"
                     /translation="MTSAAKPSAPVDNDAPPKLEEGHRDYVAALARGLAVIQAFTETT
                     PELTLSEVAQATGMTPATARRALLTLQALGYIGANGRRFVLLPKVLSLGAAFLSSMNL
                     RDIVQPFLQEVAERFRDSVSLAILDGDSVVYLAHVPSRRRIAFRASVGYRLPVHCTSL
                     GLALLAHAPKAQQNKILDKAPFQKFTPVTLSDADALRAALARALEQGYAIQDSQLELG
                     VLSIAVPVRDPQQRVIAAINCSTETERTSADELVATRLPALREAAASIEAAIRRAPAL
                     AHSITAAS"
     gene            55219..56106
                     /locus_tag="CNE_RS36945"
                     /old_locus_tag="CNE_BB2p00500"
     CDS             55219..56106
                     /locus_tag="CNE_RS36945"
                     /old_locus_tag="CNE_BB2p00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954149.1"
                     /translation="MRLDPTSLRLFVAVAETGSIAAAAEHAHLAAAAVSKRVSELEQG
                     LGTALLMRSNKGVQPTMAGMELAHLARGVLHNLDDILVRMRDYGGGLRGQVRVMANIS
                     AITQFLPAQLKSFLAEYPLIDVHLEERVSTAIVRAVAENAADIGIFTAGAVGAELETF
                     PYRRDELVVVVPGAHPLAGRHSVTIREAFDYDFVSLHAGSQIHLQLAKAASEAGRVFK
                     PRIHVPGYDALCLMVQAGLGLGILPRSSAGPYQQTLGICTVALDEAWAARQLVIGVRA
                     YEGLSAVARLLVDRLREDE"
     gene            56228..57439
                     /locus_tag="CNE_RS36950"
                     /old_locus_tag="CNE_BB2p00510"
     CDS             56228..57439
                     /locus_tag="CNE_RS36950"
                     /old_locus_tag="CNE_BB2p00510"
                     /EC_number="5.1.99.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013954150.1"
                     /translation="MANEANNGTMPLQGVRVIELGSLIAGPYAGGLLAQFGAEVLKIE
                     SPKDGDPLRKWRKLYEGTSLWWYSQSRNKKSLTLDLRSAQGQEIVRKLVAEADIVIEN
                     FRPGTLEKWGLGWEDLRKVNPALVMVRISGYGQTGPYKDRPGFAAIAESMGGLRYVSG
                     YPDRPPVRSGVSIGDTLASLYGVIGALLAMHHLRANQGEGQFVDVALYESVFAVMESL
                     VPEYAKFGHVRERSGASLPGISPSNTYPCQDGQYVIIAGNGDAIFRRFMAAIGRDDLG
                     EDPRLAHNDGRVQHNAMLDDAITAWTSAHALDTVLATLEAAAVPCGKIYTAAEISSDA
                     HYRARDMIEPHHLPDGSPLELSGIVPKLSGTPGRTRWIGPELGQHTEEILAGIGIAGD
                     ELRALRAAGVV"
     gene            57469..58413
                     /locus_tag="CNE_RS36955"
                     /old_locus_tag="CNE_BB2p00520"
     CDS             57469..58413
                     /locus_tag="CNE_RS36955"
                     /old_locus_tag="CNE_BB2p00520"
                     /EC_number="4.1.3.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /protein_id="WP_013954151.1"
                     /translation="MWLPNAPRRVSINEVSVRDGFQIEPEFVPTEEKIALIDQLSNTG
                     LARIEITSFVSPKAIPNLRDAEAVARRIRRNPAVVYTALVPNVRGCERALDCALDEIN
                     LVMSASETHNLANMRMRCEQSLAQFAEVMQLARAGGLRASGCVATAFGCPFEGAIAPE
                     RVKWAAGRYLDLGMDSITLADTTGMADPRQVSALAESFLRWFPGVPLTLHFHNTRGMG
                     LANVMAGLAAGVDSFDASLGGLGGCPFAPGATGNISTEDLVHMLEAAGIDTGVDLDRL
                     LGAARGLPGLVGHDISGQVVKAGKSTDLHPVPEWVGAR"
     gene            58444..59859
                     /gene="leuC"
                     /locus_tag="CNE_RS36960"
                     /old_locus_tag="CNE_BB2p00530"
     CDS             58444..59859
                     /gene="leuC"
                     /locus_tag="CNE_RS36960"
                     /old_locus_tag="CNE_BB2p00530"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_013954152.1"
                     /translation="MTEPDRPASLLDKLWASHVIHQEPDGPALIYIDRHLVNEVTSPQ
                     AFEGLRLNARKVWRAASVLATADHNVPTTARKLGIADPVSRAQVEALDQNCADTGIVN
                     FGMDDPRQGILHVVGPERGATLPGMSIACGDSHTSTHGAFAAFAFGIGTSEVEQVLAA
                     QCLWMKKPKSMLVRVEGELPRGVAAKDIALALIGRIGTAGATGHVIEFAGSTIRGLSM
                     EARMTVCNMAIEAGARAGMVAVDETTLAYLDGRPQAPAGAMWDAATGYWRTLRSDPGA
                     TFDAVVELDATAIRPHVTWGTSPEMVVAIGERIPDPRDERDPVQRKSIEQALDYMGLL
                     PNTPIEAVALDKVFIGSCTNARLEDLRAAAAVLRGRHVSPRIRQALVVPGSGLVKSQA
                     EAEGLDQVFIAAGFEWREPGCSMCLGMNDDRLSAGERCASTSNRNFEGRQGPGGRTHL
                     VSPQMAAAAAVAGHFIDVRSL"
     gene            59881..60519
                     /gene="leuD"
                     /locus_tag="CNE_RS36965"
                     /old_locus_tag="CNE_BB2p00540"
     CDS             59881..60519
                     /gene="leuD"
                     /locus_tag="CNE_RS36965"
                     /old_locus_tag="CNE_BB2p00540"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011614948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_013954153.1"
                     /translation="MRAFTTLDGLVAPLDRANVDTDAILPKQFLKSIRRSGFGPYLFD
                     DWRYLDHGEPGQDCSSRPLNPDFVLNQPRYRGVSILLARENFGCGSSREHAPWALEDF
                     GLRALIAPSFADIFYNNCLKNGLLPIVAAPDVVERLFAETAATPGYRLQVDLAALQVV
                     TPSGEAIAFTLDPFKQHCLLNGLDDIALALRHAGQIQDYEQARRQREPWLFD"
     gene            60587..61579
                     /locus_tag="CNE_RS36970"
                     /old_locus_tag="CNE_BB2p00550"
     CDS             60587..61579
                     /locus_tag="CNE_RS36970"
                     /old_locus_tag="CNE_BB2p00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954154.1"
                     /translation="MSWQFHTTHALRAAAFGLACLAGTDAALAQTYPTQPIRMVVPYA
                     PGGTTDIIARQLAQRMSEKLGQPVVVENKSGANTVIGADAVAKAQPDGYTLLLTNDAT
                     FVLNPVVLPSVSYNVARDFAPVATIGYVPLVMAVSGSLPVDSVKDLAAYAKGRPQALS
                     YGSFGSGSQPHLMGALFNKLAGTDLVHVPYKGSAPAVADVVGGQILMTFPALPTIRSF
                     VAAKKLKVLAVSGDKRTRALPQVPTFAEAGYKDMDISAVYGVLAPAKVPRAVVDKLNA
                     TIREILDDKDFVEKHFAAQGMVPMKLSPAQFSQYIETQTRQTRKLVELSGVRVE"
     gene            61588..62505
                     /locus_tag="CNE_RS36975"
                     /old_locus_tag="CNE_BB2p00560"
     CDS             61588..62505
                     /locus_tag="CNE_RS36975"
                     /old_locus_tag="CNE_BB2p00560"
                     /EC_number="1.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="WP_013954155.1"
                     /translation="MTSTNNARAVHAPRLGWIGVGAMGRPMCLNLLKAGYRLTVFDRV
                     PAQCEAVAAAGATVAPAAQALVADSDVVFSTIFDDGGLRDLFLAPGGVAGAATADKVF
                     VDMSTVSPDASAEVSAALAQRGAAFLRAPVSGTVSLATSAQLSCFVSGPRPAFDAVQP
                     ALACLTARQSYVGGADEARVIKLMINMMVFMSTAVIGEGLVFGARAGLDRALMVDAIN
                     DSIVGSAHYRTKAEQLKQRDYAAVGPISLVVKDLDLALAVARDNAVALPMSSLVRQYL
                     ALMQQRRQDHLDIAALADVLEWAGVPGAV"
     gene            62542..>63617
                     /locus_tag="CNE_RS36980"
                     /pseudo
     CDS             62542..>63617
                     /locus_tag="CNE_RS36980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010808945.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
     gene            <63617..>64003
                     /locus_tag="CNE_RS36985"
                     /pseudo
     CDS             <63617..>64003
                     /locus_tag="CNE_RS36985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011614952.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
     gene            complement(64351..64533)
                     /locus_tag="CNE_RS40440"
                     /old_locus_tag="CNE_BB2p00610"
     CDS             complement(64351..64533)
                     /locus_tag="CNE_RS40440"
                     /old_locus_tag="CNE_BB2p00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954158.1"
                     /translation="MAGGASVLIQTLLVCLARGSDLDLSSEIQGIRFGRSVVMILELI
                     FMKGEIQLADLKDQLT"
     gene            complement(64589..65662)
                     /locus_tag="CNE_RS36990"
                     /old_locus_tag="CNE_BB2p00620"
     CDS             complement(64589..65662)
                     /locus_tag="CNE_RS36990"
                     /old_locus_tag="CNE_BB2p00620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954159.1"
                     /translation="MRQDQSGIPRAARHRVTRASHISPRQAVETRRQRPRINDFDTAT
                     SSLLMDIKQLRALLAVAETGSTTKAAERLHIVQPAVSRHIRLLEEDLGVELFERERHG
                     MLLTDAGKTLAEYGRRALRELDRARAEIQPAAGLVSGTADIGLLPSCGELLAPELVAT
                     LRDRHPQLGVRLTVGYAGHLRQWLESGDVDAALMYDDKSVTGLQVQALLDEQLYLVGR
                     PSTVPQAGPLSIMDLEGLALVLPNPPHGLRNVVEHAFAVSGIDLVIAAETNSLSVQKS
                     LVAKGFAHTILPSSAISDDLARGTLAAAPIASPALSRRILLARLATRTQSTAASCATA
                     ALVSLMKRLVQDGVWRGATWIGA"
     gene            65747..66142
                     /locus_tag="CNE_RS36995"
                     /old_locus_tag="CNE_BB2p00630"
     CDS             65747..66142
                     /locus_tag="CNE_RS36995"
                     /old_locus_tag="CNE_BB2p00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="WP_013954160.1"
                     /translation="MNEKTSADIAAVMTADDARYAAMLAGDVAALDALLADSLVYTHA
                     TARTEDKAAYLKAVSSGLVKYVELKRSEAVVQVYGPTAVMHGQLSLSVLREGSRKGMN
                     GLFQSVWVRSDNQWQMAAWASVPQAFTSA"
     gene            66221..66520
                     /locus_tag="CNE_RS37000"
                     /old_locus_tag="CNE_BB2p00640"
     CDS             66221..66520
                     /locus_tag="CNE_RS37000"
                     /old_locus_tag="CNE_BB2p00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013954161.1"
                     /translation="MSEKNVVLAVNCRIRSDKVKELMAELLANAEASRAEPGCLHFDV
                     SVDKDDPTKIMYYEVYRDQAAIDSHAQTAHHKRWVTEGAPLLEVRQPVRLSRTAP"
     gene            66615..66917
                     /locus_tag="CNE_RS37005"
     CDS             66615..66917
                     /locus_tag="CNE_RS37005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013954162.1"
                     /translation="MSERKQVVVVACQPKAGKRQQLLDELEKNRMAALQIEAGCLQFD
                     VTTAEDSDERIVVYEVYRDLAALEAHQQTPHFKRFLQEGIPLFAEHDLAIYERVAP"
     gene            67031..68422
                     /locus_tag="CNE_RS37010"
                     /old_locus_tag="CNE_BB2p00660"
     CDS             67031..68422
                     /locus_tag="CNE_RS37010"
                     /old_locus_tag="CNE_BB2p00660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954163.1"
                     /translation="MINSDSTISTSLPAQIGKEEEDKVFRRVTRGILPLLFICSMIAL
                     FDRFIVGFAKLQITEAFGLSAAAYGFGAGIFSLGYLLFEVPSNVILARVGAKKWIARI
                     MVSWGIVTVGTILVRTPEQFYMARFLLGLMEAGFYPGIVYYLSGWFPRARFGRVMALL
                     LLVFPISNLFIGPLSGWILESMSGTAGLAGWQWLFVVMGIPAILMGFVFFLLVADKPQ
                     DAKWLSAHEKRIVLDAIARDRASRHESGGWFLAFKDWRVWALGAIMAGGYLGLYGIVF
                     WLPTMVQSAGVSGFRNIGLIASIPWIGTVLVTLVLGYSSDYFQERRGHFCFAVLLGAL
                     GFVISVQSSTNIYVTIAGLSVACAFLFACFPPAWALASTLLVGQSAACGLALVNTVAS
                     FGSFIGPYLMGIGQERTGGLTAPLMVLAAICSVSALAIWLIPAHAPDQSGAGSRALKD
                     AKTGGSVADSMAQ"
     gene            68488..68919
                     /locus_tag="CNE_RS37015"
                     /old_locus_tag="CNE_BB2p00670"
     CDS             68488..68919
                     /locus_tag="CNE_RS37015"
                     /old_locus_tag="CNE_BB2p00670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="WP_013954164.1"
                     /translation="MSAFVRWPGRSDMKDETKRKITSVLIADDQRHAAMIGGDMAGLD
                     RLLGGDLVYIHGSARQDDKQQYLASIASGAVKYLDIKRTAAAVQVYGDTAVVHGHIAI
                     QGMSSGEKRLIDSLFQSVWVLASFGWQMVGWASIPTGKAQA"
     gene            68932..69888
                     /locus_tag="CNE_RS37020"
     CDS             68932..69888
                     /locus_tag="CNE_RS37020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate (FAA) hydrolase"
                     /protein_id="WP_013954165.1"
                     /translation="MKFVTIDCGEKGHPGLLMSDGNILDLILLRRHLGVAKLMPADVR
                     GILEGGAPALALADQCRRAVEEMSDHASAQLSETGALVSFHGTPLLAPIPEPRLLLAA
                     SGNYGRHMREYPDVPLPENPTAFIKPADTLTGHEKPILIPPQFPDQVDFEGEFAFVFG
                     RTCHNVDEASAMQYVAGYTIVNDVSARNWVAEVFSSTERFQSIRAWDRNILGKNLPSF
                     SPCGPILTTADEIADPHDLAITTRVNGKVMQDSGTSDLICRIPRLISYFSKWYRFQPG
                     DIFSTGTPEGVGAGRTPPVYLKRGDRIEIEIAGLGTLANPVA"
     gene            69964..70359
                     /locus_tag="CNE_RS37025"
                     /old_locus_tag="CNE_BB2p00690"
     CDS             69964..70359
                     /locus_tag="CNE_RS37025"
                     /old_locus_tag="CNE_BB2p00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin 2 domain-containing protein"
                     /protein_id="WP_013954166.1"
                     /translation="MEDVEKLTILRGEDLNWESDGRRGFFEYCDLGMRKATSGRYLVH
                     LIRATASMESPIGGHRHIVDLQVVYMLKGWMKLWHEGHGEVTLKAGDCMYQPGGLTHG
                     ALDWSADFECLEVISPGNFSTLESETEAA"
     gene            70418..71353
                     /locus_tag="CNE_RS37030"
                     /old_locus_tag="CNE_BB2p00700"
     CDS             70418..71353
                     /locus_tag="CNE_RS37030"
                     /old_locus_tag="CNE_BB2p00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catechol 2,3-dioxygenase-like protein"
                     /protein_id="WP_013954167.1"
                     /translation="MSIIKATGVAYGRLRAPDLDRMEAFLLDFGMVRVARNENTLYMR
                     GTGPAQYIHVTEKGSPAFLGMAYRAGSEADLEKLTRVPGASAVEPIDAPGGGKRVRLR
                     DPDGYLIEVVHGIAPLPELPITHRHPEQGRTVGVLDRIHMGPARVRSFGHAVIFTPRL
                     QETLEWYWHVLGLLPSEEVYEGSPDNVLGSFNRCDCGDEFVDHHVAMFFSNATAGLNH
                     LAFEVVDLDDVFTGHEHLQARGGYEPLYGVGRHLLGNQVFDYWGGPWGMVHEHYAHGD
                     LLNASSGRKRVDIAQGFVSPWGGEPSEALLNRVVP"
     gene            71385..72092
                     /locus_tag="CNE_RS37035"
                     /old_locus_tag="CNE_BB2p00710"
     CDS             71385..72092
                     /locus_tag="CNE_RS37035"
                     /old_locus_tag="CNE_BB2p00710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetase"
                     /protein_id="WP_013954168.1"
                     /translation="MNTSLEFDPQSLVLPRVPIRGSTQHYHVRRIFCVALNYADHARE
                     MGREVSPEPPFYFTKSPFAITHTDSVVPYPPATANYHHEIELVAAIGKPAFRVSPAEA
                     WDCVFGYACGLDMTRRDLQLAARDKGRPWEVGKDFEESAIVSEIVPVSAIGHPQSGRI
                     AVSVNGETKQDSDISMFIWNVAELVSDLSKYYRLGPGDLIYTGTPHGVGPVRAGDSLH
                     GVVAGVASIDLRIGPAA"
     gene            72177..73976
                     /locus_tag="CNE_RS37040"
                     /old_locus_tag="CNE_BB2p00720"
     CDS             72177..73976
                     /locus_tag="CNE_RS37040"
                     /old_locus_tag="CNE_BB2p00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954169.1"
                     /translation="MNEQGESGRVGKWPPGDAAGQENRAGNAASEASARSAYSQAYRS
                     PEVGGNRGARLLLKGGTVLTLDEKVGDFEQADVLVEGKKIVAIAPHLEAAGAQVIDCS
                     GTIVMPGFISTHQHQYQTLMRSALSDGIHIRAIPANSQQPVAKWPGEFYTTTIQEVWT
                     PGFMPNPPVPGQPPIWDLGRPPMDPEDCYIAELVSSLSQITQGVTTITDTSQSSHTPD
                     HTDAMIQALFDSGQRAVYAYGWGNDRSAQFPEQSYEYPGRSGDTSFGLGRLAKTYFSS
                     KDQLVTLGAMLDWHPVVDPRTREKQNYTGWQLAREFGAWINNHAAHGAVVEGIAEDPR
                     NGTDWSDVTLVHCTLWQDEPVAQIGVDNVRSRAWQLVADRGAHVSISPLVEMQMRHGM
                     PPFQLALNYGILPSLSPDTETNMTTNPFSMMRSAFTLQRALANELVFPLSDPQGLKVP
                     QLVTSRQVIEMMTIAGAAGSGLLHKVGTLTPGKEADIVVLDANTLNTAPMNNVPGTVV
                     TLMESRNVRDVVIAGKIVYRDGKLVGWDVQKLLRDVTRARDRVLARINGPALAGALPA
                     GLNSHAEPYRPNFLGSTSYIGQNATAPAYVLRP"
     gene            74109..74630
                     /locus_tag="CNE_RS37045"
                     /old_locus_tag="CNE_BB2p00730"
     CDS             74109..74630
                     /locus_tag="CNE_RS37045"
                     /old_locus_tag="CNE_BB2p00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954170.1"
                     /translation="MKKEEDGLSALGRLLASAGAALALAGCAAAPTMVELQEVRGISA
                     QTLQARLGEPTDKVRLHDGRSRWLYSGQPLGLFVYAADFDTDGALVDYRQMLTMEELQ
                     QARPGAWAKQDVVARFGKPRLPIQYYALQKREVWSYRFQYVTQVAIFHFQFDAGGVLR
                     ATQMSINCFEDMM"
     gene            74741..75658
                     /locus_tag="CNE_RS37050"
                     /old_locus_tag="CNE_BB2p00740"
     CDS             74741..75658
                     /locus_tag="CNE_RS37050"
                     /old_locus_tag="CNE_BB2p00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954171.1"
                     /translation="MKWFVSFLLFVLCSTAWGQSLTLYGVIDIAIARNPGKGAWAMQN
                     GSGNRFGLRGTEDLGGGMQAFFNVENRFAGDTGAMRDPTRLFNDRSMVGILGRFGRFW
                     VGREYTPASWNVQIPADPLYNSTLMSMFLISTGGIGRVYNDKSVNYEFDVDGLTFSGQ
                     VAEDEGNKVPHRPVSFSVSYRAGSVLAAYGYDRPGGDRAIWHMVTGVYETQAFTLRAS
                     MGGGMTDTGNRRVSLILGATIPIRNSQLHISHGKLRDTTSDRTLMEKTGIAYYYSLSK
                     RTSLYADIVHDSNARPKHFGGEIGIKHRF"
     gene            complement(75691..76422)
                     /locus_tag="CNE_RS37055"
                     /old_locus_tag="CNE_BB2p00750"
     CDS             complement(75691..76422)
                     /locus_tag="CNE_RS37055"
                     /old_locus_tag="CNE_BB2p00750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954172.1"
                     /translation="METTHFSRKLPLWYQACESIRAEIYNRLRTSELRLPPESQLAEE
                     HGVSLITVRQALTVLESEGLITRTRRRGTVINPLEAQPRKEMKVLGTLATVFNHDSAA
                     ELDLLEKLLVVTPEDLKATFRDATHLTYMRRLRHDKNGPINYAVNYMLPEFGENITEA
                     DMQKMPIPRILRDKFNVNVMRIDYSASAMEASADIASHLRVPPKSAILNLVATVFDHT
                     ERVVDVGRIYCPAGKFSFDISIDMS"
     gene            76719..77021
                     /locus_tag="CNE_RS37060"
                     /old_locus_tag="CNE_BB2p00760"
     CDS             76719..77021
                     /locus_tag="CNE_RS37060"
                     /old_locus_tag="CNE_BB2p00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013954173.1"
                     /translation="MSKGNVVLVVNCRIKPGKVEELMAALNANAEAARTTEPGCLQFD
                     VLVDPEDPTRIMYYEVYRDQAAIEAHAQTAHHKTWYTVGPPMLDVRERSDFIRVAP"
     gene            77112..79646
                     /locus_tag="CNE_RS38870"
                     /old_locus_tag="CNE_BB2p00770"
     CDS             77112..79646
                     /locus_tag="CNE_RS38870"
                     /old_locus_tag="CNE_BB2p00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954174.1"
                     /translation="MRPMASSGTQGASAGRRSVSKDQDIRAWYPAACQRAQQMLQAQN
                     WDHARQLFEAIDARLPPARAFERAVVLERIGQCLLAASRFDAAMPKLHAALTLAQRLA
                     PARAVGRLVYLLHAALGDGFRALGDVEQARQSYEAALAAARNAGDAGFVAQAWHRLGK
                     FDASLQRDAEASLSYAQAASAFRALGDLARAAQVLGEKGACLARAARPAEAITCYREA
                     LDLDARAVPSRRQLQHTCALARLLVGSAPAADIRGLVQHALDATSVLDPDAPEIWHAF
                     GVLADMAGIQADAASDAATASALRAEYLLFQGLHLRVPQLFATLASLGEGKSFGAAVV
                     LGRLGHSLWLAHRLEQSVRFLEQALATLAQAPEGASRMGLAAMLQRDLGDALLALDRP
                     AAACHAYEAGLAACKATQDVAGQSALRDRLADAARGAGAPAATAEAAVPAPGPMPESA
                     GFRLTMIDETAVSYVFDSGLLIDGVPESRQATWTPAGGASDGALCPTLVPFARSWADG
                     DSTTRFALRCEEPAFEPQPGCVLMRATWREVAVAGAVAVLAGLLRAMDGEHTVAQLLN
                     RLPPPDRCVGDALLRALADAGVIDLSGRAAGRLLHTLTKKGVLPGGGLDRDAVLHLAT
                     DGGHRAYPGAPRTTLGRSIPAELEAFHAITRARRSQRAYTGLPVARQPFDALLQIACG
                     ATGILTGASRDATLRAYPSSGGLYAVEIYPVILNVEGLPAAIYHLCPDEGELECVRPL
                     LRERLIEAMLPAEREMISGCAALICLTGYFPRHECKYGEGGYRMLVAESGHLSQNLIL
                     AATALGLSARPFGGVFDRLVNEVLGLEPSKEQFLLAVALGRVTPTP"
     gene            <79951..>80402
                     /locus_tag="CNE_RS40445"
                     /pseudo
     CDS             <79951..>80402
                     /locus_tag="CNE_RS40445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959003.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing start and stop; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            80559..81545
                     /locus_tag="CNE_RS37070"
                     /old_locus_tag="CNE_BB2p00800"
     CDS             80559..81545
                     /locus_tag="CNE_RS37070"
                     /old_locus_tag="CNE_BB2p00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954177.1"
                     /translation="MKGIKETTFRLLCAGGLAPALLISSAVWASGYPVKPVTLIVPQA
                     PGGANDAVARIVAQRLGAVLGQPIVVDNRPGAGGNIGIQVAAKAPHDGYTLLLTVGSS
                     FTINPSLYRKIPFDPVKDFEPITLMATAPYLLVTNPAIQARSVQDLIGLARSKPGKLD
                     YASAGNGTLNHLLGEMLKAKAGIDITHVPYKSAAAAATDVVAGQVPITFGSLPGVMPF
                     VKTGQLRVLGVATEKRSRLIPEVPTIGEAIPGYSAISWYGLLAPAGTPKEILAQLHAD
                     ATKVLNSKDVQDKLAAQGAEAASNTPEQFRALIKEDLVKWAKVVKDSGAQVD"
     gene            81829..82242
                     /locus_tag="CNE_RS37075"
                     /old_locus_tag="CNE_BB2p00810"
     CDS             81829..82242
                     /locus_tag="CNE_RS37075"
                     /old_locus_tag="CNE_BB2p00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_013954178.1"
                     /translation="MTARVTINANTTSTPYTVTISDGQGHQWLADEPAEVGGADAGPS
                     PGHLTLSSLGACTLITLQMFAARKEWPLMGVAVELELNPDGKPAAGGTVIRRNISLTG
                     ALNAEQQERLLQVADACPMHKLLTGEVRIDTLLVP"
     gene            82242..83084
                     /locus_tag="CNE_RS37080"
                     /old_locus_tag="CNE_BB2p00820"
     CDS             82242..83084
                     /locus_tag="CNE_RS37080"
                     /old_locus_tag="CNE_BB2p00820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VacJ-like lipoprotein"
                     /protein_id="WP_013954179.1"
                     /translation="MQTTRLLTAAAAAALLAGCATGPTANPRDPLEPFNREVSRINED
                     FDKGVLRPVAQLYADYIPTPAQRAVENFFSNVSDVYSAGNNLLQGKPSRAAEDTMRVA
                     VNSVLGLGGLIDIATPAGLPKYKEDFGQTLGLWGVPAGPYLVLPLFGPSTVRDTGGML
                     VDRQFDPSAYIYPVSLRNSLVGVRIVAGRAQLLGATSLIEQAALDKYAFMRDAYLQRR
                     EYQIYDGNPPSRQDEAEAEAAPAAAPAESGKPAEETPAEVKQGSPSLPVPTTIVPPAI
                     RFGR"
     gene            complement(83139..84125)
                     /locus_tag="CNE_RS40450"
                     /old_locus_tag="CNE_BB2p00830"
     CDS             complement(83139..84125)
                     /locus_tag="CNE_RS40450"
                     /old_locus_tag="CNE_BB2p00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954180.1"
                     /translation="MTPRRLHLNSHSNAARNVMKKRAAVAGRKSGPFACRELELDDPR
                     PDEVLVRAELRHQLHPSRRPCKPLWQSLAAAWLAVGGLLGTASHRAYAGQICDAPYIH
                     DGGRIRFEADGLTPMTTLAFFRNVNDLERDLCSLDLDIYSKSALRRLMGPPVETVQRH
                     RLVIDERSGQPVVRSLNARVQAHGQYTELVGEMSTNSNGLLLYPPALVEGQVLPAETF
                     LSRYDFRIVDRHTGTKVSDFVGSNVRLTLSERTVGPLQRLKIATGTLLCWPIRYTKFV
                     DPGRFRLVDTDIELEPTVLDMIDWYCPARRFVMRQEVRYGNQHQVVDVVEIE"
     gene            84385..84747
                     /locus_tag="CNE_RS40455"
                     /old_locus_tag="CNE_BB2p00840"
     CDS             84385..84747
                     /locus_tag="CNE_RS40455"
                     /old_locus_tag="CNE_BB2p00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954181.1"
                     /translation="MMLKKVLKTVLVATVATAGAVSPAFAQSNKSDSNSVHTNGGRSG
                     AADPYTDGAKVGKADPYTDGTKSGKFDPYTDGARKSTKSNLKPSESAAKVGDPRSPYT
                     DGAKSGKADPFTDGAKKR"
     gene            85100..85663
                     /locus_tag="CNE_RS37090"
                     /old_locus_tag="CNE_BB2p00850"
     CDS             85100..85663
                     /locus_tag="CNE_RS37090"
                     /old_locus_tag="CNE_BB2p00850"
                     /EC_number="1.6.99.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent oxidoreductase"
                     /protein_id="WP_013954182.1"
                     /translation="MIKILGISGSLRAQSYNTALLRAARAEADAHVRLDIGTLHGIPL
                     YDADLEAREGLPAAVVALREQVMASDGLILATPEYNNGIPGVFKNAIDWLSRPASDIP
                     AVFGNRPVAVLGASAGGFGTVLAQNDWLPVLKTLGTRHYSGSRLLVARAGQVFDAQGE
                     LTDVGMRARLKEFLAGFVAFVEGARAV"
     gene            complement(85670..86248)
                     /locus_tag="CNE_RS37095"
                     /old_locus_tag="CNE_BB2p00860"
     CDS             complement(85670..86248)
                     /locus_tag="CNE_RS37095"
                     /old_locus_tag="CNE_BB2p00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013954183.1"
                     /translation="MYDNQRASHIHWGKRQGRVDPNGRTNPRKSKMDEFNLDELIYNK
                     PGHLIRRLHQIATSVFHEETDGFDTTPVQYAALAAVRAYPGIDQLRLANAIGFDRTTI
                     AGVVERLEGKGLISRSPGIADRRTKLLSLTATGAALLQGIYPGTERAQARTLAGLDQA
                     ERALFVAMLQRVVAANNETSRVPVSPPPARVA"
     gene            86275..87357
                     /locus_tag="CNE_RS37100"
                     /old_locus_tag="CNE_BB2p00870"
     CDS             86275..87357
                     /locus_tag="CNE_RS37100"
                     /old_locus_tag="CNE_BB2p00870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gentisate 1,2-dioxygenase"
                     /protein_id="WP_013954184.1"
                     /translation="MQMINQTIPSNTEDRHAGETASLPEEFRAALRDHALAPLWDFLK
                     AALPHGRPAGVTRPHRWRYADVRPLLLEAGRLVPVAQAERRVIVLSDPGRGPNAMSAT
                     GTLYAGIQLLLPGETAPTHRHSPSAARIVIEGRGGFTVVNGQRCEMERGDIILTPGGQ
                     WHDHGHDGEGPVTWLDVLDLPVFTAAESAYAEGGHDGCNAEEPLMTLTSELLRQGLRP
                     PRAWRCENPYPMLRYPWQTARAALERLAAATGQACAELAYVNPENGQDCLPVLGFTAM
                     MIGPDQHWQAVPTSASTVFHVVEGSGESRVDDHVFDWSAGDTFSATTFASVSHRATPG
                     QPAFLIRVDDAPLQKKLGFFQERQLA"
     gene            87392..88258
                     /locus_tag="CNE_RS37105"
                     /old_locus_tag="CNE_BB2p00880"
     CDS             87392..88258
                     /locus_tag="CNE_RS37105"
                     /old_locus_tag="CNE_BB2p00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="WP_013954185.1"
                     /translation="MRFCRFQDDRGERLGIVEDHFVADISPVVEMLPSHRWPFPPGDP
                     LVAHLQLIREHAPRLLDAAPRRALSAVRLLSPVANPSKLAAAPVNYLSHLAEAQADPA
                     TFHAHQLQRIQEVGLFLKASSSLAGPGEGVALRHTDRRNDHELELAVVIGRTADRVSV
                     ERAMDYVAGYAIGLDMTVRGPQERSLRKSIDSYSVLGPWLVTADEIADPANLELELRV
                     NGELRQRANTRDLVVGIPQLIAWASSYYTLHPGDVIYTGTPDGVGPVVPGDLIEASIE
                     GIGAMRVPVRAA"
     gene            88281..89492
                     /locus_tag="CNE_RS37110"
                     /old_locus_tag="CNE_BB2p00890"
     CDS             88281..89492
                     /locus_tag="CNE_RS37110"
                     /old_locus_tag="CNE_BB2p00890"
                     /EC_number="1.14.13.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybenzoate 6-hydroxylase"
                     /protein_id="WP_013954186.1"
                     /translation="MNDSNKIQTLIVGGGIGGLATALALAQSGRTAHVLERAAQFSEV
                     GAGLQLAPNASRMLDRLGVLDAVWQSAVFPRQLVWMDAMSGRRLTALDLGASFRHAYG
                     YPYLVMHRSDLLAALLAACQRDARITLETSRDVVAVQDMGDGAEVRCADGSVYRCQAL
                     IGADGLHSTVRRMIADDGAPVCSEYVAYRGTLPIENMPEHAGLDNVVMWTGHAMHLVQ
                     YPVRRGELYNQVAVFRSDRFDPSTDDWGTVDELEARFANACAPVRDAISLIHTNRRWP
                     MYDRDPIADWTRNRIALLGDAAHPMLQYLAQGAAQAIEDAGTLADALTRHASDVPGGL
                     LAYQEARRLRTARVQLTARWFGDFIHLGHMGAEVRNALLSAREDDSFAPVDWLYAPRA
                     IATDAAMTGRV"
     gene            89497..90837
                     /locus_tag="CNE_RS37115"
                     /old_locus_tag="CNE_BB2p00900"
     CDS             89497..90837
                     /locus_tag="CNE_RS37115"
                     /old_locus_tag="CNE_BB2p00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954187.1"
                     /translation="MSAMNDTLAAPQPAVGAMLRGRPMSRYQRIVIGICIAINVLDGF
                     DALASAFTAPAVAAQWQLPAALLGMLLSASVAGMALGSVLIAPLGDKLGRRPIVLGCL
                     AMIGTAMLASAFAANVWQLAGLRLVTGLGVGGIIAGINTLVAEYASDRRRDLALSMTT
                     VGYAVGAICGGAASGLLVGSYGWRSVFLVGGLLSVLMVPVAFAWLPESLDFLAGKQPG
                     NALARLNQVLHKAGVAPLQTLPPQGEQARQGSAWRSLFHPDFRRLTLLACACYLLVML
                     TNYFLLSWMPKLLVDMGMSMEQGISGAVIMNLSGVAGGIALGWSAGRYGLRAMSVIYL
                     CLCFLSVAWFGSLSAAPGHVLAVSAVIGFLITGAVASLNALSPRVFPPAVRATGTGLA
                     LGFGRLGGTAGPWLAGVLIQAGWSRTQFSIVLATPLLAAAVLFTLALAKERSTA"
     gene            90965..91960
                     /locus_tag="CNE_RS37120"
                     /old_locus_tag="CNE_BB2p00910"
     CDS             90965..91960
                     /locus_tag="CNE_RS37120"
                     /old_locus_tag="CNE_BB2p00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954188.1"
                     /translation="MQEGISLWEAAKREMDDYQFVAGAELQPKWEVPSEIAINVAVSG
                     RFSDSQEEGHPTSIEAYVDAASEVIEAGACGVHIDFSMVTDRQGRRLDRDVPPVEAYG
                     AVLRPLRDRFGHEFVANLNVLNGSTFDICMSPARAGLAEVAPCAAGHPDAFMVPAVRT
                     LEEHGVKPEIVIHSSGEIELAKRKLIDTGILKGPYNWIILYGLPFNVGRTLISGTWAS
                     NAQDMARHMFMMVDQIRQIDPASVITVCAAGRSTLYMTTLATMMGLNIRVGTEDTPWK
                     YPNSDVRLRDNLEMFRMARDIAELHGRRPASADAYRRMIGKPARAGMATAAQVPA"
     gene            91957..92682
                     /locus_tag="CNE_RS37125"
                     /old_locus_tag="CNE_BB2p00920"
     CDS             91957..92682
                     /locus_tag="CNE_RS37125"
                     /old_locus_tag="CNE_BB2p00920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954189.1"
                     /translation="MTSRPLDGFRSGAPDPAVWQVLEMPMPDGGMWRYEEPGARVQAE
                     GGVLEMQVDRFTRQHARIPMFDNPKHFLVMREALTIAEGGVLTIGCEMACENHNGNPD
                     DLFDGFAGFNVCDLANGMVFDFIISGTQIGVVHERLPIPGVTPAGGDWLHVVQSPLLA
                     QNHPGEFHRYEITIDRSARTCTWHVDDRRMYAVRNIAVDIGSVVVALGLFTLKPAVAG
                     VGSVSNHGQGASGRWRNLWVRAA"
     gene            92723..93715
                     /locus_tag="CNE_RS37130"
                     /old_locus_tag="CNE_BB2p00930"
     CDS             92723..93715
                     /locus_tag="CNE_RS37130"
                     /old_locus_tag="CNE_BB2p00930"
                     /EC_number="4.1.1.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4,5-dihydroxyphthalate decarboxylase"
                     /protein_id="WP_013954190.1"
                     /translation="MSKLNLSLAIGDYDRTRALLDGRVPIDGVDPVFLALDPEEIFFR
                     AFRHAEFDICELSLSSFTVKTARESCPYVGVPVFLSRAFRHTAIYIRTDRGIREPADL
                     RGKRVGVPEYQLTACVWVRAMLEEDYGVRPSELQWIRGGQEQPGRVEKIELALPADVR
                     LESAPDGATLNAMLAAGEIDALIAPRPPSCWVQGHPGVGRLFSDPVQAASDYFRRTGI
                     FPIMHLLGVRRELVHAHPWLPGALLKAFERAKAVAMSSLAEIAASAITLPLAQETMQS
                     MQGLMGQDYWSYGAAQNLHTLDAFLQYHHAQGLSPRRVRVEELLHPSTLEVHRV"
     gene            complement(93733..94260)
                     /locus_tag="CNE_RS37135"
                     /old_locus_tag="CNE_BB2p00940"
     CDS             complement(93733..94260)
                     /locus_tag="CNE_RS37135"
                     /old_locus_tag="CNE_BB2p00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013954191.1"
                     /translation="MATSRTKPTTKASKPEPAGAHPPVFDVGGRSIAWHVRDLHRLFT
                     SHLQALMTDEGASVGHWYYLRVLSEQTGLTQLELSRRVGLAATTSVPALDSMEKQGLV
                     KRVRDTEDRRRSFVFITEQGRALVERLMPAITALLEHAVDGVSERELKSFLKVMVRIQ
                     ENLLTAAPSLSEVND"
     gene            94401..95477
                     /locus_tag="CNE_RS37140"
                     /old_locus_tag="CNE_BB2p00950"
     CDS             94401..95477
                     /locus_tag="CNE_RS37140"
                     /old_locus_tag="CNE_BB2p00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954192.1"
                     /translation="MKDNRFGPAPGDGAVAGQGELWTRDGFNGTCSMVLRPHYAPAYL
                     SAHGPHAPRHFQLDKLAMSHGDDALAMPVPVASSRKGVQLSAALQDQEAPIVVRNVEA
                     DELHFVHRGEVRFETDCGVLDAQAGDFVCIPRSVAYRTTPQGGPAWRFIVESPSPLRL
                     NPQTPSGMINFARDVHYARVEPQQDDHAPTEVTLVLKAEDGPTVFRLAQDPLRAVAHV
                     YGNVPVWKVNLANVQVGTYLPHGGPPFQFITSDDGEIMIYTLCARTTQRPPIHVNADF
                     DEVILYHAGPGAWGDVSEPGTVSWVPKGVIHQGPSEDVPQGYQAWLLETRPTLRLTPV
                     ALEASALLDTREYGIHPSELAMQR"
     gene            95545..97194
                     /locus_tag="CNE_RS37145"
                     /old_locus_tag="CNE_BB2p00960"
     CDS             95545..97194
                     /locus_tag="CNE_RS37145"
                     /old_locus_tag="CNE_BB2p00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1302 domain-containing protein"
                     /protein_id="WP_013954193.1"
                     /translation="MNANTFQARAAGALALALCAQPAPPAHAFQIPTDNEDLTIRWDN
                     TIKYSVAQRLKDRSPTLTADANADDGDRNFRRWGLISNRVDLLSEFDVSYRNFGVRVS
                     GAAWYDDVYNRGNDNDSVATANAASVPHDRFPGGTRTINGRNVELLDAFAFGKVEVSG
                     MPVSVRLGQHSVLYGESLFFGNNGIAAAQSPIDLVKLLSVPNTQFKELIRPVPQVSGQ
                     VQVTPNLAVGGYYQFDWERNRLPGVGSYFSAVDILDAGGERILAGPGAYFSRTGDIKA
                     KSSGQGGVQLRYRPRGLDAEFGLYAANFHAKDPVVYTSFAGQDLAAGKLGQYQLVFPE
                     DIKVIGTSFSTTLGTANVAGELSYRHNMPLVARGGSVFVPPGMSANNAGNPLYPVGDT
                     LHGQISWINLLSPTALWEGGSIVGEIAWNRRLGVSRNGGALDPNATRDAGAIRMVFQP
                     AYYQVINGLDINVPIGIGYGLFGKSSVLNPGFGVHRGGDLSVGVNGVYEQVWNIGLNY
                     THYFGPAATVLTPPNAASQAYSYGQTFKDRDFVSLTIQRAF"
     gene            97212..98594
                     /locus_tag="CNE_RS37150"
                     /old_locus_tag="CNE_BB2p00970"
     CDS             97212..98594
                     /locus_tag="CNE_RS37150"
                     /old_locus_tag="CNE_BB2p00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1329 domain-containing protein"
                     /protein_id="WP_013954194.1"
                     /translation="MKPFSIVTIVTPWLAAAMLAAQPAQAMVSAQEAAALKSTLTPFG
                     AERAGNKDGSIPAWTGGHTQMPPNYKSGDPPPDLFAADKPLLKIDAKNAAQYADKLSE
                     GVKGLLKKYPDTFRLDVYPTRRTAAAPQWVYDNTFQNATRARTTDNGLWVEGAYGGIP
                     FPIPKNGNEAMWNHKLQWTGETVSSYFVNYVGTPDGKLIMATKGYNKSQYPYYEKGGA
                     MDKFTGESQQLRIFTTEPPLKAGSQFLLVDAVNRPRQAWEYLTGQRRVRKAPTLGYDT
                     PDDINSGQSYFDEAFVFLGELDRYNWKLVGKKEIYIPYNNNKVYQKGLSLEQLLLPHH
                     ANPDSMRWELHRVWVVEAELAPGKRHVVPKRRLYLDEDTWAAVLGEGWDAQGQLWRVQ
                     VAMPYVVPEGPFVNATSSWCIYNLLSGAYLAAAFPDYGSPGFRYHYKLLDRIPSSYFS
                     PEALAGEGVR"
     gene            98605..99690
                     /locus_tag="CNE_RS37155"
                     /old_locus_tag="CNE_BB2p00980"
     CDS             98605..99690
                     /locus_tag="CNE_RS37155"
                     /old_locus_tag="CNE_BB2p00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013954195.1"
                     /translation="MVHVETNAMFACMKTPRRRGAGRLALLLAGAATAAALVQGAAAA
                     EPVRAFRHDAALVGVASAGTRLVAVGERGTVVLSDDGSRNWRHASAPTDVTLTSVHFA
                     TPREGWATGHAGTVLHTADGGLTWSRQLDGEAAARLMLAAAGKDPARRAEAQQLVEDG
                     PDKPFLDLYTADASTALVVGAFNLAFRTTDGGRRWVPWQDRIPNPKSLHLYGIAGAGR
                     DLYIAGEQGLLLRSADAGETFRPLASPYRGTFFGVLVQTDGGVIVYGLRGNAFRSTDQ
                     GANWSRLALGTTAAITGGVALADGRTALATQAGELFVSEPVRPEAFVRVVPDHTQPFA
                     GAAQQGDRIVLVGARGSSAAPATAGRQ"
     gene            99712..102153
                     /locus_tag="CNE_RS37160"
                     /old_locus_tag="CNE_BB2p00990"
     CDS             99712..102153
                     /locus_tag="CNE_RS37160"
                     /old_locus_tag="CNE_BB2p00990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_013954196.1"
                     /translation="MHQKQSKAGQADWQVVPHIQDFDAGSGSVVERLIFNHRAWIVAL
                     CVIVTMLLGWQAMRVRLNADFEKMIPAAHPYIQNYLQSKADLSGQGNSVRVAVETREG
                     TIFDAGYLDRLKTINDELFLIPGVDRAYQKSLWTANTRWLGVTEEGLEGGTVIPDDYD
                     GSTRTVEQVRRNVERSGEIGQLVAGNYRSSIIFLPLLERDPGDGQALDYKRFSDALEA
                     VRQKYETRDIRIHVTGFAKVMGDLITGIGEVMVFFALAVVIAAAAVLWYTRCLRSMLL
                     VVLTSLLAVFWQLGLLPLLGYALDPYSVLVPFLVFAIGMSHGAQKMNGIMQDIGRGMH
                     RLVAARYTFRRLFMAGLSALLCDAVGFAVLLVIRIPVIQELAVVASLGVAILIFTNLV
                     LLPVLLSYTGVDAKAATRALRSQDTPAQAGGPWRFLERFTTARWALAALLPAAVLGLG
                     GYLVSQHLQVGDLDEGAPELRADSRYNRDDRFMTANYAASSDLLVVMVRTPDGHCADY
                     ATLRQVDALEWQLRQLPGVEGTNSLALLARRVVAGMAEGSPKWYELVQNQATLNTAAN
                     RSPRESFNQACNLLSLYVYLQDHRAETLARVVSAVEAFATTHDSQHARFMLAAGSAGI
                     EAATNIVVRQASREMLFWVYGAVIVLCMLTFRSWRAAVCAVVPLVLTSVLAEALMVAL
                     GLGVKVATLPVIALGVGIGVDYALYIMTIVLAELRAGASLPQAYRRALRFTGKVVMLT
                     GVTLAIAVATWTLSPIKFQADMGVLLAFMFLWNMLGALILLPALAWVLLPEGRAGRSP
                     VPVDAIADGASGARH"
     gene            102189..103100
                     /locus_tag="CNE_RS37165"
                     /old_locus_tag="CNE_BB2p01000"
     CDS             102189..103100
                     /locus_tag="CNE_RS37165"
                     /old_locus_tag="CNE_BB2p01000"
                     /EC_number="1.7.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H azoreductase AzoB"
                     /protein_id="WP_013954197.1"
                     /translation="MKVMVTGGTGTTGSQVVRELLARGVQVKILTRSAERAKAISPRV
                     EAVVGDLLSPSDLRPAFEDIDALFLLLAGVPSEAHEGLTAVALARAAGVKRIVYLSVH
                     QTARPPRHVPHIGSKLLIESVIRDCGVPYTFLRPNVFMQNDYWYRDALLGHAIYPQPL
                     GDLGASLCDVRDIAEAAAIVLTTDGHDGQAYTIAGPEPFTGKRAAALWSAVLGKAIAY
                     GGHDMERWEQQQLTHGAPQWFALDLKMMFTAWQTDGLVATDEELGRLASLLGHSPRCY
                     EDFVAETASGWPVGQSQIAAFEGRTFS"
     gene            103125..103847
                     /locus_tag="CNE_RS37170"
                     /old_locus_tag="CNE_BB2p01010"
     CDS             103125..103847
                     /locus_tag="CNE_RS37170"
                     /old_locus_tag="CNE_BB2p01010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954198.1"
                     /translation="MPTTILDPFHSGKPAPETWRTLELPTGDGATWTFRDPGLRMKAS
                     DGVLQASIQTFRIRHDQVQMFDNPKLLMVMQKPVPLSETDVTTISWEMACENHNGNSD
                     DLLDGFAVLSLGDFKTGMVFDFIMSGKCIGVVYERLALPGIVPTGEDWIHVVQSPLMA
                     QSRPGEFHRYEIRFDRRARACEWWLDGKRMYAVADIPVEVHSVTPGVGLMTLKPLEAG
                     KSSVSNHGQGATGRWRNLAVHG"
     gene            104262..104822
                     /locus_tag="CNE_RS37175"
                     /old_locus_tag="CNE_BB2p01020"
     CDS             104262..104822
                     /locus_tag="CNE_RS37175"
                     /old_locus_tag="CNE_BB2p01020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_013954199.1"
                     /translation="MELGLKGRVAVITGASKGVGKGVARALAAEGVNIVLVARGREAL
                     VQAAEDIEETFSVHALPVEADVTDTASVRAAAETVREHFGAAHILVNNAGAAIKRQDR
                     EITWDDSDWINQVQIKSVGALRMIREFLPLMPHDGTGRIINIAGASGSMAWMPALTYG
                     LNNAALMHVTGYLAADLADAWPWCAC"
     gene            <104804..105975
                     /locus_tag="CNE_RS37180"
                     /pseudo
     CDS             <104804..105975
                     /locus_tag="CNE_RS37180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012322500.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing start; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
     gene            106372..>106641
                     /locus_tag="CNE_RS37185"
                     /pseudo
     CDS             106372..>106641
                     /locus_tag="CNE_RS37185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959008.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            complement(106724..107227)
                     /locus_tag="CNE_RS37190"
                     /old_locus_tag="CNE_BB2p01060"
     CDS             complement(106724..107227)
                     /locus_tag="CNE_RS37190"
                     /old_locus_tag="CNE_BB2p01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prop effector"
                     /protein_id="WP_041229381.1"
                     /translation="MGFEQLAALKAQLAAQAKAEKAAKAAEVPKRATPPRARDAAPAN
                     SAKPVDPVVHTIARLQRRFPQAFPKNPAPKVPLKIGLFEDLLPHAQKLALTEAELREA
                     IKTWCRGARYWACLIEGASRMDLAGQEAGQVRPEDAKRAQQLQARRSPGAPSKSAKAS
                     HPVDAAR"
     gene            complement(107341..108451)
                     /locus_tag="CNE_RS37195"
                     /pseudo
     CDS             complement(107341..108451)
                     /locus_tag="CNE_RS37195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004637351.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            complement(108598..109953)
                     /locus_tag="CNE_RS37200"
                     /old_locus_tag="CNE_BB2p01100"
     CDS             complement(108598..109953)
                     /locus_tag="CNE_RS37200"
                     /old_locus_tag="CNE_BB2p01100"
                     /EC_number="6.3.4.14"
                     /EC_number="6.4.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase"
                     /protein_id="WP_013954204.1"
                     /translation="MQTVLIANRGAVAARVQRTLRRMGLRSVVVYSEADRDLPYVAEA
                     DAAYCIGPSPAAQSYLNEGALFDAMRRSGADAVHPGYGFLSENAGFASRVEAAGLTFI
                     GPSPRWIDAMGHKTRARDLMAKHGMPMCRSSGIVDDDPAAIRAAGAAVGYPVLVKPAG
                     GGGGIGMIAAHDDAELVDAVGRARALAQRSFGNGDVYLEQLFQRPRHIEFQIVGDRHG
                     NVQHLLERDCSVQRRHQKVIEEACAPGLPPGEADEIAARVARLLGKLGYDVIGTVEML
                     RSADGSYSFLEMNTRLQVEHAVTEAITGLDLVEAQIRLAAGETLRDVLPSPVRASGHA
                     IELRIYAEDPVRFFPSPGTLQTFRLPSGTGIRVETGYAEGNTVSPYYDPMIAKLIINA
                     ADRQAAIEIAERALAVTEIIGVKTNIPLLQRMLAFPAWRVGELHTGLVQDLLACGEAR
                     M"
     gene            complement(109973..111505)
                     /locus_tag="CNE_RS37205"
                     /old_locus_tag="CNE_BB2p01110"
     CDS             complement(109973..111505)
                     /locus_tag="CNE_RS37205"
                     /old_locus_tag="CNE_BB2p01110"
                     /EC_number="2.1.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006966590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA carboxyltransferase"
                     /protein_id="WP_013954205.1"
                     /translation="MAFETLISELAERESRARQMGGPEKLAKRKADGVLNARERIDYL
                     ADPGSFLESGLLATSYRPDDRDRSPADGKIAGYARIDGRDVALVSNDFTVLGASSSTV
                     NGNKIGHMKTVATRRGLPMVFLGESTGARMPDTMGARGIGSGDRPTQYMRTRETPWTS
                     AVLGHCYGSSSWYAALADFAVMRKGAVMAVSSVKLTSIAIGEEVDPEALGGWETLTGV
                     SGLVDMAVDSDEEALDAVKRFLSYLPSHHNEAPPVYPVPPGSGAQAHRILDIVPESRT
                     RVYDVRKVIPLIVDLDSMFEVKARYGKSVVTALARIDGRSVGIIANNPIAKGGAIDVD
                     ACNKATSFMVMCDSFNIPLVFLTDQPGFLIGIEGERRGAVGRVMNWMNALSLVTVPKI
                     AIIMRKTYGQAVLNMGGAGNADELIAWVSAEVNFMDPRSGVTIVHGVRQQDDPERYAT
                     LLQGMERDTSAWDMGAAYAAHMVINPVDTRATLTRLLEVHRMRLTGGVGQHLMRAWPT
                     SY"
     gene            complement(111522..112553)
                     /locus_tag="CNE_RS37210"
                     /old_locus_tag="CNE_BB2p01120"
     CDS             complement(111522..112553)
                     /locus_tag="CNE_RS37210"
                     /old_locus_tag="CNE_BB2p01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954206.1"
                     /translation="MGQRTARGKTPRWPSTPEHIRRQPMKRRSWCITALLLACLPAGQ
                     AVAHDWPAKPIRLVVPYAPGGTNDRLAREYAEFLRKKLSQAVLVENRPGASTNIGSEL
                     VAKAEPDGYTFLIGIDGLATNPYTGPVPPFNAQKDLLPISLLTRVPCLIAANNQFAAA
                     NVADMISLARTHPDRYSISSAALVLQVGLLNSGSKIRLTHVPYKGGAQAAGDAMGGQV
                     DMVIANVPVLAPFVRGGKLRPLAVTSATRSAAFPEVPTLKESGMSDAVFSNWYGVFAP
                     AGTPEPVISRMAALSRQFVTDPAVSKQLSSEGYQLEASTPAELATLIHTDAAAASRFV
                     AANPALFRK"
     gene            complement(112571..113605)
                     /locus_tag="CNE_RS38875"
                     /old_locus_tag="CNE_BB2p01130"
     CDS             complement(112571..113605)
                     /locus_tag="CNE_RS38875"
                     /old_locus_tag="CNE_BB2p01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954207.1"
                     /translation="MGAPALGMPLPRLDKGRITASHVVRWCAAQENWDRIHYDRAYAR
                     EVAGLPDAVINGALKQQFLAQLATAAFGERCWLWRLACRFRSPDLVGQHLRAEGCVRA
                     VERQAQATAVHLDQHLFNVDTARVTTDGTAVVLLPVNGADAPDALPGAYHDAGDAEDA
                     PPSAAAPLDTSVPAPIRRRIGSEIERIVSFSPVEAGRLRLFAEAVMDLPHWHHDPQAA
                     RTSVHRGLVAPPLFPIHAMSWPAGAHPLGTAPDALGREAVCEVGRDFSRRFGLPPQGL
                     LNGGTRVRIHALARPDDTVQASCRLRDVRYRVGTSGAPMLIFETENRYDTTDGRLLLH
                     ERQTTLQRLA"
     gene            complement(113695..115275)
                     /locus_tag="CNE_RS37225"
                     /old_locus_tag="CNE_BB2p01140"
     CDS             complement(113695..115275)
                     /locus_tag="CNE_RS37225"
                     /old_locus_tag="CNE_BB2p01140"
                     /EC_number="6.4.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionyl-CoA carboxylase"
                     /protein_id="WP_013954208.1"
                     /translation="MDMTQSIPSEDLLELERRRELALGLGGPEAIERHHAAGKLTIRE
                     RIDALSDKSSFHEVGRLTGQGHYDENGVLVKVTPAPYVMGLATVDGRPVAIGGEDYTV
                     RGGASWSGDRKKGGQGGFVEDLALNYKIPLINLIDGVGGSVTSAQRRGHTVFPGVHGF
                     ETSAALLGQVPVVCAVLGTAAGGPAGRTILSHWSVMVNGTSQIFAAGPPVVKRSLGQD
                     ISKDDLGGAPIAVDVAGSVDNAVETEADCFALIRRYLSYMPQNVWELPPETPCDDPVD
                     RREEALATIVPSDRRKAYDMRKIVRMVFDRGSVFEIQPTYGKAVITSLTRLNGKVVGV
                     VASNPMAYGGAIDAKAARKQTHFIELCDTFHIPLVFLVDVPGFMVGRDAEAQGTLREG
                     MRSVFVSLQATVPIATVVIRKCYGMAGMAATDKNGLGLKLAWPTAEWGSLPIEGGVAA
                     AFRREIATAPDPVAKEREIEQRLRQLASPFRTAEAFGVEDIIDPRETRQTLSRFIDAA
                     QISLKTTLGPKLRAGVRP"
     gene            complement(115286..115507)
                     /locus_tag="CNE_RS37230"
                     /old_locus_tag="CNE_BB2p01150"
     CDS             complement(115286..115507)
                     /locus_tag="CNE_RS37230"
                     /old_locus_tag="CNE_BB2p01150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit"
                     /protein_id="WP_013954209.1"
                     /translation="MSVKVKSEVVGSVWKCECETGQTVGEGDVLFIIESMKMEIPVEA
                     THAGTVSEVLVKEGESIAEGQLLAVVDPA"
     gene            complement(115566..116789)
                     /locus_tag="CNE_RS37235"
                     /old_locus_tag="CNE_BB2p01160"
     CDS             complement(115566..116789)
                     /locus_tag="CNE_RS37235"
                     /old_locus_tag="CNE_BB2p01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013954210.1"
                     /translation="MPPSERIQPLSGYTVIELGSTVAGPFCGRLLADFGATVIKVEVA
                     EGDALRSMGSHKDGISLYALSIFRNKELISVDLRTEEGQALLRGLIDKADFVVENFRP
                     GTLERWGLSYETLSATNPGLIVVRISGYGQDGPYSQRPGYGVIGEAISGLRSITGDPD
                     RPPARVATSLSDYLTGLYGAFGALLALEARHRTGRGQVVDTALAECAFSFMEPHVMAY
                     DQLGVVAQRAGSRLPGSSPNNLYQSADGCHVHVAALADPIFRRLCVAMGQPDLADDLR
                     YATNLMRSRHSDEVDSAVQAWIGAHDYDEIHRRLGEHDIPHAKIYNIDDVFADPHFAA
                     RDSIQRRPHDRLGMVALPNVTPRLSDTPGEVRGLGRDTGADTAAVLARMLGLAPDALA
                     ALQRSGVIYDAGMAR"
     gene            complement(116810..117805)
                     /locus_tag="CNE_RS37240"
                     /old_locus_tag="CNE_BB2p01170"
     CDS             complement(116810..117805)
                     /locus_tag="CNE_RS37240"
                     /old_locus_tag="CNE_BB2p01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954211.1"
                     /translation="MLSSIHRALSAAALALAGLAFTAAPLHAQDKYPNRPIKMYVGFS
                     AGSATDIVARVVAQYLSERLGQSIVVENKTGVGGSLAAEAVARSAPDGYTLLTVSSAI
                     AVNPAVYPKLSFNIEKDLTPIALVGRLPTVLLVRNGFPAKSLTEFLTYARSHPKKINY
                     GSSGVGGSTHLSTEYLATLTGTSFTHVPYRGNSQAVAALLGGEIDMVTDTILLAAPNI
                     QARRVRALAISSQARSPLAPDVPTFAEAGLKGYDGSLFFGLMGPKNLPPEIVSRINRE
                     LNDLLKNSAELRERLQSAGGLELVGGSPDQFRDTLHKEVTLWADVVKNAHVTVAQ"
     gene            complement(117873..118583)
                     /locus_tag="CNE_RS37245"
                     /old_locus_tag="CNE_BB2p01180"
     CDS             complement(117873..118583)
                     /locus_tag="CNE_RS37245"
                     /old_locus_tag="CNE_BB2p01180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954212.1"
                     /translation="MGVAERTIRKKAAPELKEAPRPTKSGAGDIADELRARIARHELL
                     PGTKLVEQDLAQEFGTTRPRIREALAALEQRGLVERIPNRGAIVTRISFEQILQIYCA
                     REALEGMSVRLAAQLAPPGEWDDLIELFGAPMEAALDNGDFDFYMEGYDRFRQRIFKN
                     AANPVIQGMLDSILERTQDVIRRAIVLPGRAKLGLAHHRATLAALRERNAEKAESIRR
                     ESLREAAEYLAKYRKYII"
     gene            118902..>119133
                     /locus_tag="CNE_RS40460"
                     /old_locus_tag="CNE_BB2p01190"
                     /pseudo
     CDS             118902..>119133
                     /locus_tag="CNE_RS40460"
                     /old_locus_tag="CNE_BB2p01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018312316.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            119341..119575
                     /locus_tag="CNE_RS37250"
                     /pseudo
     CDS             119341..119575
                     /locus_tag="CNE_RS37250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013958722.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            120048..121004
                     /locus_tag="CNE_RS37255"
                     /old_locus_tag="CNE_BB2p01210"
     CDS             120048..121004
                     /locus_tag="CNE_RS37255"
                     /old_locus_tag="CNE_BB2p01210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954215.1"
                     /translation="MQSEQALRHVLVSKEPTCLVCATGRGRRSLVRDPFYRQCRSVWL
                     IAWLLSGVATVAMAAPGEQPAEASDANVRSSVWFPRGMRLQMEVDGDMPMSRRSTQMA
                     PLPTPSGCQTDLEIQSKTALAALMGPPVITDQQQRVLLRPAANGSPPGITGSGTVNAW
                     ARYTRLYGTTTIDALGLLDYQYRGLPLREGDAVSGATVEASVSFTIYARDSGIEVGKL
                     VAPHATVAVASRRVGKRQVIQTARGPSECVPIHYVRITSVGPMIIAGEQVLSEPSHME
                     VTDWYCPVASVVMRQDITEGHKMQRIDTTAADPLEQTSQASP"
     gene            complement(121147..121389)
                     /locus_tag="CNE_RS40465"
     CDS             complement(121147..121389)
                     /locus_tag="CNE_RS40465"
                     /inference="COORDINATES: protein motif:HMM:PF00589.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569696.1"
                     /translation="MRARGPEWAAQADVLASASAHWLRHTAGSHMTDQQVDLRYVRDN
                     FGHASIATTSGYLHSEEDARHEAIQERHRIGWGAKT"
     gene            complement(121533..122429)
                     /locus_tag="CNE_RS37260"
                     /old_locus_tag="CNE_BB2p01230"
     CDS             complement(121533..122429)
                     /locus_tag="CNE_RS37260"
                     /old_locus_tag="CNE_BB2p01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954217.1"
                     /translation="MQRARLPLLGLRAFEATARHLSVSKAASELCVTPGAVSQQVKLL
                     EDTVGVPLLRRKGRSVELTDAGQVLRPALTQAFQTIELTLNAIARRPRHDTLKLCLLP
                     TLAEKWLMPRLSRFHGAHPEVDIQIMTSFRTIQFEAEDVDMASFTGKDLPTGLEGVRL
                     FDDEFLPVCNPALLQHYKRLAAPRDLARTTLLYSVRRMDDWQRWLALAGAADLRPQRS
                     LSFENSSLAIQAAVDGLGVAVVQRAYVTDLLKAGILVAPFDLVARSENGYYLVWSAAR
                     AASPTFRSFLQWVLKEAGRNAA"
     gene            122539..122916
                     /locus_tag="CNE_RS37265"
                     /old_locus_tag="CNE_BB2p01240"
     CDS             122539..122916
                     /locus_tag="CNE_RS37265"
                     /old_locus_tag="CNE_BB2p01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954218.1"
                     /translation="MNITKYEGGHVGDFAEGLVLQGARILASGEVRFPPPEFLHGEGV
                     VEPLSLGITGRLYTYTTVHPGKAPAYSLAMVDFDYGLRAFGRLVWEGDTAPAIGAVVR
                     AVPFALSDGTSDYAFEPLKGDAA"
     gene            122913..124052
                     /locus_tag="CNE_RS37270"
                     /old_locus_tag="CNE_BB2p01250"
     CDS             122913..124052
                     /locus_tag="CNE_RS37270"
                     /old_locus_tag="CNE_BB2p01250"
                     /EC_number="2.3.1.176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propanoyl-CoA C-acyltransferase"
                     /protein_id="WP_013954219.1"
                     /translation="MKEPLITGVGISDFGRFPHLTEEALAQAAILDALKDAEVPMRDV
                     QAFYCGNALGGHLPGQRALRELGTGGEAVYNIDNACSSGATALNLALQALRAGQYETV
                     VVFGMDHLSGLGGGALPMNQRDWNNRRGMIMPALYAMRAKRYIHDHGIPLETLADVAV
                     KNRRHGMLNPIAKFCREVTREEVLASRMVAEPLTLLQCCPAVVDGAAALVLSTRSSRG
                     AAKPVRVLASVVQSGLFEIHQVDMTEAEITRRAARLAYEQAGVGPEDLSVIELHDAFT
                     ISELLYYEALGLCGHGEAAQLLASGATALGGRIPVNPSGGLIAKGHPPGATGVAQIVE
                     LCEQLQGRAGKRQVQKADLGLSQVTGGGIWGVDHAACSIHILAAA"
     gene            124063..124848
                     /locus_tag="CNE_RS37275"
                     /old_locus_tag="CNE_BB2p01260"
     CDS             124063..124848
                     /locus_tag="CNE_RS37275"
                     /old_locus_tag="CNE_BB2p01260"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_013954220.1"
                     /translation="MTDNATISSSPVSLKGMTAIVTGGAKGIGLGIAHGLAAEGCRLA
                     LWDIDSAALAAAAAELRDAGADVTTRCVSITSEPDVQQAAAELLQRNGRIDVLVNNAG
                     IGGDNLVVKMELDFWQRVIETNLTSQFICCKAVLPTMMDQKFGRIVNISSRAWLGNRG
                     QASYSASKGGVVSLTRSIALEFARSGITANAIAPGIVETPLFGTLAPQVQEDLKRTVP
                     MQRIGQANDVANAVRFFSSPASGYVTGQVLYVCGGRSLSSASV"
     gene            124873..125097
                     /locus_tag="CNE_RS37280"
                     /old_locus_tag="CNE_BB2p01270"
     CDS             124873..125097
                     /locus_tag="CNE_RS37280"
                     /old_locus_tag="CNE_BB2p01270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954221.1"
                     /translation="MRRRDFTLAAAASLLAPAAPEAIDKTLRTPAVAESLLKSGFEPM
                     RLSPAEAQKALVEDTAQWTKVIRDNNIRGS"
     gene            125115..126284
                     /locus_tag="CNE_RS37285"
                     /old_locus_tag="CNE_BB2p01280"
     CDS             125115..126284
                     /locus_tag="CNE_RS37285"
                     /old_locus_tag="CNE_BB2p01280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013954222.1"
                     /translation="MLSDSLRGIRVVDFTQVAAGPVCTQTLADLGADVVKVEAPQGEL
                     CRALAPFVEGQSLGFLALNGNKRSVALDLKDPQQRAAALQLAAGADVVVESFRPGVMQ
                     RLGLGYEDVRQLNPGVIYCSISAYGQEGAWKHKPGVDGVLQAVSGLMSVTGLPDAPPC
                     KVQVPVVDMVTGYIGAIAVLGALARRTRDGGGQWIDVGMFACAVALQQMSFASYFADD
                     VAPTRIGSAAPYAAPNEALRCADGWVMLAAYHPSRWVALCEVLNCRELLSDPRFCELS
                     DRIAHRRELVQLLEARMTLRPRSEWLERFEAADIICAPINDYSEAVASPAFKDAQLAE
                     TVRHSVAGELILPRSPLRAVGESPRARRPAPLVGEHTSEVLRAAGIACEGDNPCL"
     gene            126275..127051
                     /locus_tag="CNE_RS37290"
                     /old_locus_tag="CNE_BB2p01290"
     CDS             126275..127051
                     /locus_tag="CNE_RS37290"
                     /old_locus_tag="CNE_BB2p01290"
                     /EC_number="4.2.1.116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019657129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013954223.1"
                     /translation="MPVNLEVRDYIATVTLNRPEAMNAIDPESATQLHEAWNEISARK
                     DVRVGILTGAGERAFCTGADLKKTMPPAESFAELHFGPRAGVPPVSTLQTPKPMIAAI
                     NGFALGGGLELAMLCDIRIAASTAMFGFPEVCIGSIPAGGGTQRIVRAVGQSDAMLML
                     LSGERVDAQEALRIGLVSRVVASQDLQVLARSIASRIAANAPLAVVAAKKLAQVGGEL
                     PLAAGLELEQQTFGLLRNSEDRIEGRRAFAEKRKPRFQGR"
     gene            127132..128103
                     /locus_tag="CNE_RS37295"
                     /old_locus_tag="CNE_BB2p01300"
     CDS             127132..128103
                     /locus_tag="CNE_RS37295"
                     /old_locus_tag="CNE_BB2p01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954224.1"
                     /translation="MKRRSFLSALGATALASRSFASAPHSFAGKQLRFVIPYNAGGVA
                     DSSARIGLEGLQTALGSGVVVFDNRPGANGNIGTEYVTRQPADGTNFLVIPSSQLTTN
                     SFVPELRIKGIDVLERFVPVAPLVDIPLVLMVNADSGIQSFADFMRKAKASQLRFGNP
                     GVGTPHHLAALLLEKHTGVRMIHVAYKGGAPMVADLAGQHLDAVFSSWSTAHGLVTAG
                     KLKPLGSLQSGTAFGGLPSLNGELGGSSVPTWTGIFAVVGTPEGAMDAVNQATRTALL
                     SPQLEARIKDLGLVPMPMSRAKSAAKLKEEARFMRGFLGKIQLDFSK"
     gene            128123..129283
                     /locus_tag="CNE_RS37300"
                     /old_locus_tag="CNE_BB2p01310"
     CDS             128123..129283
                     /locus_tag="CNE_RS37300"
                     /old_locus_tag="CNE_BB2p01310"
                     /EC_number="5.3.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methylitaconate isomerase"
                     /protein_id="WP_013954225.1"
                     /translation="MSNANSRRMSEQVRIPVTIMRGGTSKALFLAQRDIPADPGRRAR
                     LLLALFGSPDPRQIDGLGGADVLTSKCAIIGPPSRPDADIDYTFAQIGIDAPTVSYEM
                     VCGNISAATGVYALQEKLVAVQEPVTEVRVHNTNTGKILRLLVQCADGEPRVEGDCEI
                     DGVPGSGSEVALDYSGTSGGATGKLLPTGHPRDAVHVPLLGRDIEVSIVDVGTVCVLI
                     RAADLGETGTELPGEFNPRTFEVAEAVRQWAAERCGLQGSYTPYQIVVGPPQSYRAFS
                     GDRVVESGEIDLVARMVGANGLVHKAFPGGGSVCLSIAAQIEGTVASEVRGGHQGPAR
                     IRIGHPSGVFGVYGHVARGADGEWSVQEVHFVRTARRLMDGFAYVRTSALRG"
     gene            129331..130515
                     /locus_tag="CNE_RS37305"
                     /old_locus_tag="CNE_BB2p01320"
     CDS             129331..130515
                     /locus_tag="CNE_RS37305"
                     /old_locus_tag="CNE_BB2p01320"
                     /EC_number="2.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016447274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_013954226.1"
                     /translation="MKQRDIFVVGAARTAIGTFGGSLKDVPNTQLATTAVKAAIERSG
                     VAPANVGHVVMGNVIPTDTRDAYLSRVAAVDAGCLIETPAFNVNRLCGSGLQAIVSAA
                     QAIALGDCDIAIGAGSESMSRAPYFDTAARHGARMGDAQLVDYMIGILHDPWEKMHMG
                     ITAENVAARYGISREQQDALAVQSQQRAAAALAAGRFKEQIVPVEVKTRKGVVLFDTD
                     EHVRADTTLDVLSKMKPAFKKDGLVTAGNASGINDGAGAVVLAEGERVKALGLKPLAR
                     LVGYAHAGVEPAYMGIGPVPATRKVLERTGLKVSDLDVIESNEAFAAQACAVMKELGF
                     DPAKVNPNGSGISLGHPVGATGAIITVKALAELQRVQGRYALVTMCIGGGQGIAAIFE
                     RV"
     gene            complement(130540..130798)
                     /locus_tag="CNE_RS37310"
                     /pseudo
     CDS             complement(130540..130798)
                     /locus_tag="CNE_RS37310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006758203.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(130804..131907)
                     /locus_tag="CNE_RS37315"
                     /old_locus_tag="CNE_BB2p01340"
     CDS             complement(130804..131907)
                     /locus_tag="CNE_RS37315"
                     /old_locus_tag="CNE_BB2p01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS630 family transposase"
                     /protein_id="WP_013954228.1"
                     /translation="MQVDTTDPRWRRSELILSEAEREQLTALTMRRKTAQALALRARI
                     VLACADGIDNKTVAAKQRVTQQTVSKWRAGYVAHRLDGLLDAPRPGAPRTIDDARVDA
                     VIAKTLESVPSGATHWSTRTMAREMDLSQTAVSRIWRAFGLQPHRQETFKLSSDPLFV
                     DKVRDIVGLYLNPPLKAMVLCVDEKSQIQALDRTQPILPLAPGIPEHRTHDYMRHGTT
                     TLFAALDIATGEVIGELHRRHRSSEFLQFLRTIDANVPANLEVHLVMDNYGTHKTPSI
                     KNRFARHPRFHVHFAPTSASWVNQVERWFATLTEKYIRRGTHRSTRQLEEAIRHYLDV
                     YNANPRPIVWCKPADEILASLERFFMRIRRAAL"
     gene            131992..133182
                     /locus_tag="CNE_RS37320"
                     /old_locus_tag="CNE_BB2p01350"
     CDS             131992..133182
                     /locus_tag="CNE_RS37320"
                     /old_locus_tag="CNE_BB2p01350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954229.1"
                     /translation="MKRVMKRSMVALAVLAAFSGTAMAQAGLTLYGVADINVEYVNHV
                     GKVPSAANQFNPGPANDAWRINSGGVAGSRWGLRGEEDLGNGLKSVFVLESGFNLDNG
                     TLAMSGRLFDRQAFVGVQSASYGRLTFGRQYTSIMYALANFTPMAFASQYDPIVAQIG
                     PNFREDNTVAYSGTFGPVTAMAHWSFGTGVALPQPAANGVAVGGNGEVPGQFRRDAGY
                     GVGLNYFAGKLGLAAAYDQFNPSIGTAGGTISSGAYKKAAVAASYAIGPVTVMGGYRW
                     GQNKDANGILLQRDDLYSLGANYQVTSALDLSVAYNYQDLKNFLGSTRLANPWQVALR
                     ANYALSKRTSLYLTTAFAKNAGLMLDSGPTAYVTSLFLGNSYALAGGQSTMLGAALGI
                     RHTF"
     gene            complement(133322..133813)
                     /locus_tag="CNE_RS40470"
     CDS             complement(133322..133813)
                     /locus_tag="CNE_RS40470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569697.1"
                     /translation="MAGQNSGQTDRRIAAAANVSFGSSTLLAGYRWFKGDIGVTPGTP
                     QRRNNLFRLGYGFQATPALTLTGAGYHLNNKRNGEDPWMLLASANYTLSKRTDAFLNV
                     GNLRNKNNSNLGLNGFGSTVTPRDNQTGVHGQHSPQVLTDPRLPYCSGETAGPTQQQE
                     VKK"
     gene            complement(134110..134334)
                     /locus_tag="CNE_RS38885"
                     /old_locus_tag="CNE_BB2p01390"
     CDS             complement(134110..134334)
                     /locus_tag="CNE_RS38885"
                     /old_locus_tag="CNE_BB2p01390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954233.1"
                     /translation="MTSGNVSGLRWGLPGVEDLGSGMKAVYTLESGFDLDSGASGQGG
                     RQFGRQALWAWKTSGTASRLAGSRTRCLTC"
     gene            complement(134404..134664)
                     /locus_tag="CNE_RS37330"
                     /old_locus_tag="CNE_BB2p01400"
     CDS             complement(134404..134664)
                     /locus_tag="CNE_RS37330"
                     /old_locus_tag="CNE_BB2p01400"
                     /inference="COORDINATES: protein motif:HMM:PF01527.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013954234.1"
                     /translation="MKKSRFTEEHMFTILREADRTTVAEAARKHKVSEATIYAWRKHF
                     GQMEATDVKRLKALELENSRLKKLLAERALDIEILKETNGKK"
     gene            <134769..>134962
                     /locus_tag="CNE_RS40475"
                     /pseudo
     CDS             <134769..>134962
                     /locus_tag="CNE_RS40475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018904329.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start and stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(<134991..135418)
                     /locus_tag="CNE_RS37335"
                     /pseudo
     CDS             complement(<134991..135418)
                     /locus_tag="CNE_RS37335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018312317.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            135681..137186
                     /locus_tag="CNE_RS37340"
                     /old_locus_tag="CNE_BB2p01420"
     CDS             135681..137186
                     /locus_tag="CNE_RS37340"
                     /old_locus_tag="CNE_BB2p01420"
                     /EC_number="1.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_013954236.1"
                     /translation="MSRSDQTENHRFPEVNPHTRYDLFIAGEAVPSSGSDSFTCFDPF
                     EETEWGIVPVGTSDDVDRAVRAARAAFPAWAATPVAGRAEILRIFGNLIRENVEELAR
                     IQVHENGKTITEMRGATSTLAPLADYVAQLAIADHGTTVQPTLPGHDAWTRPEPIGVI
                     AAIAPWNNPLVLLAWKLFPAIAAGNTVVIKPSEVTPVSTLRLAQLARQAGVPAGVINV
                     VTGAAETGAALVSHPDIDKVAFTGSTATGISIAKVAAARVLPTTLELGGKGPQIVFPE
                     ADLARAVPSLLAGLIAGTGQACNAGSRLLVHESLYDEVLERLKLALANVKIGDPLDPK
                     VQVGPLASRAQFAKVTGYFDIAAREQTTKLLYGARVGTEIPEVTRGLFVEPTIYATPD
                     RTSRVRCEEIFGPVGAVISFRSENEAIEVANETEFGLVSGLWTQDVDRVARVSKRLRS
                     GVVWVNTWRAFGINVPFGGVKMSGLGRELGPDLLHEYTQVKSIWLGNGLET"
     gene            137322..138761
                     /locus_tag="CNE_RS37345"
                     /old_locus_tag="CNE_BB2p01430"
     CDS             137322..138761
                     /locus_tag="CNE_RS37345"
                     /old_locus_tag="CNE_BB2p01430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     flavoprotein subunit"
                     /protein_id="WP_013954237.1"
                     /translation="MNTENNYDIIVIGCGAAGLATAIAYAEAADRSDKIARIALLERA
                     PEEERGGATQWTAALLRIAEDGRFDTNWRQLVDVLGGGLPDQEYCATLEKEVPATLEF
                     LTSRGVPLERLPWPAPINFAHGEVKLQTVMHPVNGGAGIVSGLFNELTKHKGVEVHYR
                     TEAVRLSISDDGAVNGVVVRKEDGRLRTLHGNNVMIASGGFEGNKEMLTRYLGSNACD
                     LVPIVPGIKNNRGEGITMAIEVGADTSGQFDMFHAEAIDPRSSQPDAVVWATPYGIVV
                     NSDAKRFFDEGSHTLDRTFELLGYEIWKNQNQRAFWITDQQIANLPGILAINFTDVDP
                     IAADSIEGLAENLGLDPSALESTIAEFNSACGSQTFDHTRLDGKSTTGITPPKSNWAN
                     PIEQGPFLAVPLTGGITFTFGGIRTDTVGRVLTPAGTPIAGLYAAGEVTGLYYHEYPA
                     ATSVLRSVTFGRLAGTHAATCSPSRDAHS"
     gene            139486..140247
                     /locus_tag="CNE_RS37350"
                     /old_locus_tag="CNE_BB2p01450"
     CDS             139486..140247
                     /locus_tag="CNE_RS37350"
                     /old_locus_tag="CNE_BB2p01450"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-2-methylbutyryl-CoA dehydrogenase"
                     /protein_id="WP_013954239.1"
                     /translation="MQIKYVAAVVTGGASGLGGAAAKRLAEAGAKVAIFDLNDELGRA
                     HARAIGGQFFKVDVTDEVAVASALAQAEELHGPARILVNSAGVGAPAKVICRDGEPLP
                     LTDFSKIISINLLGSFNVLSKFAARLHKARALGEERGVIVNVASVAAFDGQIGQPAYA
                     ASKAGIVGMTLPIARELARFGIRVMTVAPGIFLTPLLASLPQEAQESLGQQVPFPSRL
                     GQPDEFAQLVEAIVTNAMLNGEVIRLDGAIRMAPR"
     gene            140428..141057
                     /locus_tag="CNE_RS37355"
                     /old_locus_tag="CNE_BB2p01460"
                     /pseudo
     CDS             140428..141057
                     /locus_tag="CNE_RS37355"
                     /old_locus_tag="CNE_BB2p01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977991.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            141054..141851
                     /locus_tag="CNE_RS37360"
     CDS             141054..141851
                     /locus_tag="CNE_RS37360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014899827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_041229385.1"
                     /translation="MTEQVILSVEGPVATIRLNRPEVGNSIDMGSAQALLKASIQCDQ
                     DPAIRCVILTGTGRLFCAGGDLETFRAAGDQVPGLLSELAGILHLAISRLQRMGKPLV
                     VLVNGPAAGAGLSLAISGDIVLSARSAHFTAAYSAVGLSPDGGLTWNLPRLIGLRKAQ
                     EMVVLNKRVPSQQAEDIGLITRAVDDDKLLAEGIELAETLARSATGALGGTRRLLLET
                     YEDGLEAHLEKEARSIAALSAGLEAREGISAFVGKRKPIFYRGVENG"
     gene            141844..143004
                     /locus_tag="CNE_RS37365"
                     /old_locus_tag="CNE_BB2p01480"
     CDS             141844..143004
                     /locus_tag="CNE_RS37365"
                     /old_locus_tag="CNE_BB2p01480"
                     /EC_number="2.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954242.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_013954242.1"
                     /translation="MAEAYIVEAVRTAGGRRNGKLAGWHPADMAAEVLNAMVERSGID
                     PAAVDDVILGCVTQAGEQAFAFARNAVLASRLPVSVPAVTIDRQCGSSQQAVQFAAQA
                     VMSGTQDVVIAAGAESMSRVPMFSNISLHEKAGIGVGPFSERIKARFGVRNFSQFAGA
                     EAIARKYGFNRAVLDAFALVSHRRAAQATDSGAFKAEIVPLATETGCHMEDEGIRRDA
                     TLESIGAVKLLSEDGVISAANASQICDGASAVLVVSEQALKQYGLTPIGRIVNMTVTA
                     GDPVIMLEEPIPATRRALSKAGLKIDDIDLYEVNEAFAPVPLAWLQALEADPARLNVN
                     GGAIALGHPLGASGSKLMATLIHALRARGKRYGLQTMCEGGGVANVTILEAL"
     gene            complement(143159..143455)
                     /locus_tag="CNE_RS40480"
                     /old_locus_tag="CNE_BB2p01490"
     CDS             complement(143159..143455)
                     /locus_tag="CNE_RS40480"
                     /old_locus_tag="CNE_BB2p01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954243.1"
                     /translation="MFIVELTYTQPLNAIEARLSEHRRFLDAQYARGLFLVSGPKNPR
                     DGGVILVSGLIARNELDKLLREDPFPIRFGGVPRDGVCFAQASSSTGETAVVDR"
     gene            complement(143518..144267)
                     /locus_tag="CNE_RS37370"
                     /old_locus_tag="CNE_BB2p01500"
     CDS             complement(143518..144267)
                     /locus_tag="CNE_RS37370"
                     /old_locus_tag="CNE_BB2p01500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006156694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013954244.1"
                     /translation="MARRNLEPKQEPAGEDEVGVAAVNRALSLLDTFSKEQLSFTLAQ
                     MAERTGLYKSTILRLAESLEAYGYLRRGEGSVFTLGPTPFRLATLYQRNLHPAELVMP
                     VLRNLVELTEESATFYVISGDKRLCAYRANSPLAITDNVQAGEMRPLERGAGGKVLLA
                     FVGRQGPEFDTIREEMFSLSRGELYEGIVSLASPVFGSADKLEGAISISGPATRLGKE
                     AIARIKPHLFRASQHLTELFGGDGSRYEVLL"
     gene            144397..145875
                     /locus_tag="CNE_RS37375"
                     /old_locus_tag="CNE_BB2p01510"
     CDS             144397..145875
                     /locus_tag="CNE_RS37375"
                     /old_locus_tag="CNE_BB2p01510"
                     /EC_number="1.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006156695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine dehydratase"
                     /protein_id="WP_013954245.1"
                     /translation="MKRYQMFINNEWVDSTSGQWFESIEPYSGKAWAEVPKGNAQDVE
                     KAVQAAKAAFDDPAWRDLTATQRGALLRRLAELVSTNVTRLADTEQRDNGKLIAEVSG
                     QVQNVAQWFHYYAGLADKVQGAVVPINKPGVFNYIKHEPLGVVAAITPWNSPLALTVW
                     KMAPALAAGNTMVIKPSEYTSASLLELAALTKEAGFPPGVVNVITGFGADVGEPLVRH
                     QDIAKIAFTGGDIAGQRINEIAASDFKKVTLELGGKSANIVFDDADLDQAVKGAVAGI
                     FGAAGQTCMAGSRLLVQRNVHDQFVEMLIKVASDAVIGDPSKHETQVGPIATEAQFRK
                     ILSYIEIAKSGGAHCVLGGHALTGDAYGQGQFIAPTIFTGVTNDMRIAQEEVFGPVLA
                     VIPFDTEDDALRIANDTMFGLAAGVWTSDLHRAFYMSDRLKAGTVWVNNYRATSFTTP
                     FGGYKRSGIGREGGVDAIKEYLQTKSVWITTKPAKANAFVLG"
     gene            145911..147374
                     /locus_tag="CNE_RS37380"
                     /old_locus_tag="CNE_BB2p01520"
     CDS             145911..147374
                     /locus_tag="CNE_RS37380"
                     /old_locus_tag="CNE_BB2p01520"
                     /EC_number="1.3.99.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_013954246.1"
                     /translation="MNDKSDADVLIVGCGVAGLSAAVTALEAGLKVINLERSDESQFG
                     GNSRWTEAYMRMKNDTEISDDFEEHFANNAGWNIDPNVLDALTDSYANWPSFVKSHSL
                     PDPEVISAFANSVPPTISWLKGLGLKFEPQPIYLLTQNTTRIAAKGGGLAIIEALRAK
                     ALALGGEIRYRTTATDLVRNDNGAACGLVITTPDGVRSQLLAKHVVLASGGFQGNPEM
                     MTKYVGPRAKHIRPVAIGGYYNRGEGIQMALNAGAAPAGEFGSYHAEPVDPRSQQAEA
                     VVFIYPYGMLVNKLAKRFVNEAPGTVDAHYDNIARTIADQPDGISYVIFDSKVDDIPR
                     WKTSIRSDQPPVSAQTLEALAAKLGLPDDALAQTVATFNAACPQRSDAFEPFTVDHRG
                     TKGLEINKSHWCRPIDQSPFYAYPIISTNCFTFGGLKVNESAQVLDQDGRVMAGLYAA
                     GETMGIYHQVYTGSTSVLRGLVFGRRAAQHIALSSHR"
     gene            147421..148617
                     /locus_tag="CNE_RS37385"
                     /old_locus_tag="CNE_BB2p01530"
     CDS             147421..148617
                     /locus_tag="CNE_RS37385"
                     /old_locus_tag="CNE_BB2p01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013954247.1"
                     /translation="MDRRAFLSLAGATAGSIALPSLAIAQPKPLVYYSINAFSGNFAA
                     SGKYSDLGVRAAITGYGTRLGRAIEYKRIDTEGNPAIAVRKVQQAISQDGARHFGGAA
                     LSSEALVIMKEVNKANGVYITYVGADEVTGKDCNRSAFRWSTPTFGAVNTVLRPLFQQ
                     NPKWKKAYTITGQYVFGEALLRNSKAVMQDAKVELVGNSYHSLAEKEFSGYLGNAMAS
                     GADVLVILNFGANTLDLLRQAASFGIKKRMAVAVVWFSGLDTFQALGADVTEDIYFGL
                     QYWHGLDTPGNKTFLDVYRREFKENPRFYSAADYQIATLMFDAIRKGGSEDPAAIIKA
                     LEGYTYAGLTGEEQVRPFDHQVIKNYFLARGKKKSAMKDADDFVDILSSSKTASPKSA
                     SDCKMA"
     gene            148640..149497
                     /locus_tag="CNE_RS37390"
                     /old_locus_tag="CNE_BB2p01540"
     CDS             148640..149497
                     /locus_tag="CNE_RS37390"
                     /old_locus_tag="CNE_BB2p01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_013954248.1"
                     /translation="MNIYVFQALNGLGLGMIYFLLSVGLSIIFGLLGFVNFAHGALFL
                     VGAYAAFFTSQATGSFALGLIASFVCVASVGLVAEHWLLRRTYKMSHEAQILVTVGLT
                     FVLTETVVYFFGPESQRVAPPEALSSVLMIGPYPIPSFRVFIVIVCAVIGAALWWLFE
                     RTMFGARVRAGNERPQMLKLLGTKVSRVYAIAFGLGTGLAGLAGGLAVPLRGADPSMG
                     LEAIVIAFVVVVIGGMGSFSGPLVGGLIIGVTQSMMSAIWPEGARLAIFLLMVVVLLL
                     MPKGLFGRA"
     gene            149490..150476
                     /locus_tag="CNE_RS37395"
                     /old_locus_tag="CNE_BB2p01550"
     CDS             149490..150476
                     /locus_tag="CNE_RS37395"
                     /old_locus_tag="CNE_BB2p01550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_013954249.1"
                     /translation="MLNTISKSAGAFYLTLLALPLALPLMSGSATTAVVVMIFGIAAA
                     ACNLMLGYAGLLSFAQGTFFGVGSYAAGLLLRSHPDLGLGVLVLCAVAGAVAALIIGM
                     LSIRRKGIYFVMITLAMAQMAFFAALSFPDVTGGENGLLDIPRLSAGLDGILSESQSQ
                     YLVVSVMFFLAFAFLRRVVRSPFGRVLDAVRENETRAQMAGYDVRRLKLLAFVISGSV
                     TALAGALYAIQLRSAPLSNIDLMMSETILIMAILGGKRSLLGAVFGALLMTLMAEQLS
                     QLWPRWQMIVGFVLILTVLFAPSGIGGVSSQWRMSREKRKASGTHLSSKETA"
     gene            150476..151228
                     /locus_tag="CNE_RS37400"
                     /old_locus_tag="CNE_BB2p01560"
     CDS             150476..151228
                     /locus_tag="CNE_RS37400"
                     /old_locus_tag="CNE_BB2p01560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013954250.1"
                     /translation="MTATILTTRGLGLDYGSFTAVGKVALDLKANTLHSLIGPNGAGK
                     TSLFNIVSGRLPATRGTIEFEGKNITRSPAHGRVKLGMARSFQVTSLFPESTVLDNLR
                     LAAMGYEAGRSLHFWSTWNKEASKHEIADKVLVELDLARYASMPVGALSHGTQRLVEI
                     GMCLVARPMLLLLDEPMAGLGLADVPRVSELLLQLKASYTILLVEHNMHVVMGISDRI
                     TVMFQGNVIAEGSPDEIRQDANVKRVYLGSSV"
     gene            151225..151944
                     /locus_tag="CNE_RS37405"
                     /old_locus_tag="CNE_BB2p01570"
     CDS             151225..151944
                     /locus_tag="CNE_RS37405"
                     /old_locus_tag="CNE_BB2p01570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013954251.1"
                     /translation="MTQPLLALHGVQASYGKSIALEDVSLQVGRGEVVSLMGRNGMGK
                     TSTLNTIVGVLEKTAGSVHLDGVDISDLESDEISRLGVSLVPADRGIFTLLSVEENLK
                     IARRKHSAWTLESAYASFPRLKERRKNLGGALSGGEQQMLSIARALMQGPKVLLLDEP
                     TEGLAPVIVDELVELIASVGRSGVSIVLVEQTFAVCRALASRHYVLEEGHVVFEGPTA
                     ALDDDPTTLERFLGLDVGVHA"
     gene            152081..154720
                     /gene="acnA"
                     /locus_tag="CNE_RS37410"
                     /old_locus_tag="CNE_BB2p01580"
     CDS             152081..154720
                     /gene="acnA"
                     /locus_tag="CNE_RS37410"
                     /old_locus_tag="CNE_BB2p01580"
                     /EC_number="4.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_013954252.1"
                     /translation="MRLSRNSFRCRTALPGMPGYFCMSIVEAEKNGAGALTRLPYSLR
                     VLAEHLLRHEDGDVVRKEDIEALGEWTLTGSSTKSVGFMPGRVLMQDAAGLPVLADLA
                     ALDEELRAKRGTGITLKLPADLIVDHAVEVDASGTRAALSANLQLEFERHGKRYEFLK
                     WAAQRFTNLRIAPPGIGICHQLNLEVLADLVSTNTTDDPELLGFDSVLGTDSHTTMVN
                     GLSIFGWGIGGIDATAALLGEPTVIRIPDVIGVRLYGSLRPGVQASDLALTLTSTLRE
                     HDLVQRVVEFCGPALGTLSVPDRATVANMAPEYGATMAYFPPDAQTLAYLRWTGRPQE
                     HLARVENFLRAQGTYRVASDPEPCFTAVIDFDLGSVEPTVAGPSLPQQRRTLSEVPAT
                     IEHTGMGEGLTHGAVVLAAITSCTNTSNPEALVTAGLLARNAVARGMHVPRWVKTSFA
                     PGSRVASELLSAAGLQQHLDTLGFHVVGHGCATCMGNSGPLHPGVEAYVKNEKLSVAA
                     VLSGNRNFEGRIHPAVRSAYLASPALVVAYALAGNLAVDLSSAPLGSAPDGSPIQLAD
                     IWPDPQEVRAALEGVRLESHFAANRRAWQLGTAEWDALPSAVGDEYPWEARAGYIRRP
                     PFLETTVRRPLLTSDIVGARPLLILGDAVTTDHISPVSRIPADSSAGRWLQEHDVPAT
                     KHGTFSARRLNHEVMLRGGFANPRIRNRLLSEVEGGFTRILPHGDVVPIHEATGVYAD
                     REVPIIVIAGERYGGGSARDWAAKVTRLLGVRAVIARSFERIHRANLVAFGVLPLETQ
                     EDLGSLLTGGETLDMVGLPEALRLGGELELTIRAPDGTDVKRLKLVCRIDTTVEAEWL
                     KSGGMLGRVLDKLLIETTTPQPS"
     gene            155410..156609
                     /locus_tag="CNE_RS37415"
                     /old_locus_tag="CNE_BB2p01590"
     CDS             155410..156609
                     /locus_tag="CNE_RS37415"
                     /old_locus_tag="CNE_BB2p01590"
                     /EC_number="2.8.3.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012356669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013954253.1"
                     /translation="MQKPLRNVRVLDLTNVLAGPFCCHQLAHMGAEVIKVETPGTGDL
                     ARQLGADPELNQRLMGVSFLAQNPGKQSITINLKHARGKEVFRKLVCSADVVVENFRP
                     GVMNRLGLGYEMLKQENPRLIYCAISGFGQDGPLAELPAYDQIIQGMSGVMSITGDSQ
                     TAPYRVGYPVSDTIGGLTAAFAVAASLADHQRTEGYFIDVSMLDATLATMGWVVSNNL
                     IAGKTPAPMGNENMTASPSGTFRTGDGLLNIAANKQEQFEAVCRVVGRPELATDERFA
                     QRQGRLANRVALTDALEVELVKKPAMEWWPLLNAADVPAGPVLSVPDTLAHPQVRDRG
                     MIGVFPNAPGVGRDIRVVRTGFKVNREAPAVDTPPPELGQHTRQVLGSLGYSDSDIDQ
                     LSEERAV"
     gene            156606..156833
                     /locus_tag="CNE_RS37420"
                     /old_locus_tag="CNE_BB2p01600"
     CDS             156606..156833
                     /locus_tag="CNE_RS37420"
                     /old_locus_tag="CNE_BB2p01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013953814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954254.1"
                     /translation="MSGAEEVMNPGENTTDPDQRLSQDWWRTEIIDMRPGEIRYRGYP
                     IEQLIGRVSFAQMICSRPVDASAGWDVISRS"
     gene            complement(156892..158121)
                     /locus_tag="CNE_RS37425"
                     /old_locus_tag="CNE_BB2p01610"
     CDS             complement(156892..158121)
                     /locus_tag="CNE_RS37425"
                     /old_locus_tag="CNE_BB2p01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041229386.1"
                     /translation="MELLPLEPLPTSAAAPPTPLERLHLPPALSGAAGSNRAPATATR
                     IAATNDLAAVTAWLARYADTPATVSAYRREVERLLLWAVLQLGKPLSSLTHEDLLVYE
                     RFLADPQPAARWVLSGSKKLARSHPDWRPFAGPLSPASVRHAMVILNALFARLTEAGY
                     LAGNPLALARRRRAPTRPRITRYLSHDLWNAVKATIEAMPAATERERLHAARCRWLLT
                     VLYLGGLRAAEVTGTAMGAFFCRRDAQGVERWWLEVTGKGNKTRLVPATDELIAELAR
                     YRRAHGLPPTPHPGETRPLLLPVIGRETGRDKALSRGALHLILKEVFGMAAARLRARG
                     PEWEGQAAVLASASAHWLRHTAGSHMTDQKVDLRFVRDNFGHASIATTSGYLHSEEDA
                     RHAATQERHRIGWAQKS"
     gene            158379..160424
                     /locus_tag="CNE_RS37430"
                     /old_locus_tag="CNE_BB2p01620"
     CDS             158379..160424
                     /locus_tag="CNE_RS37430"
                     /old_locus_tag="CNE_BB2p01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954256.1"
                     /translation="MEEGIDDNSFYSRRMIDGRTVDTSHWASPDEGALTGDRRVLYLA
                     RKQAVSLYLSGASAESIRRLTSLGTRQAYRLIRERCLETHPDGRPYGWRGLVPWLRVK
                     PYRRSRKVHVDQFGRGAAGAMQALLDCQPALRQAFEARILASASAKRLVETKQSRRRH
                     CAWFLDQLRSFGYEARNEWPFNTSSLGYYSICRYIDKVLSANPRALAAASGGPNLALK
                     LRSGDGTGRPVLRFMQRVEMDAHKLDGRFCVSLPLMGGGFKEKIVHRLWVVVILEVVS
                     RAVLGYYFSVRREVSKDDVMRALKRALGRWCLRPVSFCDTPYLPEAGLLSAVGSDFVG
                     LCWDETSVDGALAETCQHVRDALRDSVGSTLLDPKTSFSKRRSKDDRPFIEAFFRNLA
                     GQGFQRLSNTTGANFQDRKGRQPEEVALASRFQYEYAEELLDVLIANYNATPHSGIGN
                     RTPLAYAKFLYHHSQQSFRRADPAVVDTLFSIRKRCIVRGGAASGRAPFVEFHYGRYT
                     NDVLHNRHDLVGSEIWVVCHKEDDCRVALASTLDGMSLGVLRAAPPWNMSPHSLSLRA
                     AICQACSHGKFAIPAGVDAIDVFMRYVESQAHNRLPVHPAYLEARRILAAAADSSIGP
                     SMLDAAMARAKAGSSSSNHSKGSAQEPTARRAQSGAADPPKPPAGSTLPPRRMAQSR"
     gene            160428..161408
                     /locus_tag="CNE_RS37435"
                     /old_locus_tag="CNE_BB2p01630"
     CDS             160428..161408
                     /locus_tag="CNE_RS37435"
                     /old_locus_tag="CNE_BB2p01630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011548841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954257.1"
                     /translation="MSFSLPERIDPRHCIVTKQYAVYTPPMHEMIEQIGEWIDQQRPG
                     GYIYGASRLGKSRCLQWYVANELQERFKAVMPLVVWNRRPDSQSSEAGFWHQLLLASR
                     FEFANPAKPPKKAEGIYLCKQRFIAIANNAQRNYVVLLIDEAQDLTLREWKWLAGLQN
                     ELDYEGYLLSVFSVGSHQLNYRHEYMAITGNAHVAARFMAAHARFHGLRSPEEIGYVL
                     NGYDIDSEWPPSSGVPYLEYFAPADYAAGRRLAECAAQLWKALMELSPESARRHFEFP
                     MQHVAKATEAILFQLARGEDWDDVTSHESWLRELAKANFPDHMRIISTGS"
     gene            161410..162852
                     /locus_tag="CNE_RS37440"
                     /old_locus_tag="CNE_BB2p01640"
     CDS             161410..162852
                     /locus_tag="CNE_RS37440"
                     /old_locus_tag="CNE_BB2p01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954258.1"
                     /translation="MAAYPSVNWWPGNLRPYESRLSFVARFCAMNGINVRKCAKFLSV
                     EPDSNTPLPIDKIRRLASVLGETAPLVEDVFSPSIRFIDVGRYGPPPDSRERGAIRYC
                     ETCVQHGYHSYLHQLGWLSRCPFHLSELKTTWAQKHTASLVSQRVGALEFVMRQRCRT
                     WPHGINAGFPAREQGRVASLAGWVARASVAAARMSLGEIWSSGNDGMPGAVSLDQAFG
                     QLRTLEPPPEDIEPLLIEAGDRWTLESHAFARQAKIQLGGLRLCHLSFAEVLHFYIRI
                     NAASANPSSFVTRLHAMQDRQTRHGTCRCRWRLTKAGWLSRWVSVHPEEGPRWGLICP
                     YDIALNELQLGWGRSDLALSNRQAEQERRRFCSVSHAMRDLGLIRYTRDAAVAPAGYL
                     YADQDVWTCCEWVRESALSAVLDMAVAWEAELTFDALTTWLDDIDRGVDPLERDDSKS
                     CVRLCETDDGLLLIKWTRAEANVRRGRSRI"
     gene            163221..165260
                     /locus_tag="CNE_RS37445"
                     /old_locus_tag="CNE_BB2p01650"
     CDS             163221..165260
                     /locus_tag="CNE_RS37445"
                     /old_locus_tag="CNE_BB2p01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954259.1"
                     /translation="MEVRDADDSCHCSRRTIGRRAIDTSLWASPDEGALEGERRALYF
                     ARKQAVSLYLSGATADTIKRLTSLGAKQAYRLIRERCLETHPDGRPYGWRGLVPWTRI
                     KHYRRHRKIHVSQFGGGAVGALQALLDAQPELRQAFEARILASASGKRLVETRQSKRR
                     HCGWLLDQLRELGCEQRNEWPFNTATLGYVSIGRFIDKVLSANPRALAAASGGPDLVS
                     KLKTGDGTGRPVQKFMQRVEMDAHKLDGRFCVSLPLMGGGFREKIVHRLWVIVILEVM
                     SRAVLGYYFSMRREVSKDDVLRALKRALGKWCARPVSFSDRAYLPDAGLLSVLGDDFV
                     GLCWDETSVDGALAETCQHVRDALRDTVRATLLEPKTSFSKRRSKDDRPFIEAFFRNL
                     AGKGFQRLSNTTGAKPQDRKGRKPEDVALASRFQYEYAEELLDVLIANYNATPHSGIG
                     NRTPLAYANFLYHHAQQSFRRVDPAVVEALFSIRKRCIVRGGAASGRAPYVEFYYGRY
                     TNEVLHNRHDLVGSEIWVVCHKEDDCRVALASTLDGISLGVLRAAPPWNISPHSLAVR
                     AAISQACSHGQLIIPAGADAIEIFMRFVESQAHKRLPVHPAYLEARRILVAAADPSIG
                     AAMLDAAMDRAKQKDSRGSRNGGTSNKPARPNGAIKTEPATPGSMLPPRRMAQSG"
     gene            165264..166244
                     /locus_tag="CNE_RS37450"
                     /old_locus_tag="CNE_BB2p01660"
     CDS             165264..166244
                     /locus_tag="CNE_RS37450"
                     /old_locus_tag="CNE_BB2p01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011548841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954260.1"
                     /translation="MRFPLPERIDPRHCIVTKQYAVYTPPMHEMIEQLGEWIDQQRPG
                     GYIYGASRLGKSRCVQWYVAQVLQERLNAVVPLVVWNRRPDSQTSEAGFWHQLLLASN
                     FEFANPAKPPKRAEGIHLCRQRFIAIANNAQRNYVVLTIDEAQDLTFREWKWLLGLQN
                     DLDYEGYLLSVFSVGSHQLNYRHEYMAITGNAHLAARFMAAHARFHGLRSPEEIAYVL
                     NGYDIDSEWPPGSGVSYLKYFAPVQFATGHRLADCAALVWKALVELSPESARRHLEFP
                     MQHIARATEAMLFQLAHGGDWVDVTSYENWLQEFAKANFPDHMRIISTGS"
     gene            166246..167685
                     /locus_tag="CNE_RS37455"
                     /old_locus_tag="CNE_BB2p01670"
     CDS             166246..167685
                     /locus_tag="CNE_RS37455"
                     /old_locus_tag="CNE_BB2p01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954261.1"
                     /translation="MAAYPSVNWWPGNLRSYESRLSFVARFCALNGINVRKCAEFLSV
                     EPDSNTPLPIDEIRRLASVLGETAPLVEDVFSPSIRFIDVGRYGPPPDSRERGAIRYC
                     ETCVQHGYHSYLHQLGWLSRCPFHLSELKTTWAQEHTASHVSQRVGALEFVMRQRCRT
                     WPHGIDAGFPAREQGRVASLAGWVARASVAAARMSLGEIWSSGNDGMPGAVSFDQAFG
                     QLRTLEPPPEDIEPLLTEAGDRWSLESHAFARQAKIQLGRLRLCHLSFAEVLHFYIRI
                     NAASANPSSFVTRLHAMQDRQTRHGTCRCRWRLTKAGWLSRWVNVHPEEGPRWGLICP
                     YDIALNELQLGWGRSDLALSNRQAEQERQRFCSVSHAMRDLGLIRYTRDAAVAPAGYL
                     YADQDVWTCCEWVRESTLTAVLEMAVAWEIELTFDALTTWLDDIDRGVDPLERDDSKS
                     CVRLCETDDGLLLIRWTQADGSASQTTPF"
     gene            168266..169520
                     /locus_tag="CNE_RS37460"
                     /old_locus_tag="CNE_BB2p01680"
                     /pseudo
     CDS             168266..169520
                     /locus_tag="CNE_RS37460"
                     /old_locus_tag="CNE_BB2p01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011296091.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="KfrA protein"
     gene            169615..170727
                     /locus_tag="CNE_RS37465"
                     /old_locus_tag="CNE_BB2p01690"
     CDS             169615..170727
                     /locus_tag="CNE_RS37465"
                     /old_locus_tag="CNE_BB2p01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphate phosphatase"
                     /protein_id="WP_013954263.1"
                     /translation="MKENKLAPEQEVEPRVASNATNGLGQMELPIAEAMRDADPAIGE
                     ASGAGVGSGSVDTQAQRLDFWSTSRDSGPTATVSYRRRRSYAAPDASTEDVAPEESRE
                     AAASEALTESDAPEAPIEAMPSEATTEAVAEAPVEVLATDEPMEAAARDELTESAAPV
                     APLYAPAPEAAPEERQAPKRGRKPKALTETAAPEAAPEGRRTPKRGRKPKTLAEVAAP
                     EVTTQETPTRKRGPKQITLPGVEAAPEAPTQKPQTRKPRQEQKTPTATQSPSQSSLLA
                     QLASVNAQLEQLRATEVPKVVEEIRQLMQEYDLSIEDIAGKPSVEPAARAVPTKTKAA
                     PPPRYRNPKTGQTWSGRGRAPAWIGKKSERFLISSP"
     gene            170813..171001
                     /locus_tag="CNE_RS40485"
     CDS             170813..171001
                     /locus_tag="CNE_RS40485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018313456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_085959716.1"
                     /translation="MRHFTTGCFDPPPPSDPPVTYLQCRKSHLGRGRAAMPPWLRPAV
                     NAGQSVEFFRLAQADALV"
     gene            171184..172434
                     /locus_tag="CNE_RS40490"
                     /old_locus_tag="CNE_BB2p01700"
     CDS             171184..172434
                     /locus_tag="CNE_RS40490"
                     /old_locus_tag="CNE_BB2p01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase family"
                     /protein_id="WP_013954264.1"
                     /translation="MLSPERATIGARRSDELGRYYTRADIGELLVDYMGSTAPYGVLD
                     LGSGVGSLSEAAARRWSNSNILTVDVDQAVSAQIRAALNLRAEGRHAHLRADALSSRL
                     PLLIRAQLDKIDAAVCNPPFIKPVWRKTFDNILEDAGLSGCLPAIKDADAALLFLAQN
                     LRTLDAGATLGIILPDTMISSQRYQRFRKDLLARYKVEAVIKLPRGSFLGTEALASIL
                     IVKTAKPTDQSVPLYKLNFERTISTPILVPIDQAVERLDYDYHALTRVQPVRPGKKLP
                     LAAICTEVRRGLIENSLAKRCSISVFHTTSMSSADLGRWVDLPNQFPGSDNESSMITA
                     TSGDILVARVGRNIGQKILGVATGMVLLTDCVYRIRVPQRYQKLVLSQLSSKANRDWF
                     ESRTYGVGARQLTKADLLSFPIYL"
     gene            172449..174134
                     /locus_tag="CNE_RS37470"
                     /old_locus_tag="CNE_BB2p01710"
     CDS             172449..174134
                     /locus_tag="CNE_RS37470"
                     /old_locus_tag="CNE_BB2p01710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954265.1"
                     /translation="MSEFEERADQLALDIIDTSLVDGEMFRSARRKLLATGAKLLVGP
                     RGTGKTHLMRYTYQHALDKPTAPLVLYASFNRYLNLEPLLKRSPDALKRFHSWVLAKL
                     ILSCFQWLEDKGENSAWFAALDPLYDSAKLSGLISLLERGGGDDIYQEFGQFLTVDLV
                     LKAARALASRFSRSRTVFLLDDAALSLSDQYLVSFFEIFRLLKTQYISPKASVYPGTT
                     QYGPTFHASHEAESVPLWLSIEDSEYSQIMGEIAEKRLTKKEVETINRDILEVFKYAS
                     FGIPRTFLRLLREYFDSRPGTSQQKINKIIEQQASLIGAEYDSLGLKIRQFSSLVSMG
                     RRLFDKAVIDISAGQSEDTSTRNIVLGIRQDSGQNPLAERMLRFLIEVGMLFPLQAVS
                     HGPNRKYDRYIPHIAFLYQHGAFREGRGSSLKVLPQVMQRPAAKHPVRRDLNSLLGAE
                     TVENLHLDLPPCQNCGAERLNDSQRFCHNCGQELVAASLFEECMKLPLEQVPGISKAL
                     IQRIQADTNLRTIGHVYASQNASGDLQQANYVGPVRASGIISKVSVMVNEFLS"
     gene            174348..174989
                     /locus_tag="CNE_RS37475"
                     /old_locus_tag="CNE_BB2p01720"
     CDS             174348..174989
                     /locus_tag="CNE_RS37475"
                     /old_locus_tag="CNE_BB2p01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954266.1"
                     /translation="MIAAVESYLRAILRRLIAMDSICQESVHRRDVSYGAAIHLTKDM
                     LPEAVLEKISFISKGSIVDSIRELAGIKGNLPPDVTASIDDYVKICHLRHCAVHRFGK
                     LGVSNAIALGLEDHKELLEKPLLLDYLSLQNSIVISTGMVKTINNFLFNEIVSRISDS
                     RWTGVYKTDKRLFLTYYKIFADTISTTGFSVGLKDMYILFMSQKAKFSAGLPF"
     gene            complement(175360..176457)
                     /locus_tag="CNE_RS37480"
                     /old_locus_tag="CNE_BB2p01730"
     CDS             complement(175360..176457)
                     /locus_tag="CNE_RS37480"
                     /old_locus_tag="CNE_BB2p01730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569698.1"
                     /translation="MALPLVGERLWAFGYRHDARQDAAALITPLVTSGVVTAVFPQGR
                     GERMPSACVEVAMDTKGGMSGGPVVNANGDLVGIVSSSFDGGPSYVTLIWEALRIKVS
                     SRLPSLALRGDIDLIAARELGLVKLKGEVKRSKRGDITMTLTEPECELLTVSSDPEAI
                     VSPPPGSKPLIGVRLEDFEERWLSEVETAAADTALAYLEGLELPLVRRFLSASDVPEA
                     CLAPIREFTVEDFDGVEDPDIQSAREDEDGTVAIAFAFDLLSVVWTMQVPASDYLALA
                     RDYDSHFMNITVDGPTASMELIQRCHFETSLALDREASEFTKASITFSGVIRPKPRAP
                     GTRRIPDAPIDLDYWLRETPADAGGLLSGYP"
     gene            complement(176725..176922)
                     /locus_tag="CNE_RS37485"
                     /old_locus_tag="CNE_BB2p01740"
     CDS             complement(176725..176922)
                     /locus_tag="CNE_RS37485"
                     /old_locus_tag="CNE_BB2p01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954268.1"
                     /translation="MDIFTRNAGLADPVLSDEAAFFIQLILDDVWLWFNTVYGEQARR
                     YRPPPDLDPDDDPANELDLPF"
     gene            complement(176974..177768)
                     /locus_tag="CNE_RS37490"
                     /old_locus_tag="CNE_BB2p01750"
     CDS             complement(176974..177768)
                     /locus_tag="CNE_RS37490"
                     /old_locus_tag="CNE_BB2p01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014002463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013954269.1"
                     /translation="MYRQHFGLRCAPLDKDSTSLWDDGAIAHLNERFQWLLTSPGVGL
                     LTGEPGVGKTAALRHITRSLNPHRYQVIYTAESDFGRIDLYRALARELGLEPSYRRAD
                     LWRDIKRRITELAQNRQVLPVWVIDESQNLPPAFFRDLPAFLNFAMDARDLITIWLAG
                     HPSLADVLERAPYAALYGRIQVRVHFTPVIERERFAQLIGHALAAAGCNHTLLSDSGI
                     EQLREASRGVPRQAGRILRNAMRLAVPKGLNHIPDDLLLRAIGEVR"
     gene            complement(177772..179133)
                     /locus_tag="CNE_RS37495"
                     /old_locus_tag="CNE_BB2p01760"
     CDS             complement(177772..179133)
                     /locus_tag="CNE_RS37495"
                     /old_locus_tag="CNE_BB2p01760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013954270.1"
                     /translation="MSFPHFDEGFNEMNDIDEMALFRLGVLGPLTSRGELARGELTRL
                     IRQIAQQEYAIPGSRRRHISEKTLHAWYDTWRREGIAGLASKVRADRGSSKLPEAVQA
                     AVLAAKRENPRRSIRQIRLLLESAGLVARDTLSRSAVHRLLKANGLSRIAGPAVVPDE
                     KRSFEAEHAGSLWYGDVMHGPTLSIDGKRRKTYLVSLMDDASRLVAHSAFCLSETALD
                     IESVLKQALLRRGIPGRLVVDNGSAYRSATLQSICARLSIRLIYCRPYQPASKGKIER
                     WHRTLREQFLAELDTSRIRELGDLNARLWAWIEQIFHRSKHASLGGLTPLARYQQDLP
                     RIRLLGPLAAQLDQLFWYRITRLVRRDGTVSYQGKRFEVPYELAGQHVRLVVDPHTGV
                     VMHVENEAGLQLGAATELDTVANSTRRRQRPQAEPATAEPAVAGPNLIELAHRQHYPH
                     TEH"
     gene            complement(179232..179762)
                     /locus_tag="CNE_RS40495"
                     /old_locus_tag="CNE_BB2p01770"
     CDS             complement(179232..179762)
                     /locus_tag="CNE_RS40495"
                     /old_locus_tag="CNE_BB2p01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954271.1"
                     /translation="MHRIVFAFLTLEQHLLAIRCTPQSYRPDACAHCGCGCLWGHGCY
                     HRKADRSGDAELNPVPIPRFRCPSCRRTCSRLPLAICPRRWYGWALQQQVLLLLIAGA
                     SLRRTAAIFALGYHTVRRWWRWLNTSQTFAFHLRSRFADLGRCANSVEFWLTCFGQMP
                     LCQAMAWIDHDGLTVP"
     gene            complement(179872..180369)
                     /locus_tag="CNE_RS37500"
                     /old_locus_tag="CNE_BB2p01780"
     CDS             complement(179872..180369)
                     /locus_tag="CNE_RS37500"
                     /old_locus_tag="CNE_BB2p01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954272.1"
                     /translation="MTSVRITEANPALATLRRSWVTAIYTNEDGIGSMGSLHEAGDAL
                     VALALMEEDGPTILGSGVMIGPGLVVAATHVLAEFKARNADPVLLTFLPDGARAWLPR
                     ESSTLTGPSVFGADRRIVSDVSLLSCTLNSEAHEHHPLTLVLRPAQSEVWEGPFIPRT
                     AGAIF"
     gene            complement(180724..181311)
                     /locus_tag="CNE_RS37505"
     CDS             complement(180724..181311)
                     /locus_tag="CNE_RS37505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954273.1"
                     /translation="MSIVGGNQRIGFRWIQLLHAIEANKFWILKPLTITPHAIARCLQ
                     RVGTMDVPGILEPISLALGFAIPLMSVSHQEKWRQFAVPVREGLFLGDSGPDGWVIRT
                     YISRKPYEHESGWDKYLNLFPEIPRWSPSDLRNISVSGRWMTEQLMAIRKERLIVDRV
                     SRLAKQYERREDKQGEQWRKAKSQRDRDRRRQSDA"
     gene            complement(<181850..>182020)
                     /locus_tag="CNE_RS40500"
                     /pseudo
     CDS             complement(<181850..>182020)
                     /locus_tag="CNE_RS40500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007736805.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(182202..183029)
                     /locus_tag="CNE_RS37510"
                     /old_locus_tag="CNE_BB2p01810"
     CDS             complement(182202..183029)
                     /locus_tag="CNE_RS37510"
                     /old_locus_tag="CNE_BB2p01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954275.1"
                     /translation="MLESILPTSPNMVTPKLVAKIEAEEPTLRLAVLIDADNAQAAVI
                     EGILGEVARFGEATVKRIYGDFTSPHSASWKKVLQTYAIKPVQQFAYTTGKNATDSTL
                     IIDAMDLLYTRRFDGFCLVTSDSDFTGLATRIREEGLFVLGFGEQKTPDAFRNACNKF
                     VLTELLRPAPAEATPAAAAKPETAVVPIVTQANTVTKAPVPSFPQDFMLSAIDQSSDE
                     NGWAHLGTFGSYLTKLQPDFDPRVYGFKKLSDLVRSRQDIFVTEERTRRAKLRSSST"
     gene            <183814..>184304
                     /locus_tag="CNE_RS40505"
                     /old_locus_tag="CNE_BB2p01820"
                     /pseudo
     CDS             <183814..>184304
                     /locus_tag="CNE_RS40505"
                     /old_locus_tag="CNE_BB2p01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354827.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start and stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="KfrA protein"
     gene            complement(184385..184708)
                     /locus_tag="CNE_RS37520"
     CDS             complement(184385..184708)
                     /locus_tag="CNE_RS37520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017046316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2845 domain-containing protein"
                     /protein_id="WP_085959718.1"
                     /translation="MIISVLAAIYIFVDSTAKEKLQKEQRERGLRAKYGEEIASEILK
                     SHIWVDQTTEQLVHSRGKPYAIDQKFLKTKVREVWKYEPGPRGGCRLRVTIENGRVVA
                     WDRKI"
     gene            complement(185191..185430)
                     /locus_tag="CNE_RS37525"
                     /old_locus_tag="CNE_BB2p01830"
     CDS             complement(185191..185430)
                     /locus_tag="CNE_RS37525"
                     /old_locus_tag="CNE_BB2p01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954277.1"
                     /translation="MSMPKTITPLPRGQYWATPHAPFPLDGPNGHDEVFPGAYGVSDG
                     QWVTFYKDGEEVWACNAIYAAAHFDFAAVSSAGAD"
     gene            185574..185821
                     /locus_tag="CNE_RS37530"
                     /pseudo
     CDS             185574..185821
                     /locus_tag="CNE_RS37530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959180.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(185836..186301)
                     /locus_tag="CNE_RS37535"
                     /pseudo
     CDS             complement(185836..186301)
                     /locus_tag="CNE_RS37535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008450171.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(186530..187378)
                     /locus_tag="CNE_RS37540"
     CDS             complement(186530..187378)
                     /locus_tag="CNE_RS37540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013954279.1"
                     /translation="MANVVPRDRSASARAGKPQNLTRAVLREPGDRQFASTLERGLRV
                     LQCFSADSPELGNAEIAARTGLPKPTVSRLTHTLVRLGYLRRHPDSGDFGLGMSILCL
                     GYPLLAGLQLRRLAAGPMKELADLIDGSVAIGVRDHLRIVALENITTRDVLKRKPGTG
                     LTLPLVSSTAGTAWLVGATADERKRAIREIEYAEPGSWARQADEFDVFRKEFARLGYV
                     KRRNVLRPDTVALGVPLRRRPGAELLVLSCVLATSAATADALEQQAAVGLLTAAKCIG
                     EKLQQP"
     gene            complement(187463..188371)
                     /locus_tag="CNE_RS37545"
                     /old_locus_tag="CNE_BB2p01860"
     CDS             complement(187463..188371)
                     /locus_tag="CNE_RS37545"
                     /old_locus_tag="CNE_BB2p01860"
                     /EC_number="3.-.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013954280.1"
                     /translation="MHVDIRHHHVMLNGFDMHYASCGEPGHPLLLFVHGFPENWQAWH
                     HQLEAFGPHYYAVALDTRGINESAGPVDVKGYRAGHMVADILALIDHLGYPQCVLVGH
                     DWGGAIACAVALANPARLHGLVMINAVHPAIYRRELVESPAQQAASAYMNFFIGDDAL
                     AQICANDFAYLFGMFAEDGQQPEWLDAPTQAGYRHSWSRPGSVRAGLDYYRASPLHPA
                     ALGDSGAAGVVFDSAAMTLSVPTLVIWGERDRFLLMGCIDGLRQFAPDLRIERIPDGS
                     HWVIHEHGPRVNRLITEFLNDRLDTA"
     gene            complement(188388..189698)
                     /locus_tag="CNE_RS37550"
                     /old_locus_tag="CNE_BB2p01870"
     CDS             complement(188388..189698)
                     /locus_tag="CNE_RS37550"
                     /old_locus_tag="CNE_BB2p01870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl sulfatase"
                     /protein_id="WP_013954281.1"
                     /translation="MQANTTQAIEERVKPNAGLGVLVRSEYFTNLIPGVHTLGGQGNS
                     LAIETARGVVIVDAGPGGGVTRAMITRLRELSAAPVLAIVYSHGHSGYNAGARLWQEH
                     AAERGEIRPALIAQAGVPARYRRYTETAQLQAWLNSRQFRKTMRPASADSYPMPDQTF
                     DSRMVIDGGDRRIELIAAPSETDDALAVWLPESRFLYGGASMIRSIPNVGTPLRTIRD
                     PLRWANTLERLYALNPTQVLPEFGDPITDPQEIHDAFQVPIRALRYLRDAVVERMNAG
                     MNEREILHDMVYPEALFGHKWMRPIYGDPEYIVREIWRMENGWWDRNPTHLHPARPAE
                     AANAVLSALGNPGHVLDEARRLQAEGDTQLALHVIDLLALADPVIPEVIAARALKAAL
                     CRQRAEQMRSIVSRQILLSSAEDLLGLPIGSTSAEDPPADFSWN"
     gene            complement(189782..191050)
                     /locus_tag="CNE_RS37555"
                     /old_locus_tag="CNE_BB2p01880"
     CDS             complement(189782..191050)
                     /locus_tag="CNE_RS37555"
                     /old_locus_tag="CNE_BB2p01880"
                     /EC_number="3.1.6.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl sulfatase"
                     /protein_id="WP_013954282.1"
                     /translation="MDTSNILMVKQALACHADGVYTLGGQGNSVVVDLGATLLLVDAG
                     PGGGITDAMIAQLRASLDKPVAYIVYSHGHMGYNNGVRQWLAEAARRGDPTPQLVAHA
                     NLPARYRRYRETGGLQAYTNVRQFRSDYPATPPAHWFQMPTLTYQDRLALTGTERHVV
                     LMHAPSETDDGTAVWIPDARTLYGSNAFIKTCPNVGSPYRIYRDPMRWAQTLERFAEL
                     APAVLIPEFGKPVTDAAEIHEALTVPARALRYLRREVVARMNAGMSENDIINDVPLPD
                     ELFGSRFMKPTYGCAAYIMHDIWRSENGWWNRNPTDLHPAAPAKAAAAVRRALANPER
                     VLARTRELQAAGELQLALHVIDLLASDDDGDPVSKQARELKAALCEGRAQPMTSVVSR
                     HLYLSAADELLDRPVGAAERARGDAGYAWQ"
     gene            complement(191103..192089)
                     /locus_tag="CNE_RS37560"
                     /old_locus_tag="CNE_BB2p01890"
     CDS             complement(191103..192089)
                     /locus_tag="CNE_RS37560"
                     /old_locus_tag="CNE_BB2p01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954283.1"
                     /translation="MSSFGRRPRLAMIAATAMCLIVQPVAAQTPWPSRPVRLVVPFPP
                     GGSTDLLARALGEKLSKSLGQAVVIDNKPGASGALAAESVVRADPDGYTVLVTIQAPV
                     VVVPHYTTVRYDPLRDLVPVAALANGPLVFAGNAAFPARNVKEVVAYARTHPNTVSYA
                     SFSPGTWSHFAGLLLNRHEKIDLLHVGYKGSAPAIGDVVGGQVQLIFDGQATVLPMVK
                     AGKLRAYAVTSATRTRLLPDVPTFAELGYPEISSDGWMGAFAPAKTPDAVVKRLNAEL
                     VKLVNTPEVMERLNTLGAEPASAMDAARFGRQVASDYKRWGDIVRTSGYRQE"
     gene            complement(192221..193189)
                     /locus_tag="CNE_RS37565"
                     /old_locus_tag="CNE_BB2p01900"
     CDS             complement(192221..193189)
                     /locus_tag="CNE_RS37565"
                     /old_locus_tag="CNE_BB2p01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954284.1"
                     /translation="MTFRSFATAALAACLTLPGVASAQTYPSKPVRMVSPYGPGGSND
                     ISARIIAEGLGKKYGQQFVVENKPGAATRVANEMVAGAQPGGYTLLYAAAPFAINEAA
                     GIKGHYDIRKNFIAIGPRVVAPLFLIVNAASPIRNLADFVSFAREKKDGVTFAGTGVG
                     AAPHLASELLANAAGFKLLNVQYRGDATAYTELLAGRVDATLTAITSALPFIKAGRLR
                     VIAIASEQRSPIYPEAPTFSELGYPTVIGYGWFGLLAPAGTPPAVVQQLNRDVNAVLA
                     DPGNKERLVNLGLQPESGSSEAFADFIGGEVAKWSAVIKRAGIVLE"
     gene            193447..194415
                     /locus_tag="CNE_RS37570"
                     /old_locus_tag="CNE_BB2p01910"
     CDS             193447..194415
                     /locus_tag="CNE_RS37570"
                     /old_locus_tag="CNE_BB2p01910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954285.1"
                     /translation="MTMSIGKLLAAPVACLVLAPMAHADPYPSKPIRLIVPFPAGGGT
                     DTVARMMAERLQQSLKQTVVVENRAGAGGTIGTSYAAQAEPDGYTIVLGISATMVMAP
                     FLYPNAAYTANQRFAALGQIGTVSNMLVVNPAFPAHNLKELVAAAKARPGQINYGSWG
                     LGSGGHLCAEILMRAKGITMTHVPYKGTAPELADVLGGTIMVAMVDSTTSAPYVQAGK
                     LRALAACTERSSNLPDVPGLKDEGVSFDSSFWYGLFAPAGTPAPVLSRLREEVGQILK
                     QPAVAARLKDLGIQATNLSPAQFEEVVRRDYAGWGKLIREAGIKAE"
     gene            complement(194468..196597)
                     /locus_tag="CNE_RS37575"
                     /old_locus_tag="CNE_BB2p01920"
     CDS             complement(194468..196597)
                     /locus_tag="CNE_RS37575"
                     /old_locus_tag="CNE_BB2p01920"
                     /EC_number="6.2.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxyhexanoate--CoA ligase"
                     /protein_id="WP_013954286.1"
                     /translation="MFDHASLDRMFRPRSIALIGASTNPDKIGGVPLALLLKYEYDGK
                     LYPVNPNAGEVQGVPAYPSLAAIGAPADLAIVAVPMARAEQAVKDAAEAGVCSVVLFT
                     SGYAEVGETGRAAQARLAALARTRGVRILGPNCLGFMNTRDQVYATFSPAPHAARARP
                     GAVGIVSQSGAFGIYAYAMARERDIGLSYWISTGNECDIEFADAVAWLARDPDTRVIM
                     GYVEGCRDGAKLKAALSLARDAGKPVIVTKVGRTASGAAAAASHTAALAGDDAVFDAL
                     LRQYGAIRTRTLDEFFNVGYALSGPVRPANNALGIMTLSGGVGALMADDAADAALELV
                     PMPAGAQAAIMARVPFAAPRNPVDITGQVTSEPELMTFAARTMLDSGSYGSLLAFLAA
                     AGTSATFWPHLLAFAKTIRAEYPDTPLALCSLFTPERRRALEALGCLVFADPSAAVRA
                     LKCLGDTAAIARPACDPGLSPYSENPATIEAGVLDEPAGLALLRSAGVPVVAHQRVAS
                     QDEAVAAAAAFGYPVVMKLVSADITHKSDIGGVRLHLQDAGAVRAAYREILEEAARHA
                     PAARLDGLLVAPMIKGGVECILGVQRDPVYGPVVMFGLGGVLVEAVRDVAFRMAPFDE
                     REAHAMIDEIRGRRVLAGMRGQPPADVSALASALAALSRFAWANRDAVVSVDVNPFIV
                     LPLGGGALALDAVVIGAGNASDRLATA"
     gene            196834..197574
                     /locus_tag="CNE_RS37580"
                     /old_locus_tag="CNE_BB2p01930"
     CDS             196834..197574
                     /locus_tag="CNE_RS37580"
                     /old_locus_tag="CNE_BB2p01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_013954287.1"
                     /translation="MNNSQAHADLHGKVAVITGAGRGIGRAIAMAYARSGAAVVCSAR
                     TTNEIQDTVHQIEAAGGKAAAVTADVCDYAAMEALFATSFTLFGGVDIVVANAGVSMQ
                     SRKVEHCDPELWRQTVEVNLIGAFHTARAALPHLRRRGAGKMIFTGSGSRHRPNPGMS
                     SYASAKLGMWMLTQTLAVELLDANISVNELIPGPVRTEMTGFGDKFAPAGEWVKDPED
                     VVPLALFLAGQGDAGPTAQSFSLMRRAG"
     gene            complement(198107..199534)
                     /locus_tag="CNE_RS37585"
                     /old_locus_tag="CNE_BB2p01940"
     CDS             complement(198107..199534)
                     /locus_tag="CNE_RS37585"
                     /old_locus_tag="CNE_BB2p01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate export family protein"
                     /protein_id="WP_013954288.1"
                     /translation="MPRRPHPMTRAFGPILALAMAMAGIPCRAEAQGSAPPYNFLRYT
                     EDYRYLQDPARRSDPWDPVKLIPLGAPDAYLSLGGELRERFESYSAPNFGVPGPSSDS
                     YLLHRLLLHADLHVGSYFRVFAQLGNQLAPGKDIATPPYEDRADVQQAFVDIRLPVTD
                     GPRADSELPILRIGRQEMAFGSQRLVSVRDAPNVRRSFDGARLGGKVGEVKLDAFATR
                     PVLLKTGNFDDTPNHAQGFWGLYATFPKTVIPASGADLYYLGFENSQARYSIGTGVER
                     RHSAGGRIFGSHGPWDWDWEALAQFGSFGRQDLFAWGVSTDTGYAFKLAEWGARAGLK
                     ATVGSGDRDPQDGKLGTYGGLFPKLAYFNQAGLLGASNVMDLQPSLTFKPTATLRFIL
                     SWDFIWRQTTNDAVYTAAGLPIAGTAGRSGRYTGSQLAFDMLWQVDRHIAINAGVVHV
                     DVARVLGSVGGHNTNFTYVAAAYTF"
     gene            complement(199562..200239)
                     /locus_tag="CNE_RS37590"
                     /old_locus_tag="CNE_BB2p01950"
     CDS             complement(199562..200239)
                     /locus_tag="CNE_RS37590"
                     /old_locus_tag="CNE_BB2p01950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_004593426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013954289.1"
                     /translation="MSQPANFNGKRPAIDPADTAMLLIDHQSGLFQTVGDMPMPELRL
                     RAAALAKMATLSKLPVITTASVPQGPNGPLIPEIHENAPHAKYVARKGEINAWDNPDF
                     VAAVEATGRKTLIIAGTITSVCMAFPSISAVADGYRVFAVVDASGTYSKMAQEITLAR
                     VVQAGVVPMDTAAVASELQQTWHRDDAQQWAEVYTKIFPAYQLLIESYTKAQDVQKNG
                     EALDSAR"
     gene            complement(200309..201175)
                     /locus_tag="CNE_RS37595"
                     /old_locus_tag="CNE_BB2p01960"
     CDS             complement(200309..201175)
                     /locus_tag="CNE_RS37595"
                     /old_locus_tag="CNE_BB2p01960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="WP_013954290.1"
                     /translation="MKRLLGVYSAPRSHWVGDGFPVRSMFSYQSHARQLSPFLMLDYA
                     GPADFGPTDRPRGVGTHPHRGFETVTVVYKGEVAHRDSTGQGGVIGPGDVQWMTAGAG
                     ILHEEFHSEAFTRDGGPLEMVQLWVNLPARHKLTAPGYQAILDRDIPAVALPDGAGTV
                     RVIAGQYGAHAGPARTFTPMHVWDLRLVQGGVSTLPLPDGWNAALVVLRGRVRINGDT
                     VAGEAQMAVLDRSGASLTLEASTDTVVLLLTGEPIDEPVVGYGPFVMNTEQEIQQALS
                     DFNNGRFVPASA"
     gene            202006..203784
                     /gene="ilvB"
                     /locus_tag="CNE_RS37600"
                     /old_locus_tag="CNE_BB2p01970"
     CDS             202006..203784
                     /gene="ilvB"
                     /locus_tag="CNE_RS37600"
                     /old_locus_tag="CNE_BB2p01970"
                     /EC_number="2.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, large subunit,
                     biosynthetic type"
                     /protein_id="WP_013954291.1"
                     /translation="MNMPTLEFRNTPAKPNARAPRVLRGAEMIVEALLAEGVRTVWGY
                     PGGAVLPIYDAIASQTGLEHLLVRHEQAAVHAADGYARASGEVGVALVTSGPGLTNAV
                     TGIATAYFDSIPLVVLSGNVPTTMIGEDAFQECDAVGITRPIVKHNFLISDIGNLAVT
                     LKKAFHLARTGRPGPVLVDIPKDIALASAPFHYPDKVEIRSYRPAVEGHEGQIRHAAQ
                     LLREARRPYLYVGGGAVTAGATVALRELAALADAPVTTTLMALGAFSATDPRYLGMPG
                     MHGTYEANRTMQECDVLVAIGARFDDRVIGNVADFCATPRQIVHIDIDPASIGKRVRP
                     TVPIVGDARRVLEKLTAALREARTPLADRADWWRRIDSWRARRCLAYVRDGQRIKPQY
                     VIETLSRLAGGDAIICSDVGQHQMWAAQHYRFTQPRRWINSGGLGTMGVGLPYAMGVK
                     HAFPERDVIAITGDGSIQMCIQELSTCKQYDLPVKIVSLNNGYLGMVRQLQHVEYERR
                     YSQSYMEALPDFPALARAYGHIGLSVNTEADVEPALRDALAQKTRTVFLDIHVDGSEN
                     VWPMIPGGHGLGEMLLGESTSTDASR"
     gene            204121..204828
                     /locus_tag="CNE_RS37605"
     CDS             204121..204828
                     /locus_tag="CNE_RS37605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954292.1"
                     /translation="MSKALTIESTPSTRVETAIEKLREALLRGHFPPGASVREIDVCA
                     LCGVSRTPARSAMLALHSEGLLDYVAQKGYRARRFEMANTQDAYAIRGVVEGLACRLL
                     VERGLAHLVVPRLQALVALGDKLIRNAEKAPFDTAAWSQMNADFHKILLEPMNPVFDE
                     VSGYARRVPHAAPTTTADWRAQPDIDLIKSAQNDHRKIVNALANNEATRAEELMREHL
                     YNAGEVLRRTLDATMAG"
     gene            complement(204932..206014)
                     /locus_tag="CNE_RS37610"
                     /old_locus_tag="CNE_BB2p01990"
     CDS             complement(204932..206014)
                     /locus_tag="CNE_RS37610"
                     /old_locus_tag="CNE_BB2p01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954293.1"
                     /translation="MESQSGLQNLRPRIYGVLGRPMSGNPKTAALIMHPTSNYMGHYF
                     VGPLAAMNVPCLALNSRYAGNDTLLQMERVILDLGAGIRYLRSRGYQKIILIGSSGGG
                     ALAAFYQSESENLTVHEFIEGGPTGITKDDIPPADGIVLSAAHLGRADIFAEWVDPAV
                     VNEHDLFATNLELDIYEGPIKPPFTSQFIATFRAAQLARRARIEGWVEAEIAALRKRP
                     NGPADRIFIINRTHSDPRMIDLSLDRNDRKWGSVWGDPRTVNYAANAFGRVTSLRAFM
                     SQFSSKSRALGPANLKQTSVPVLLLVHTADASTFPSTRDAWQASAAGRITTVGIEPGN
                     HYLVGQTELVEFGANTIVDWIDKHVR"
     gene            complement(206215..206781)
                     /locus_tag="CNE_RS37615"
                     /old_locus_tag="CNE_BB2p02000"
     CDS             complement(206215..206781)
                     /locus_tag="CNE_RS37615"
                     /old_locus_tag="CNE_BB2p02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance/dioxygenase
                     family protein"
                     /protein_id="WP_013954294.1"
                     /translation="MPIQRFSHVAYRCADARKTVDFYTQLLGLEYAFAVAENYVPSTG
                     QFDPHIHVFLRVSPGSYLAFFELSEAPEMGFDPNTPDWVQHIALHVPRVEEVKSFKEA
                     LETAGIAVLGITDHGIFKSIYFRDPSGHRVEITCESLSDELCEQLGARSKALLDEWSH
                     TRRAPDIGIHRSGSLVGTVNLEDRALRE"
     gene            207085..208368
                     /locus_tag="CNE_RS37620"
                     /old_locus_tag="CNE_BB2p02010"
     CDS             207085..208368
                     /locus_tag="CNE_RS37620"
                     /old_locus_tag="CNE_BB2p02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954295.1"
                     /translation="MSRTQAVLEPMNAVDRDVLYRKVSRRIVPFLVICFVVAFLDRVN
                     ISYAKFQMQQDLGFGDAVYGLAAGVFAIGYVLFEIPSNLLLARYGARRTFVRIMVCWG
                     LVSMAMMFVTEPMHFYVLRVLLGVFEAGFYPGLMLYLAYWFPTRHYAKAVSWFIAGSS
                     IAGLIGGPLSGWIMRDMAGVLGLHGWQWMFFLEALPAIFLGAVAYFHVSDNPGTARWL
                     SAEEKAALARDLAAENHTHANARSHSFRAALRNPIIYIFAAIYFTVNCAAYGLVLWLP
                     SLVHATGVGSVLEVGLLSAIPNVVGAVGIIVLCRHSDATGERRWHFLTSASIGALALL
                     TLTVATRSLPLTIIALSVAVIATYALLPIFWATPHVFLAGSAAAGGLALISSIGQLAG
                     FVSPYVMGLTKAHTASFSLGLSLMAIVRKREICRT"
     gene            208425..208913
                     /locus_tag="CNE_RS37625"
                     /old_locus_tag="CNE_BB2p02020"
     CDS             208425..208913
                     /locus_tag="CNE_RS37625"
                     /old_locus_tag="CNE_BB2p02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013954296.1"
                     /translation="MDQSDLDCLPLRAINVGANGKRSFDKGDKRRLVEACLQPGVSVA
                     GMAIKAGVNANQLRRWIEQHKAEQKDADGTMDAIESAPAAFVPVVEVHAAGPKAGAEL
                     PTVPEPLPVRTLQPPQPLPARLVARLPNGVSVELECSGQDATLVMATIEALGRCHVPA
                     RR"
     gene            208894..209247
                     /locus_tag="CNE_RS37630"
                     /old_locus_tag="CNE_BB2p02030"
     CDS             208894..209247
                     /locus_tag="CNE_RS37630"
                     /old_locus_tag="CNE_BB2p02030"
                     /inference="COORDINATES: protein motif:HMM:PF05717.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013954297.1"
                     /translation="MFRLDADLQVYLHRNAVDFRLGINGLVALVEQSMQHDPFARAVY
                     AFHNRRRNRIKLLLWDRNGFWLLLKRLEEDRFVWPRRQQAVIELTTEQLHWLLDGIDV
                     DAVQRHPSRKYQHTG"
     gene            209303..210910
                     /locus_tag="CNE_RS37635"
                     /old_locus_tag="CNE_BB2p02040"
     CDS             209303..210910
                     /locus_tag="CNE_RS37635"
                     /old_locus_tag="CNE_BB2p02040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006163466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
                     /protein_id="WP_041229262.1"
                     /translation="MNEHDLSQLPPAAQAYIRELEARAAANAQHIAELNERIGLLEEQ
                     FRLAQSKRFAPSSEKLKDRVFDEAEQMAAAEPADDDEDEVLALPDTGLPEPDKPAGRK
                     RGRKPLPAELPRQRIEYDLTEDQKICPCCRGALHRMGEEVSEQLHIEVKASVLQHVRF
                     KYACRHCERNAERTPVVTAPMPAQPLPGSNASPAMLATVTTGKYVDGTPLYRMEDALG
                     RAGIEVGRGTLANWIIRPAQLHYSRLYEALRRSLLSQPLIHGDETTVQVLKEEGKAAQ
                     SKSYMWVYRSAEDSEQPVVLFDYQPGRGQEYPQAFLAGYHGMLMTDGYKAWRTLEGVT
                     HFGCVAHARRMFVDAQKGQKKPSARVLKALESFQALYQVETLAKAELPEGETRVDYTY
                     RMRQQHSVPLLEALKAWLDQQAPQVLPESLLGKAIAYARNQWEYLSRYVTDGRAPVDN
                     NAIERDIRPFCTARKAWLFADTVAGAKASAMIYSLMLTCRACDVEPYAYLLHVLTELP
                     QRAPDADISDLLPFNFARRQTAPPHPA"
     gene            complement(210991..211251)
                     /locus_tag="CNE_RS37640"
                     /old_locus_tag="CNE_BB2p02050"
     CDS             complement(210991..211251)
                     /locus_tag="CNE_RS37640"
                     /old_locus_tag="CNE_BB2p02050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018313452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229049.1"
                     /translation="MAQTTAQRQAAYRARRGTAGKDGNGERRLDMWVSTEADLALARL
                     AHRYAVTKRQMLERLIARADDAIVRRLDPDSEQWDLYFNVPR"
     gene            complement(211384..211605)
                     /locus_tag="CNE_RS40510"
                     /old_locus_tag="CNE_BB2p02060"
     CDS             complement(211384..211605)
                     /locus_tag="CNE_RS40510"
                     /old_locus_tag="CNE_BB2p02060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954300.1"
                     /translation="MDCAAVGVGTAQFFRRQGKRNKLPRVADDFIDAGYAPAAVTTPV
                     NGDAATNTRPGTMPNHLAQPAQPLFSREE"
     gene            complement(212111..212899)
                     /locus_tag="CNE_RS37650"
                     /old_locus_tag="CNE_BB2p02080"
     CDS             complement(212111..212899)
                     /locus_tag="CNE_RS37650"
                     /old_locus_tag="CNE_BB2p02080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013954302.1"
                     /translation="MVESDPQQDQTKPSYPIASVDKALRLLRSFTDRGAIRVAEASRD
                     LDVARSTAHRLLEMLQHHEFVQQDPVSRAYVPGPALLKIGLSVVRNLDVRAVARPVIE
                     ALVDEVQESAHLVILSGRDMLIIDAVESPRMLRIGSRLGGTIPAHAAAGGRAMLATLS
                     DERIKELYPTEELKAVTPDTLTSRKDLLSELEQVRARGYAVSVAEVEPDVSTVAATIP
                     GSARTTPAAITISVPRSRVKRDDLPRLGKAAVSAALRVADRMAL"
     gene            213089..214498
                     /locus_tag="CNE_RS37655"
                     /old_locus_tag="CNE_BB2p02090"
     CDS             213089..214498
                     /locus_tag="CNE_RS37655"
                     /old_locus_tag="CNE_BB2p02090"
                     /EC_number="3.5.4.28"
                     /EC_number="3.5.4.n1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methylthioadenosine/S-adenosylhomocysteine
                     deaminase MtaD"
                     /protein_id="WP_013954303.1"
                     /translation="MTFTRKILRGGHIVSMDPNIGELVGDVLIEGDTIAAIGPDLNIA
                     DGSAEVIDASRHIVLPGFIDSHRHLFQALLRGLASDWSLFQYFVSMFGMLAPTMTPED
                     MYLGTTLGALDALDAGVTGVFDYSHNQSTPEHTDAAIRALRNAGIRAVFGYGGSMAEQ
                     AEILVPPFKSATLSNQAEIRRIRRQYFSSDSGLLTLGMGARGPDSSTMDVVRADWALA
                     RELGIRINIHIGMAALDLGSRPNVTRLCKEGLLGDDLIFSHCNLLTDDEFRMMADAGV
                     SATVTPEDECAMGHGWPPIAGLLKAGIRPNIGIDTCMAVGGDPFTAMRFALAVPRGLD
                     NQTMLEAHENPWALKLTARDVLEFATIEGARAIGQEATTGSLTPGKQADIVMIRSDHI
                     SMIPAIDPIASIVHHASRHTVDHVYVAGTAVKRDGKLLGTDMAELNRRAVAASDQILR
                     RAGVQRGWAPKQPQPHHAS"
     gene            214603..215088
                     /locus_tag="CNE_RS37660"
                     /old_locus_tag="CNE_BB2p02100"
     CDS             214603..215088
                     /locus_tag="CNE_RS37660"
                     /old_locus_tag="CNE_BB2p02100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="WP_013954304.1"
                     /translation="MTESARASDYAISRAHIEDTVARFVLALDSRDIDRAVACLAPRV
                     RWDYASVTGQPAAEFDAGALADRWRSSIVHTDASQHFLSMPYIGLSGDRATCVVHAQV
                     TVRLANRIGSHHLRTHGTYTFGLVRTDADWSIDAVAMAQLWSDGNPRIMELAAAGGVR
                     R"
     gene            215085..215453
                     /locus_tag="CNE_RS37665"
     CDS             215085..215453
                     /locus_tag="CNE_RS37665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954305.1"
                     /translation="MNPTHHAANSSLNRPLFVIFSDPGERPGELAQHIPAHIEYMVGL
                     EKRGALFMSGPFLDTSGEPAPSGMWIVRAASREQAHALAAGDPFHVSGARAFRVEAWQ
                     VHQGRIEMSIDLSDQKIHLS"
     gene            215520..216413
                     /locus_tag="CNE_RS37670"
                     /old_locus_tag="CNE_BB2p02120"
     CDS             215520..216413
                     /locus_tag="CNE_RS37670"
                     /old_locus_tag="CNE_BB2p02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="WP_013954306.1"
                     /translation="MNQQTRTHTVGLIAPGKIGLPFAANLVADGNAVWGYRRGSLAEF
                     EAIGGMAARSPQEVAEKAEIVFTCVSSADALDEVISGPHGLLAAGRSDLLVVDIGAMA
                     LGRKLSARETLRRAGIEMLDAPVSGTPPMVSARKGVVFASGEQTACERVRPLLTALGS
                     TVVYAGAFGAGSKLKFVANTLVAVHTAAAAEAMALAKAVGLDPKLVLDTIRPSAASST
                     MFNIRAPMMAEGRSRPVNGTVTGLVDVMDAILATADDAGAAMPLLNTAKRLYERACED
                     GYGAEDIAVMVKVLESLAVPA"
     gene            216463..217416
                     /locus_tag="CNE_RS37675"
                     /old_locus_tag="CNE_BB2p02130"
     CDS             216463..217416
                     /locus_tag="CNE_RS37675"
                     /old_locus_tag="CNE_BB2p02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="WP_013954307.1"
                     /translation="MSLETDFSPNIFPKARQPSTRALGLGIHRTGHVALRAPDPSAAA
                     EFAVSQLGFTLAGHDDEGRYYLSAAGPDPYSLVYTPGQGGLDHISYIVADHAALDEAA
                     ARLADANIPVTRHEPSLWSPGASLRFSTPAGHTLELTTGLITDVPIAATTLRPASASG
                     PIVCDHVVVRCSDLQAEMAFASRTLGLMESARIETPDATPVMTFFRASRLYHCLAVAQ
                     SPSNGLHHVQFTLKDGAAVFEAWEKMRSESRVELLWGPVRHGPGHNIACYFRDHVGHV
                     IEYSAEEEVIFDDEAYSPMRWSVEDPRSLDEWGTRPPESML"
     gene            217413..218351
                     /locus_tag="CNE_RS37680"
                     /old_locus_tag="CNE_BB2p02140"
     CDS             217413..218351
                     /locus_tag="CNE_RS37680"
                     /old_locus_tag="CNE_BB2p02140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954308.1"
                     /translation="MTQEHFQEGTGGRLPWRLGTVASDGRPVTVVETAGTLYLLEELI
                     ARTGTPAPAQTAVRDVIEQWDTWRPILTKLAGSSAAARPLERDRLDWLPAIPNPGKIV
                     CVGVNYRDHLAEMGSGAVRPERPFAFIKPRNTLLGHRQTLWLPPVTRKVDWEAELAII
                     IGRKAFQVAAQDAWNVVAGYCPFNDISARDWISDLVPGLGQDWILHKSFDGFGPLGPL
                     ITPAEFVRDPQDLAIRLSVNGEVRQDSSTANMVFDIASVIEYFSSVMTLMPGDIIATG
                     TPAGVGHGRGEYLKDGDRISLSIECLGELDTLVRRR"
     gene            218446..220173
                     /locus_tag="CNE_RS37685"
                     /old_locus_tag="CNE_BB2p02150"
     CDS             218446..220173
                     /locus_tag="CNE_RS37685"
                     /old_locus_tag="CNE_BB2p02150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1302 domain-containing protein"
                     /protein_id="WP_013954309.1"
                     /translation="MKRNAARAIWRRASPRRRILRARPTAIVTPVFAAVAMTVASVAN
                     AFEFDTGNEDLKARWDNTLKYSVAQRLGRPSGALTADANLDDGDRNFRQYGLISNRVD
                     LYSEFDLRYRDVGMRVSGAAWYDQVYNRPNDNNSPGTANAASVSSNHFPDATERLHGR
                     KADLLDLFAFGKAEIGDMSATGRLGKHTLLYGESLFFGNNGIAAAQSPVDLIKLLSVP
                     NTPFKEVIRPVPQISGQLQLSPNVAVGGYYQASWERDRLPGVGSYFSQVDILDAGGER
                     ILAGPNAIIPGGSPFYLARVGDLKAKNSGQGGVQLRLRPEGGDMEFGFYAARFHAKSP
                     VVYAFPGAGFNPVSGQVGAYQLVFPQDIKVYGASVTTTLADVNVSAEASIRRNMPLVP
                     HGGSVAVPVGVSADNAGNPLYPVGGTAHAQLSWVALLAPSALWQGGSFLGEIAWNRRL
                     SVDGNAATLDPNASRDATAIRMVFQPSYFQVFDGVDLSVPIGIGYGLSGKSSVIHPGF
                     GARHAGDLSIGVLGDYLKVWKFSLNYTHYFGSADGVLTPANAAVQNYSYAQSLRDRDF
                     VSLSISRTF"
     gene            220194..221567
                     /locus_tag="CNE_RS37690"
                     /old_locus_tag="CNE_BB2p02160"
     CDS             220194..221567
                     /locus_tag="CNE_RS37690"
                     /old_locus_tag="CNE_BB2p02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1329 domain-containing protein"
                     /protein_id="WP_013954310.1"
                     /translation="MKSSNMYLRAALCGMLAVSQLAGAAVPPEEAAKLKTTLTPFGAE
                     RAGNKDGTIPAWTGGYAEVPPGYKSGAPRPDPFSAEKALFSISAKNLDKYADKLSDGV
                     KALLKKYPDSYRLDVYPTHRTAAAPQWVYDNTYRNATRATTTGRGIGLEGAFGGIPFP
                     IPKDGFEAMWNHKLRWMGETTAFTGANYLGTADGKSVLAARVVNKTQNPYYDKSGSLE
                     GFKGANQLLRIFMTDPPFKSGEQYLIVDSINKPRQAWQYLTGQRRVRKAPTIGYDTPD
                     DVNSGQSYYDEAFVFYGDLDRYDWKLVGKREIYVPYNNNKYYQKTPIGQRLMAHHVNP
                     DLVRWELHRVWVVEASLAQGQRHVVHKRRFYLDEDTWAALMGEGWDAEGQLWRVQIQL
                     PLIVPEGPFIYTGGQISVFNLLAGSWVSMGDTDWENASTSSYLKLLDRLPATYFTPEA
                     VAGEGVR"
     gene            221645..222766
                     /locus_tag="CNE_RS37695"
                     /old_locus_tag="CNE_BB2p02170"
     CDS             221645..222766
                     /locus_tag="CNE_RS37695"
                     /old_locus_tag="CNE_BB2p02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954311.1"
                     /translation="MRTRSLALCIAAVACTVGMGLSGATAPARAGGPADVLERQALRS
                     VLAPASLMLAVTRAGERLVAAGERGIVLLSDDNGRSWRQAGVPVSVTLTSVFFASRTQ
                     GWAVGHGGVILHSDDGGETWSKQLDGVRAAQLVLAAAQAAVADTGATTGDRSTRRLRD
                     AERLVADGPDKPLLDVYFANEREGLVVGAYGLAFSTEDAGKHWQPADDRLVNPEGRHL
                     YRIRAVGSDLYLAGEQGALYRSRDGGRHFTGIKTNYPGSYFGMVTGPRDDLLIFGMRG
                     NLYRTQDAGLNWRQIDSGRTAALTDGIRASDGAILIVDGDGGLMRSIDDGKTFRNIPT
                     GIAGPINSIAQAADGSLILAGLRGVARLPLDKIRTGVEP"
     gene            222763..225249
                     /locus_tag="CNE_RS37700"
                     /old_locus_tag="CNE_BB2p02180"
     CDS             222763..225249
                     /locus_tag="CNE_RS37700"
                     /old_locus_tag="CNE_BB2p02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_013954312.1"
                     /translation="MKRVDTSSGQGRPDVSGLDASSGSLLERLLFNHRRVVVALCVLA
                     TLLLGYRATGLQLNAAFEKMIPTSHPFIAAYLENRQELSGLGNTLRIAVENTKGDIFD
                     ASYLETLRRINDEVFLLPGVDRSYVKSLWTPSTRWLGVTEEGLEGGPVIPNTYDGSAA
                     SLTELRANIERSGQVGQLVAANLRSSVIVVPLLDVDAHGQRLDYHEFSGKLERLRHKY
                     ENGSIRLHITGFAKVVGDLIEGLKHVVLFFGLAIAVCAGVLYWHTRCMRSTVLVVFCS
                     LLSVVWLLGLLSLLGYELDPYSILAPFLVFAIGMSHGAQKMNGIMQDIGRGLHRLTAA
                     RLTYRRLFVAGLTALLADAVGFAVLMVIRIQVIHDLAVAASLGVAVLIFTNLVLLPIL
                     LSYVGVNPEAALRSLRGDSASAGSADAGAVVAPRKHAFWAFLDRFTQRKWAALALGIA
                     MALGAASFIVRLDLKVGDLEPGAPELRRDARYNRDTAFMVANYAASSDTYVVMVRTPQ
                     FQCSRFSTLSLVDDLEWKLRQLPGVDGTSSFASLAKTAAVGMNEGSFKWHDVPRTQDM
                     LNAITTRAPREMFNQNCDLLTIYVYLRDHKSDTLDAVVKVVDQFGQTNNTADLKFLSA
                     AGNAGIEAATNIVVRQANGQMLLLVYAAVILLAFVTFRSWRAVLCAVIPLMLTTILTE
                     ALMVKLGIGVKVATLPVIALGVGIGVDYALYVLAVTLAELRQGNSLSASYYRALLFTG
                     KVVVLTGVTLAIAVATWMLSPIKFQADMGILLAFMFIWNMLGALILLPALACFLFPHA
                     SSEARVPAGATASSSSGRFRMGRGGPMDMN"
     gene            225287..226276
                     /locus_tag="CNE_RS37705"
                     /old_locus_tag="CNE_BB2p02190"
     CDS             225287..226276
                     /locus_tag="CNE_RS37705"
                     /old_locus_tag="CNE_BB2p02190"
                     /EC_number="1.13.11.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gentisate 1,2-dioxygenase oxidoreductase protein
                     NagI"
                     /protein_id="WP_013954313.1"
                     /translation="MKPGQAGEPEALAQRTEALHLLPGWFRRPTPLLWREMRSHCVPA
                     HWRYQEVRECLRQAAHEVSTEEAERRNLILRNPIPDNDHSTLRTLICAYQTMLPGERA
                     KSHRHSPHAMRVILESRGAYSIVDGHKHPMESGDIVLTPGGSWHGHGHEGSEQAFWLD
                     GLDVPLTHLLEPMFYEPHPDQWERVAQETTHSPMRFAWTDTMAALDRAEPDPTGHFGT
                     TITLPTPMMPTVTLKVCRWPANWANRPYRHTANTVYVVMRGSGRSEVGELEVDWSFGD
                     TFVAPAWSRVSHHATDDSVICTISDEQLMHWARYYRVEDLGRGEMPLPLQANP"
     gene            226301..227161
                     /locus_tag="CNE_RS37710"
                     /old_locus_tag="CNE_BB2p02200"
     CDS             226301..227161
                     /locus_tag="CNE_RS37710"
                     /old_locus_tag="CNE_BB2p02200"
                     /EC_number="5.3.3.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="WP_013954314.1"
                     /translation="MYLCRFDDDRLGVVEADTVFDVTPALEVLPTHRYPLPRVDPLIA
                     NLAAVRERIAGLRDGAPRLRLADVELLCPVANPGKIIAAPVNYVDHLHEGLSQPEIHH
                     GNKINEISQAGLFLKATSSLVGPSHGVFIQHPERRNDHEIELVAVIGKSGRNIPQADA
                     LSYVAGYCVGLDMTVRGPEERSMRKSIDSYSVVGPWLATADAVADPSNLTLSVTVNGE
                     HRQRENTSNLIMGIAQLIAFASSFYTLYPGDILFTGTPAGVGPVKSGDRLTASVEGVG
                     RMEVKVGLAR"
     gene            complement(227667..228694)
                     /locus_tag="CNE_RS37715"
                     /pseudo
     CDS             complement(227667..228694)
                     /locus_tag="CNE_RS37715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006491127.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            complement(228832..229830)
                     /locus_tag="CNE_RS37720"
                     /pseudo
     CDS             complement(228832..229830)
                     /locus_tag="CNE_RS37720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012406532.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(229838..231142)
                     /gene="ltrA"
                     /locus_tag="CNE_RS37725"
                     /old_locus_tag="CNE_BB2p02250"
     CDS             complement(229838..231142)
                     /gene="ltrA"
                     /locus_tag="CNE_RS37725"
                     /old_locus_tag="CNE_BB2p02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
                     /protein_id="WP_013954315.1"
                     /translation="MSEIPVHPRPRRLSDWINPMEARKVHSLIDKVYQRKNLEVAWER
                     VRANRGSGGIDGISVAAFAEQADQQLGRLQAELRAQTYQPQPVRQVSIPKVGKPGEFR
                     KLGIPSIYDRVCQQALLNRLEPVFEPIFDDANFGYRRGRSTHDALRKIWKEIEAGGEW
                     IVDADLKDFFGSVDHDKLLALIARRVADGRVLGLIKAMLKAGSFGQGRLFPSERGTPQ
                     GGVASPLLSNILLTPFDREMRRRGYQLTRYADDWVITCSSRAEAHAAIAAATKILTAL
                     GVQLHPEKTRIVQVQFGFEFLGYKIKRGRRLSLPAAKIRSGARSGALYAYPREKSIQR
                     LMDQVRRLTKRCIPLRTRDLIARLNPILRGWGHYYKRSHVRRIFNRLDRWIVRRIWSH
                     RFKRWRNRGWKLMTEARLYGDLGLVNLVGLIPSIASQHAASS"
     gene            231414..232550
                     /locus_tag="CNE_RS37730"
                     /old_locus_tag="CNE_BB2p02260"
     CDS             231414..232550
                     /locus_tag="CNE_RS37730"
                     /old_locus_tag="CNE_BB2p02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_013954316.1"
                     /translation="MNTTPNTALHGQNTTITGWLYMAFELGDKSWKLSLGDGVLGPSR
                     HTLGAGDLNAVLQVIAKAKARCGLAPQAPVRSCYEAGRDGFWLHRWLIEQGIANLVVD
                     SASIEVNRRARRAKTDRVDGDKLLSMLMRYYAGERRLWAVARVPTPQQEDERRLHREL
                     GRLRLERAAHSNRIRSLLVLHNLRVAHIGDRSWKHWWNAHGSQLPAGLSAEIEREVAR
                     LALVETQIKTIETQQRDAVKAGTQPAIALLARLRGIGLGSSWLLINELFGWRRFHNRR
                     EVAGCLGLAPTPYSSGESQVEQGISKAGNKRSRWLMIELAWAWLRYQPTSQLTQWFNE
                     RFARGSKRMRRVGIVAVARRLAIALWRYLEYGEIPHGASLKSVH"
     gene            complement(<233453..233723)
                     /locus_tag="CNE_RS40515"
                     /pseudo
     CDS             complement(<233453..233723)
                     /locus_tag="CNE_RS40515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014498647.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(233751..234791)
                     /locus_tag="CNE_RS37735"
                     /old_locus_tag="CNE_BB2p02270"
     CDS             complement(233751..234791)
                     /locus_tag="CNE_RS37735"
                     /old_locus_tag="CNE_BB2p02270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954317.1"
                     /translation="MLKASHCLKSQLTIALLTCLGASATAHAANGGVRLYGLIDTYIG
                     SIKPSGTAYSSWQLDNGGETTPFWGMSGEEDLGGGLSTVFALESFFRSDTGEAGRSAT
                     DSFFARSAYVGLSSDKFGELRLGRNSTPLLYLTTLFNPFAGSTRFSPLNVQNWTPNFG
                     RLIHGDTGWSNAARYISPTMAGFSVQLIYGLGEAANNNGTNNVGGFIRYQGGPLDVAV
                     GGNHTKTGTAITAFEPSQKVMFAGASYDFKVLKLFGTFNMTKNGQSELRTYTYQAGVS
                     APLGPGQLNASYVWTKNDRKTLADFNRTTAGIGYSYNFSKRTDVYANYLYDKLTTAAT
                     GNTFGVGLRHKF"
     gene            complement(234964..235902)
                     /locus_tag="CNE_RS37740"
                     /old_locus_tag="CNE_BB2p02280"
     CDS             complement(234964..235902)
                     /locus_tag="CNE_RS37740"
                     /old_locus_tag="CNE_BB2p02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="WP_013954318.1"
                     /translation="MKIIAYAEGGATALGVITSPTHYVAVSDIAPELPTGLIAILELE
                     HGLARLRDAAQGVQGDRALAAVTLKPFLDRPNAMWALALNFKSHVAETGLQTNADYPH
                     LFMRMPASYVGADEPIVAPPESIARAFDYEGELAVIIGKPGRYIPAQRAMEHVAGYTC
                     LNEGSVREYQVHNRQFGLGKNFEASGSYGPWLMTSDEFGDPAKHAVLTRINGVVRQRA
                     PLDDMLFDVARVISYLSQGYKLRPGDLIAMGTPGALKPQPDDVEGRDMSRQYGLFKVP
                     GLVHMRPGDQVEVEIDGLGILRNPVVRDEAYRGSTQ"
     gene            236489..236806
                     /locus_tag="CNE_RS40520"
                     /old_locus_tag="CNE_BB2p02290"
     CDS             236489..236806
                     /locus_tag="CNE_RS40520"
                     /old_locus_tag="CNE_BB2p02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954319.1"
                     /translation="MSEVVAAEPAADIENAREEWEREIPGLLELMDPDVPGMHATTSI
                     DFVVVLSGAITLELDSGVATVLHAGDTLVQNGVRHRWMNHGTERAWIAAVVLGTELST
                     RKT"
     gene            237011..238246
                     /locus_tag="CNE_RS37750"
                     /old_locus_tag="CNE_BB2p02300"
     CDS             237011..238246
                     /locus_tag="CNE_RS37750"
                     /old_locus_tag="CNE_BB2p02300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetamidase"
                     /protein_id="WP_013954320.1"
                     /translation="MTAGKIIIDQANDFDAADGSARDEIRRFAGDGGTDRSRRGLLKL
                     AGIGGASMILGGRAHAASGIEGERDGARVFDPNRHGKVHTLPSTPETVRVGEMDPAVQ
                     SVLEIESGDVVHYQNTWVHWGNEAKFGMSFAERNVIRKRYPQGPQSLVGPVSIKGAVP
                     GDVIECRMIRLRPIDWGWNSTVRGMGALPGDFQEPYLHYFRFDAERRFAEFAPGVLIP
                     LAPTQGAIAAQPAGDKPTSALLLGAYGGNLSLASLVEGTSLFVSVEVPGAKMWTGDSN
                     AAQGDGVVNQTGIESAMEDLRIQYVLHKRVALNAPLAETPTHWIVLGAGPTLEEALTA
                     ALRQMIGWISAATALSWHDVYALCSIEGSFRVTQYANQTNSNYSFPSPKVIHATLPKR
                     IFSAERQTKISRSLRPQNS"
     gene            238274..239548
                     /locus_tag="CNE_RS37755"
                     /old_locus_tag="CNE_BB2p02310"
     CDS             238274..239548
                     /locus_tag="CNE_RS37755"
                     /old_locus_tag="CNE_BB2p02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954321.1"
                     /translation="MISLRQDMEAAKAGVAPLASDGTQHLQWRIYILCGLVAFLDGFD
                     TQSIGPAADAIAASIGIDIKDFGPVFSASQIGFLIGAMIFSALGDRFGRKRMLVAGTL
                     IIAISSLGTAFASSYNELIVIRIVAGLGLGGVTPNFISLASEFSPLVLRARVVTMLWA
                     AVPLGGMVGSFVSSVTLSRFGWQAIFLLGCGAPLLLVPALVFLLPESREVQRGANDNG
                     AAQLRVSPIRTLFGEGRGLATLWLWLASWMTWALLVVIGVWTPSLLQRAGWTIAMAAS
                     MLGLLNAGGVAGTFLIGAALKFVSPQRALMLALIAATASIVMLGAFTHSFAVVAVAAG
                     LAGFFSSAAGGSLLALSASLYPEHVRATGVGWSLGFARTGAVLGPVCVGLLVGFQWSA
                     ASIYSAIALPGLVAAVLVVLLSRTSTFRAAIE"
     gene            239581..240045
                     /locus_tag="CNE_RS37760"
                     /old_locus_tag="CNE_BB2p02320"
     CDS             239581..240045
                     /locus_tag="CNE_RS37760"
                     /old_locus_tag="CNE_BB2p02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954322.1"
                     /translation="MPMSTEESNVNSLTLISYKQASQALEAAVRLAQGHNTALSFVVV
                     DSAGHLVAAARMDGTPFVTIEVARGKAFACVATGGQSGRALRQRYVDHPMVWGNISSL
                     GYGAPLLPAIGSQPIWVKGELIGAMGVSGGAAEIEEETLKNAIESIGGSVTP"
     gene            240175..240795
                     /locus_tag="CNE_RS37765"
                     /old_locus_tag="CNE_BB2p02330"
     CDS             240175..240795
                     /locus_tag="CNE_RS37765"
                     /old_locus_tag="CNE_BB2p02330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_013954323.1"
                     /translation="MLTIWGHQGSPNVQKVIWACEELGARYVRKDIGGAFGGTDTPSY
                     LAKNPNGRVPTIEDDGFALWESHAILRYLAARDPAKRLTSDDWQARAKIDQWMDWHCA
                     HLSPAIRSLVVLVVKPRSTMPTPEEIEAARAEIIPLLRLVDRELEQRDYVAGNTFTIA
                     DIPVAISYNLWKIMEPACADFPALEAWYARINRRVAFKPMSGQRRV"
     gene            complement(240883..241737)
                     /locus_tag="CNE_RS38890"
                     /old_locus_tag="CNE_BB2p02340"
     CDS             complement(240883..241737)
                     /locus_tag="CNE_RS38890"
                     /old_locus_tag="CNE_BB2p02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013954324.1"
                     /translation="MAERLPAQILQGDFGRATINTTEQAIVEHAHREFNVIIKLSGAD
                     TALQLESASLEVDDSSVVLLNPWVLHAKRPSDCGPTTILSLFLNPSWLANEFKDAAPH
                     LDYLFPRPREPIADELREKVNLLVAAITTRSLGSPGTCEERLKAVVGTVVRQYGNLDA
                     DGRALRNTRPTDHRIRKAIAYIHEHATENPQVSEITRSAGISRSHFFAQFSLCVGVPP
                     RHYIDSLRLGIATRWLATTDRPLVDLADELGFGTHSNFTRFFTKHMALSPSEFRRRTT
                     DIAFLEPR"
     gene            complement(241802..242314)
                     /locus_tag="CNE_RS37775"
                     /old_locus_tag="CNE_BB2p02350"
     CDS             complement(241802..242314)
                     /locus_tag="CNE_RS37775"
                     /old_locus_tag="CNE_BB2p02350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of ribonuclease activity A"
                     /protein_id="WP_013954325.1"
                     /translation="MLIMFSTSDLSDEHPDTTSVCQLQFRSFGLREHFAGPCATLRVQ
                     EDHRPVLRRLSTPGAGRVLVVDVGGSLRIGVFGDRLAGLAAANGWAGLVIHGVIRDSK
                     TVNGIDIGVKALGTTALRNASEQPGAEDNVPLTFGGVIFRPGEWVYCDADAVLISPEA
                     IQAAAPPQAY"
     gene            complement(242373..243356)
                     /locus_tag="CNE_RS37780"
                     /old_locus_tag="CNE_BB2p02360"
     CDS             complement(242373..243356)
                     /locus_tag="CNE_RS37780"
                     /old_locus_tag="CNE_BB2p02360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954326.1"
                     /translation="MRYPKICLGVLGIITAIGAGGTAQASAEAYPSRPIRLVVPFVPG
                     GVTDASARLVADKLGQALGQSVIVDNRPGASGNIGAEMVAKASADGYTLLLGFDGALV
                     TGTHITKPRFNVLADFAPITKVGDATLIFVTSPSVPAKNFKELVAYASSRKSTGLSFG
                     SSGTGTTCHLAGELLKEQAGINLQHIPYKGGSQALTDVLGGSLPVLCTAVASVSQYVK
                     SGQVRAIAVTGSQRIASLPEVPTLMESGVRNFSVDSWVGILAPAGTPPAVVTRLQREI
                     RKVLDQPETRARMLDLGITPVGNSPDEFAKQIRSDYARYGEVVKKAGITLN"
     gene            complement(243572..244054)
                     /locus_tag="CNE_RS37785"
                     /old_locus_tag="CNE_BB2p02380"
     CDS             complement(243572..244054)
                     /locus_tag="CNE_RS37785"
                     /old_locus_tag="CNE_BB2p02380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_013954328.1"
                     /translation="MIDLDKIDLRILAELQRDACLTNVELAARVNLSPSPCLARVRVL
                     KQSGLISRHVTLLDPRKLGLNVNVFIQVTLEKQTRAGLESFERAVLALPQVMECYLMS
                     GDSDYLIRVVVAEVQALEHFIVDKLTRLAGVASIRSSFALKQVKYQTALPLPEPTARK
                     "
     gene            complement(244062..244658)
                     /locus_tag="CNE_RS37790"
                     /old_locus_tag="CNE_BB2p02390"
     CDS             complement(244062..244658)
                     /locus_tag="CNE_RS37790"
                     /old_locus_tag="CNE_BB2p02390"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase"
                     /protein_id="WP_013954329.1"
                     /translation="MNHRIEQIAARAMPLRGDDIDTDQIMPARHLKCITFDGLEAHVF
                     GDERKLARARQRLHPFDDPRFAGAEILLVNANFGCGSSREHAPQALRRYGIRAIVGES
                     FGEIFAGNCVALGIACVHLADDAVRRLQAHCEARPATTLQIDLANMTLALPDATLAIG
                     MRDGPRRQLLNGNWDSLSVLLQGSHETRARLAILQSQP"
     gene            complement(244655..246088)
                     /locus_tag="CNE_RS37795"
                     /old_locus_tag="CNE_BB2p02400"
     CDS             complement(244655..246088)
                     /locus_tag="CNE_RS37795"
                     /old_locus_tag="CNE_BB2p02400"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954330.1"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase"
                     /protein_id="WP_013954330.1"
                     /translation="MGKTLYEKVFDSHALRELAPGQYQIVVDRHMLNEVSSPQAFATL
                     RERGLKVAYPERTFSTSDHTTSTLGDPEAVDDATSALQIATMRGNAAESGIRYFDPRQ
                     GEHGIIHVIAPERGLIHPGMVVVCGDSHTSTYGAFGAVAFGIGTTQVRDVLASQTMLC
                     EKLRVRRIDIVGKLAPGVYAKDVALYAIARLGAKGGVGYAYEFGGEVVERFSMEERMT
                     LCNMAIEGGARCGYVNPDATTYRYLQGRAHAPAGQRFRQSVARWEKVRSDADARYDNR
                     VTLHADEIGPMVTWGTSPDQAVAVHERIPVVSPALADTLGFMGLEAEQPIAGTRVDVA
                     FIGSCTNGRLSDFEAVAEHLRRGTYRVAAHVKALVVPGSRAVHEALIASGIDRLFTEA
                     GFEMRDAGCSLCCGMNADRLSGHQRCASSSNRNFRGRQGSPEGRTMLMSPVMVAAAAI
                     AGEIVDARRLFGIDGTAPPSSRTIEQP"
     gene            complement(246108..247313)
                     /locus_tag="CNE_RS37800"
                     /old_locus_tag="CNE_BB2p02410"
     CDS             complement(246108..247313)
                     /locus_tag="CNE_RS37800"
                     /old_locus_tag="CNE_BB2p02410"
                     /EC_number="2.8.3.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_013954331.1"
                     /translation="MKVLQNVRVIEIGRFITAPLAAQLLGELGAEVIKVESPKVVDPF
                     RTFDGGLYAGHFQSHNRNKRSLVLDFATPDGREVLQELLRDADVLLLNMRPGSETKLG
                     LDAEHLRRINPRLVHCSITGFGADGPYAHRPAFDNVGQALSGWMSMFHRGTDSRVPGP
                     PVSDTISGIYACIGILGALVERASTGRGRKVEVSMLEAMIALATEPLGQLSAYGSAPE
                     FFSRASKSQSYLVTCKCGRRIGLHLSSPEKFWQSLLGAIERPDLAQAYPDRQSRVHGY
                     DAIAAELSAVFATADRDTWMARLQQHDVPAAPELRLDELDADEQVRHLDIFYQLEHPD
                     YGPVRAANRAIRYDGDNASGFRVPPAFGEHSIEVLREAGIEEARIEQLVGAGTVLDHH
                     RPQAGGTQG"
     gene            complement(247310..248104)
                     /locus_tag="CNE_RS37805"
                     /old_locus_tag="CNE_BB2p02420"
     CDS             complement(247310..248104)
                     /locus_tag="CNE_RS37805"
                     /old_locus_tag="CNE_BB2p02420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citryl-CoA lyase"
                     /protein_id="WP_013954332.1"
                     /translation="MEKQELRSDMGWSTADRITVRGLDLCQDVLGKIALGDFAFLEVT
                     GRRPGAAESTVFNAILAVLVEHGMTPSAMVARLTYLGAPESMQAAIAAGLCGMGTTFA
                     GTAEGAARLLQGVQPLGTAKQYDVAETAARIVQEHRQQRLPVPGIGHPVHKPVDPRAV
                     TLFAIAEENGLAGPYVALMKAISLEAERAFGKPGQLPVNATGAIGAIASELGLSWKLC
                     RGLAVVSRAVGLLGHLAEEIEHPIANALWVRTEEEASAHLVQKEPQ"
     gene            complement(248152..249501)
                     /locus_tag="CNE_RS37810"
                     /old_locus_tag="CNE_BB2p02430"
     CDS             complement(248152..249501)
                     /locus_tag="CNE_RS37810"
                     /old_locus_tag="CNE_BB2p02430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954333.1"
                     /translation="MATSIQPTSIEAALPDLEKRTYDKVFWRTVPLFFVCYVISYLDR
                     VNIGFAKLQMLGDLNLNDNVYALAASMLFWGYVLFEMPSNLILHRVGARRWISRIMIS
                     WGCVSISMMYIEPLAALFHITPATMFYVLRFLLGVCEAGFFPGVVLYLNQWFPSHKQN
                     RVLAGFMFALPLSLCIGGPVSGWILQNMHEAFGHRGWQWMLLIEGLPAVILGIVVLAC
                     LTDSVDKARWLSADEKALIKRNLAAENAHKTHNFGAALKSPVIWLLCAILLTMNTGFY
                     GLSFWLPSIIQATGLKNIYHVGLLSALPYVVAGVFIVANAVHSNRTGERRLHAAIPAG
                     CAGIGLILSAAFASQLEMSLLLISVAAAGILGVAPLFWIFSGRALTGAAAAAGLAMIN
                     SVGSLAGITGAMITNVAKNVTGNVNSGTYVLGACLLLCCLLILLLPRAIVSADAHRP"
     gene            complement(249721..250998)
                     /locus_tag="CNE_RS37815"
                     /old_locus_tag="CNE_BB2p02440"
     CDS             complement(249721..250998)
                     /locus_tag="CNE_RS37815"
                     /old_locus_tag="CNE_BB2p02440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954334.1"
                     /translation="MTPTTKRPHDVPRVIHRRPPFVSLTTTQPTSTVARQPGGTKLKR
                     HRPNQRAWHAGILPILAIGLGGVAANAMAQAGPVAPGGSGHIYGVLDAGYVYQSGSVN
                     HANGTSSGPVVRNALQGGVARGSRLGFRGSENLGNDLKAIFVAEMGFYVDTGVSSQGA
                     QVLNQYPAGPLFGRQAFVGLASNAGTLTMGRQYTPAFLVTTLADPFFQGMAGNMANLQ
                     NTSGRASNSVIYVTPAFGGLTASAMYALGEVPGDSAKGRQYSANLMYQASRLNVGLAF
                     YNTNNAGASATSRTTTLAANYDAGIATLYGDLQIQRASMENPPGSTVLGGDRVFTSYN
                     SFLVGVSVPLGRHQFLLSYIYNRDMRSGPDSDRNAGQFAIGYKYHYSKRTYLYSAYGT
                     VTNHNGASYTIGDALSVNGNARRAFNLGLSHDF"
     gene            251029..251754
                     /locus_tag="CNE_RS37820"
                     /old_locus_tag="CNE_BB2p02450"
     CDS             251029..251754
                     /locus_tag="CNE_RS37820"
                     /old_locus_tag="CNE_BB2p02450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954335.1"
                     /translation="MCVILSYNKGNREERSPDMTNPSATQRSTLEYVVDSLRHAILSG
                     RLVPGQRLVEADLTRELGVSRGPVRESFRRLSAEGLVESIPNQTTMVRRYSQLEMKEL
                     FEVRAELEALAARRTASRMNEACVRERFLQATQPIWEDHHGMSPAAYFEENRRFHQAI
                     ADECGNAKLTDFIGRLQLPMIMFQLGNAIHGEAQQESVVEHRLIAQAIVSGDADKSAQ
                     LIREHLRRASEFVDRMPADTFRP"
     gene            252065..254761
                     /locus_tag="CNE_RS37825"
                     /old_locus_tag="CNE_BB2p02460"
     CDS             252065..254761
                     /locus_tag="CNE_RS37825"
                     /old_locus_tag="CNE_BB2p02460"
                     /EC_number="1.2.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013952931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate dehydrogenase"
                     /protein_id="WP_013954336.1"
                     /translation="MTNLASPRAQLLEQAQRRGDDDPQETQEWLDALEAVVAQCGQER
                     ARYLLGRLLDVAPTLGVSTTAQSNSPYVNTIPVERQPPYPGDAAMEARITAIVRWNAL
                     AMVVRANKAYGELGGHISSYASAADLFEVGFNHFFRGAEAGNGGDLVYFQPHSAPGVY
                     ARAFLEGRLSEGQLDNFRRESEGKGLCSYPHPWLMPDFWQFPTGSMGLGPIQAVYQAR
                     FMRYLEHRGLQATSGRHVWGVFGDGEMDEPESIAAIPLAAREKLDNLTFVINCNLQRL
                     DGPVRGNGQIVQELEALFRGAGWNVIKVLWGSAWDPIFARDHSGALLRAFAATMDGQF
                     QTYKAKDGHYGRAHFFGQNEALKALVAHMTPEEVAELNRGGHDLRKLHAAFAAARDHK
                     GQPTVILAKTVKGYGMGDAGQAQNTTHQQKKLDLDALKAFRRRFGLDLSDEDLEAMRF
                     YRPAEDSAELRYLRERRAALGGYLPARRRQADAVPVPALPQYGQFAVQAEGKEMSTTM
                     AMVRMLTGLLKDKTLGPRVVPIVADEARTFGMASLFRQVGIYSSQGQLYEPEDAGSML
                     YYREDIRGQILEEGITEAGAMSSWIAAGTAYSTHGTAMLPLYIYYSMFGFQRIGDLIW
                     AAGDQRARGFLVGATAGRTTLSGEGLQHQDGTSHIIAATIPNCRAYDPAYAYELAVIV
                     DEGMRAMMERQEDVFYYLTVMNENYAQPSMPAGVERDIVRGMYRLAQTERGGRGKVRL
                     LGSGAILREVEAAARMLAEDWQVDSEVFSVTSFSELEREAREVARQQLHQPLAEVAPS
                     HVERLLAGNAPVVAATDYVRAYPQLIAPYVRAPYTVLGTDGYGRSDNRPSLRRFFEVD
                     RAYVCVAALRALAAQGTVPAALVAQALERYGIDAGKPAPSLL"
     gene            255550..>255720
                     /locus_tag="CNE_RS40525"
                     /pseudo
     CDS             255550..>255720
                     /locus_tag="CNE_RS40525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954178.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
     gene            255662..256532
                     /locus_tag="CNE_RS37830"
                     /pseudo
     CDS             255662..256532
                     /locus_tag="CNE_RS37830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019451394.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(256588..>257173)
                     /locus_tag="CNE_RS37835"
                     /old_locus_tag="CNE_BB2p02510"
                     /pseudo
     CDS             complement(256588..>257173)
                     /locus_tag="CNE_RS37835"
                     /old_locus_tag="CNE_BB2p02510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954180.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            257427..258599
                     /locus_tag="CNE_RS37840"
                     /old_locus_tag="CNE_BB2p02530"
     CDS             257427..258599
                     /locus_tag="CNE_RS37840"
                     /old_locus_tag="CNE_BB2p02530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954340.1"
                     /translation="MGSFLTHGCAMRRGSVRAEVEKHGDNMKSSLVGATFLVLTGVCT
                     AAGAQSQVTLYGRLNTSLEYSDATTASDGTRLGGTGRLTNNRSVFGMRGEESLGDSLK
                     AIWQIESSISLDSGGGQIAGRNTRIGLAGSAGSFFMGNWTTPYLEATSAYDPFYPTTA
                     GYMAIMGNGSTPTSNNVEDTSSFDRRQKNSIHYRSASWNGFRAGVTWGVNEERVTVPR
                     NPSLWSFSAAYDGGPLNLVLAYERHNNYQTAGRDDDGLKVGVSYQFPITRVSAIYERL
                     HYRTATGDLKRDAYYASVVQTLWTGSLRAGVGVASNGRGNATEAVGFFRSGADTGAVQ
                     ATIGYEYPLSKRTAVFGFYSRIFNKKNATYDFAINELGISAGADPQTFALGMRHTF"
     gene            258640..259620
                     /locus_tag="CNE_RS37845"
                     /old_locus_tag="CNE_BB2p02540"
     CDS             258640..259620
                     /locus_tag="CNE_RS37845"
                     /old_locus_tag="CNE_BB2p02540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954341.1"
                     /translation="MRFTTTRRAVLAMLLCLPLMHTAARADGFPSKPIKMVVPFAAGS
                     ATDLLARIVSAEMSTGSNMQIVIDNRPGAGGTIGTAVVAKSPPDGYTLLLTSAGHAVN
                     PTLYPKLSYDTTRDLMGVSTVATMPYLLVVGASSPYRTLKELLAAARARPDAVTYSSA
                     GSGSSSHLSGELFNVTAGVQTRHIPYKGAPAAITDVMSGRVDMFFAPSITALQFVKEG
                     KLRILGVATAARVPSMPDVPTIAEAGVPGYVFDAWFGVLAPAGTPKDIIAQLNTAMLK
                     ALGSPATKEKLKAQGAEAKPSTPGALDKLIAVDIAKLEPVVKRSGAQPGQ"
     gene            259680..261401
                     /locus_tag="CNE_RS37850"
                     /old_locus_tag="CNE_BB2p02550"
     CDS             259680..261401
                     /locus_tag="CNE_RS37850"
                     /old_locus_tag="CNE_BB2p02550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011614609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_041229402.1"
                     /translation="MARLASALVRAVAIGCLTAAAGATMAAPAQAVAHADRILVNGTV
                     LTMDAADGIAQAIAIRGDKIAAVGTNQEVRRLAGQHTEVVDLGGRTVIPGLIDTHIHA
                     IRGGQGYGFETYWYEGETTSLAAGLEQLRQTALARGAGKWVVVTGSWHPDQFAEKRAP
                     TSAELTALLPDNPAYVQYLYDYAVVNAKAIEVLGLEQADALPAGVRAERDGAGRLTGR
                     ILGAIRPLSALYARIHAQSNVDTAGNLAAFFGKLNSLGVTAMIDASAGPGANYDPLFA
                     LWREQRLPLRVSYRVSAMAAGNESDWLQNTLAYLPPRLGDGKLRFLGPGEMLVFGMDD
                     GVTMGPGFRPVAKDRAELLKVASFAASRGYPVEIHAYTDDAASAILDVFEEVARSHDL
                     GKLRWAMAHLNTGKPETFRRMKVLGLAYTVQMGPYFEAGAIGHANDNHVAESAPPVRL
                     ALRQGLKVAGGTDATRIGIPGVWRALEFHVSGYAIGKEVRRREEFRLTRLEALRLYTA
                     NAAWISFDENVRGTLEAGKLADLAVLDKPYLTVPMADIHRIRSVLTLVDGKVVHADGS
                     FASLKAR"
     gene            261402..261797
                     /locus_tag="CNE_RS37855"
                     /old_locus_tag="CNE_BB2p02560"
     CDS             261402..261797
                     /locus_tag="CNE_RS37855"
                     /old_locus_tag="CNE_BB2p02560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate isomerase"
                     /protein_id="WP_013954343.1"
                     /translation="MPHLIVEYTRNLGESARIGALLDTLCSTLAMQHGTFPVGGIRAR
                     AMCLDTYRIADGSADDAFVHVTLAVAAGRPGDVLGDTVNALFDAMIAHFAALYRRRYL
                     ALSLELREFSGAGTYRSLNNIHQRFSSLQ"
     gene            261846..262937
                     /locus_tag="CNE_RS37860"
                     /old_locus_tag="CNE_BB2p02570"
     CDS             261846..262937
                     /locus_tag="CNE_RS37860"
                     /old_locus_tag="CNE_BB2p02570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010811691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954344.1"
                     /translation="MKIGSMGAALIAATPALALAQSVTMYGVIDTGVEYVSNVGAAGD
                     GLVRMPTLTGTVPSRWGMRGTEDLGGGLKSVFVLESGFAPDTGGANQGGRLFGRQALV
                     GLSGKWGQLSFGRQYTMLFWANLDADILGPNVYGAASLDSYLPNTRADNAVAYKGSFG
                     GLTVGATYSFGRDAVNAGPSPTGTNCAGENPASQSACREWSALIQYEQKGWGVSAAYD
                     SLRGGPGAFGGLGSKSMTDDRLSLNGYVLLERAKLGLGVIRRDNEGSPTPRSDLWYGG
                     VTYDITPAFTMSGQVYYLKFHDSANKAMLYALRGAYAFSKRSSVYATAGYIDNGGQLA
                     LSVSAGAAGSNPRPGGSQFGTMVGIKHVF"
     gene            complement(262964..263899)
                     /locus_tag="CNE_RS37865"
                     /old_locus_tag="CNE_BB2p02580"
     CDS             complement(262964..263899)
                     /locus_tag="CNE_RS37865"
                     /old_locus_tag="CNE_BB2p02580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954345.1"
                     /translation="MDLRQLRYFKVLATLQHFGRASAALHIAQPALSRQIRLLEEELG
                     VRLVERHVRGATPTPEGLVLLDRASFLLRYANQVKIDIADLAASPRGLVALGLTPALA
                     PLLFIPLAEALRQRYPDIRLRLVENFAPALQDALLQGTLDVGLLSGPVSSAGVSAMPL
                     VTEDLCAIGPHDDMSLGDGPLDIEQLQHLPIVLAGLPKSGVRLALEALAARQGVALQV
                     AMEVESIEVARRLVARGFGWTVHFAAAIREELQTRQLRAQPIRGLALQRLIGYAAARP
                     PSRASLAVMETLKQVAVELAGTDHWPHSRLLEAAG"
     gene            complement(264010..265023)
                     /locus_tag="CNE_RS37870"
                     /old_locus_tag="CNE_BB2p02590"
     CDS             complement(264010..265023)
                     /locus_tag="CNE_RS37870"
                     /old_locus_tag="CNE_BB2p02590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_013954346.1"
                     /translation="MSKPTIKQIAQALDIHPSTVSRVLNPETRHRIGEDMVARVLKAA
                     QDLHYSPNRIAAALRTRRSGTIGVVVPDISSPVFPPIVLGIENALSRHRYIPIMANAG
                     GDKARQTFIVDQLLARQVDGLILATAERNDPVVAHCLTQGVPIVMVNRSDDAGRVSSV
                     VGDSRQAMALAVAHLHALGHRRIGHIAGPASVSTGHEREAGFLQALTDAGLSAAQCPV
                     VRAPAYTEAAGQAACAQLLARRTRITAVVAANDFLALGCYAAVRATGGSCPQDLSVVG
                     HNDMLLMHAVAPPLTTIRVHFYEMGTRAAALMLGALDGSITTTARTLLAPELVVRDST
                     RTL"
     gene            265246..266187
                     /locus_tag="CNE_RS37875"
                     /old_locus_tag="CNE_BB2p02600"
     CDS             265246..266187
                     /locus_tag="CNE_RS37875"
                     /old_locus_tag="CNE_BB2p02600"
                     /EC_number="1.6.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone oxidoreductase"
                     /protein_id="WP_013954347.1"
                     /translation="MKGAVSLSGRLPAYQEFREPEAAGGQVVVDVSAAALTRLDMAIA
                     EGRHYIKPPVEQFIVGREGVGRLADGRRIYFNVNAPAAPFGSMAQRALVDAELTFPVP
                     DGIDDARAAALGNAGLAAWLPLSWRARMLAGETVLILGATGISGLLAVASAKLLGAGR
                     VIAAGRDTQALERARRLGADAVVVLDSGTDLPAAYRKAAQGEVDVVLDYLCGSPAEAA
                     LQVLGHGGRLVHIGTTVGPTITFAGAAARKACFDIMGFAYYHAPIAEQARAYAELCRH
                     TETGRMEIDIEPTPLSEIAQAWQAQARGARQRFVLVP"
     gene            266355..266906
                     /locus_tag="CNE_RS37880"
                     /old_locus_tag="CNE_BB2p02610"
     CDS             266355..266906
                     /locus_tag="CNE_RS37880"
                     /old_locus_tag="CNE_BB2p02610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_013954348.1"
                     /translation="MDITPAEMEATRIARWGKVEPYRETFIESRLPGMKKNIYKIMNR
                     GVLENKGVEPAIPGNHRFGVTFIEIPVGQGASLHAHKTEEVFCPLNGRMELIWGAKGQ
                     YSLMLNQWDVISCPIGVMRGFRNPNDHALVVYSVVGGTDEECGRIAWHPDVVKAAEAT
                     GLVYGQDGFIKEAGANAADRAGD"
     gene            267004..268002
                     /locus_tag="CNE_RS37885"
                     /old_locus_tag="CNE_BB2p02620"
     CDS             267004..268002
                     /locus_tag="CNE_RS37885"
                     /old_locus_tag="CNE_BB2p02620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_013954349.1"
                     /translation="MNRRSALGWIAAGAAGLALGRGAVARAAGQTAAWTPSGTVRIVV
                     PFAAGGTTDLVARLLSDRLGKLLGRAVIVDNRVGAGGNIGIASVARAPADGHTLLLAS
                     TAFLTNPALFIQNPPYDPVRQFAPISELVSAPDLIAVRADSPLDSLAALVARARQQPG
                     ALTFATPGKGNSVHLGGELLWQRAGISLLHVPYNGAAPAIHAVLGGQVDCALTALPPA
                     RALLAAGKLRALAVGSLMPWPGLPGVPAIAGLGYPGYRSETMQALYAPAGTPGTAIAR
                     LASACAMLLGEETVRRQAAEMGFAVVAGSPEALARRVADEVPRWARVAASAKVRAD"
     gene            268071..268988
                     /locus_tag="CNE_RS37890"
                     /old_locus_tag="CNE_BB2p02630"
     CDS             268071..268988
                     /locus_tag="CNE_RS37890"
                     /old_locus_tag="CNE_BB2p02630"
                     /EC_number="1.13.11.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 4,5-dioxygenase subunit beta"
                     /protein_id="WP_013954350.1"
                     /translation="MSETNASGQRPRASSPRSIPADPQALLQAVLQANQGSANARTRE
                     VLDAAIRHLHAFAGEIGLTYEELHHGLDFLVRIGQATGPKKHEGILLADILGVATLVV
                     LMDAKAALAAGGTEPALIGPFWREEQPVRPNGASIASVDTQGERLRVRGRVLSLDGTP
                     IVGARVETWQAAPSGLYENQDPEQEDMNLRARFETDSDGSFWFDSVKPSGYGVPTDGP
                     CGELLRLQGRHHMRPAHLHFIVIAPGHKVLATQIFDELDPYAYSDAAFGAVGSLLRKF
                     EPDGNGGYRLDLELRVEPGESKVPRPPLP"
     gene            complement(269097..270134)
                     /locus_tag="CNE_RS37895"
                     /old_locus_tag="CNE_BB2p02640"
     CDS             complement(269097..270134)
                     /locus_tag="CNE_RS37895"
                     /old_locus_tag="CNE_BB2p02640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954351.1"
                     /translation="MPPRRVVHFPRAPAPPTIPMKRRHFILACAAWQLAAATAAHAHA
                     PDVWPSKPVRIIHGFAAGGPIDNLARLLAAQFQERFGQPAIVEARPGAGGTIAARYVA
                     RSAPDGYTLFLMASGHATAPELYKSLAYDPIKDFAVISMVARSPYAIIANPKAGYDTM
                     GHLLDAARRQPGKIDYGTGGNGTGMHLAAALLQAKTGVRLSHVAYKGGSATALAVVGG
                     EVPLIFTSLAGMSAYVDSGKVKVLAVTTRERFRLYPKVPTIAETVLPGFDVTAWYALA
                     GPRGLRPDVMARLGEMVRVTLQRDDVAESLRMQAAEPWYTSHEAAQRFVAEEVRLWRK
                     VIQDEGLAEMN"
     gene            complement(270178..271590)
                     /locus_tag="CNE_RS37900"
                     /old_locus_tag="CNE_BB2p02650"
     CDS             complement(270178..271590)
                     /locus_tag="CNE_RS37900"
                     /old_locus_tag="CNE_BB2p02650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013954352.1"
                     /translation="MNRTVIKNADILTMDAGLGELRADVLIEGDRIAAIGTDLPVHDA
                     EVIDATGMILMPGMVDGHRHVWEIIDMGRLVKSRPAEYAQTYQQWKMRTIVCMTPEDN
                     YLAGLIGGLQAIDSGVTSLFDFAHGQPTEACAMGAAQGLKDSGIAGWFGFQLGVSSSY
                     QAGDTVPLAKADGERIAKTTEVHWATAERLQRELFSDSSALLQLALAPSGNIGSSLDD
                     IRTEWTRARGMGVGMLAAHIHKPEHPLPAGIMGHRDSGIRDLHDAGLLGPDYQATHAN
                     RLTAEELAMLRDSGGMLCATAMGEFPYVMSASKGPSVHGRSRSAGVPTSMGIDISLAL
                     PGDYFEHVRATYWNLYLDPECRALMRACDSEYILDFATAHGAQALRLGDTTGSIQVGK
                     RADLVLLSTERVGFAMAGSLADRVVMFAGTADVDSVWIAGKARKRHGKMIGVDWRALK
                     AQLVEAQQRIGRQAATIRFT"
     gene            complement(271737..272666)
                     /locus_tag="CNE_RS37905"
                     /old_locus_tag="CNE_BB2p02660"
     CDS             complement(271737..272666)
                     /locus_tag="CNE_RS37905"
                     /old_locus_tag="CNE_BB2p02660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954353.1"
                     /translation="MDRLTAMSVFCRVVERGSFTVAGERLDMSTASVSKYVSALESHI
                     GTPLLARTTRRIVLTEAGKAYYEKCTRILDEIEDAERSAGVVQTTPRGLLKVRAPVSL
                     GHANLGRTVAEFTQKFPEVSVEMTLNDRFVDPAEEGVDVAFYIATAPKGSAEGASPIA
                     TMPRLLVAAPAYVEWHGLPAELDDLARHRCLVYTRGIAPNEWRFSPAGGDGKERAVHV
                     TGSFRCNHSLTLREALLEGAGIALLPAFLVLDDLAAGHLHAVLPDWCPQARTLYAAYP
                     QPRRSSPKVREFVSLVSRRFDFGTSFPLRMRDS"
     gene            272798..274360
                     /locus_tag="CNE_RS37910"
                     /old_locus_tag="CNE_BB2p02670"
     CDS             272798..274360
                     /locus_tag="CNE_RS37910"
                     /old_locus_tag="CNE_BB2p02670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013954354.1"
                     /translation="MGEPLTMTRKSFLRLSGAGIVAAAVGGTAGAQDVLAPRIQGVAP
                     PAMDTPRRTLIRHADVLTMDPQFRELHGVDVLIDNGRIAAIGKGLAAADAETIDATGM
                     ILMPGMVDGHRHLWQCMDAGRLIKMDPSGYSRAYLGWQRRAMACMTPEDNYLAELIGG
                     LQAIDAGVTTVLDFAHGQPSEETALAAARGVRDSGVSGWFTYQLGRAVAFGPGSTISM
                     ARVHADLNTTTEQSWKTVARLQKEVFSDSSAVLQLGLAPSDATGRPVGEVRKEWERVR
                     ASGVKILAAHLHKPATPTAPGTIGHRDSGIRDLYEAGLLGSDYHASHGNRVTAAELEL
                     LRETGGMLCSTVVGEFPYMLTPHMMASCHGRARHAGVAAGIGIDGPLVVQQDFFEHVR
                     GAFLSLFLEPEGRDLVRAYKSQDSLDFATALGARAVRLGDEIGSVAVGKRADLVLLRT
                     DRIGFAMQGSVADRVANFASLADVDSVWIAGKPRKRNGKMLGVNWSRLKTDLAAAQQR
                     LAARMATVNFTA"
     gene            274555..275628
                     /locus_tag="CNE_RS37915"
                     /old_locus_tag="CNE_BB2p02680"
     CDS             274555..275628
                     /locus_tag="CNE_RS37915"
                     /old_locus_tag="CNE_BB2p02680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_013954355.1"
                     /translation="MKHNARIVLAHACAVSALASLAPAAHAQSSVTLYGVADTFLEYN
                     NHQRAPAGTASSGGSLVRLNSGGLAGSRWGLRGTEDLGGGMQAIFALESGFNLDTGTM
                     GEAGRLFNRQAFLGVSTKDFGRLTFGRQYTSMFDLLPVFMPLVYAGAYEPMPFLMSPL
                     RIDNAVKYRVDRGPFAAQAHYGFGEQAGSWQGDAAWGGGVSYTSGELGLAAVYDQVNG
                     RDTATGYGRMRKVAVAGTYAPGDWRFTTGYRWAQDTMPTGVTRQRDDMWWAGVGYRVT
                     PFFQVNAAFYYDRMKVREGQANPPNPKQYVLQGIYAASKRTDLYAAVAYARDAGLNFA
                     ALSTLAAGARSQTGAAVGIRHKF"
     gene            complement(276004..276291)
                     /locus_tag="CNE_RS40530"
     CDS             complement(276004..276291)
                     /locus_tag="CNE_RS40530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007738795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569705.1"
                     /translation="MYEAEVLVDGILTPQPGGSRLSLPVSGGLSGSRRGLRGFEDLGG
                     GLGGLFVLESGFGLDSGTLTLGGRFFGRLAYVGMVSGWGQITFGRQYTDMY"
     gene            <276404..277877
                     /locus_tag="CNE_RS37920"
                     /pseudo
     CDS             <276404..277877
                     /locus_tag="CNE_RS37920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014615990.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing start; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
     gene            278264..>278527
                     /locus_tag="CNE_RS37925"
                     /old_locus_tag="CNE_BB2p02720"
                     /pseudo
     CDS             278264..>278527
                     /locus_tag="CNE_RS37925"
                     /old_locus_tag="CNE_BB2p02720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005797222.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            <278529..278720
                     /locus_tag="CNE_RS40535"
                     /pseudo
     CDS             <278529..278720
                     /locus_tag="CNE_RS40535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959257.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
     gene            278924..279000
                     /locus_tag="CNE_RS37930"
                     /old_locus_tag="CNE_BB2p02730"
     tRNA            278924..279000
                     /locus_tag="CNE_RS37930"
                     /old_locus_tag="CNE_BB2p02730"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:278958..278960,aa:Met,seq:cat)
     gene            complement(279111..279485)
                     /locus_tag="CNE_RS37935"
                     /old_locus_tag="CNE_BB2p02740"
     CDS             complement(279111..279485)
                     /locus_tag="CNE_RS37935"
                     /old_locus_tag="CNE_BB2p02740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010811174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954357.1"
                     /translation="MATARAGTRGEALKLLETEGVTVVELDYESGWQDAVELGRLGQK
                     VGIRVEYRGHENIAVRSPAALVAGLLRPKTTFRQRNLYCQFELNNLPADELESLEAKA
                     AKLGDYILAGHLMREVDAQWTE"
     gene            complement(279857..280057)
                     /locus_tag="CNE_RS40540"
     CDS             complement(279857..280057)
                     /locus_tag="CNE_RS40540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018314114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569699.1"
                     /translation="MLSPHEIAALLLLGDAQDIDDLEPDQLDGLLADKLVTMEHGHDS
                     GNACPRLTSQGHSMLEAVRSIR"
     gene            280259..280462
                     /locus_tag="CNE_RS37940"
                     /old_locus_tag="CNE_BB2p02760"
     CDS             280259..280462
                     /locus_tag="CNE_RS37940"
                     /old_locus_tag="CNE_BB2p02760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007581066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_013954359.1"
                     /translation="MATGTVKWFNDAKGFGFITPDDGGDDLFAHFSEVQGNGFKSLQE
                     GQKVSFEVKQGPKGKQAANIKPL"
     gene            complement(280571..282560)
                     /locus_tag="CNE_RS37945"
                     /pseudo
     CDS             complement(280571..282560)
                     /locus_tag="CNE_RS37945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013959256.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
     gene            complement(<282968..283240)
                     /locus_tag="CNE_RS40545"
                     /old_locus_tag="CNE_BB2p02790"
                     /pseudo
     CDS             complement(<282968..283240)
                     /locus_tag="CNE_RS40545"
                     /old_locus_tag="CNE_BB2p02790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011295780.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PHA-granule associated protein 4"
     gene            283806..284288
                     /locus_tag="CNE_RS37950"
                     /old_locus_tag="CNE_BB2p02800"
     CDS             283806..284288
                     /locus_tag="CNE_RS37950"
                     /old_locus_tag="CNE_BB2p02800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954361.1"
                     /translation="MVAPTKTTRVSATAKGKPTAKKLVVPTKKASVLAREAQAAKKHL
                     LKLRADTKKAIEAAKREVAQAVEAAKAAARFEKQAAKDKLAAKKAKAAGAKKATGNKA
                     VATKAVATKAAAKKAASGGKVKVAAKAAPKAAAVKSMPKKRASAKKVVPAVASPVASA
                     "
     gene            284381..284459
                     /locus_tag="CNE_RS37955"
                     /old_locus_tag="CNE_BB2p02810"
     tRNA            284381..284459
                     /locus_tag="CNE_RS37955"
                     /old_locus_tag="CNE_BB2p02810"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:284417..284419,aa:Met,seq:cat)
     gene            284896..285210
                     /locus_tag="CNE_RS37960"
                     /old_locus_tag="CNE_BB2p02820"
     CDS             284896..285210
                     /locus_tag="CNE_RS37960"
                     /old_locus_tag="CNE_BB2p02820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013954362.1"
                     /translation="MATYQDLLAQKQALEAKIEEARSTEVAGVIEQIRELMVRYSLSP
                     EDVAPRRRRGRPASTASAATEKAPLPPKYMDPKTGKTWSGRGRTPAWLGKRPERFLIQ
                     QE"
     gene            complement(285890..286705)
                     /locus_tag="CNE_RS37965"
                     /old_locus_tag="CNE_BB2p02830"
     CDS             complement(285890..286705)
                     /locus_tag="CNE_RS37965"
                     /old_locus_tag="CNE_BB2p02830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_013954363.1"
                     /translation="MNHGEGLTTRDLETRLGASRRLISSLVAAGLVTPARGPRGQYVF
                     SFQDVVLIRTAESLHRSSVAPARILRALRRLERLTPNRHLSALRISASSGKISAWDRH
                     GAWLVESGQRLIEFGPDEADVRVVDLTRTRANQATAEEAFARGYALEPVDADAAEAAY
                     RRALEISPGMLNAYLNLGCMLADQERFDEAIRLYEGALSVLPNAPQLHFNLGVAREDV
                     GALQSALAAYERCIELAPDDADAHYNAARLHQELGHFQNALRHFNAFRKLDRP"
     gene            complement(286702..287595)
                     /locus_tag="CNE_RS37970"
                     /old_locus_tag="CNE_BB2p02840"
     CDS             complement(286702..287595)
                     /locus_tag="CNE_RS37970"
                     /old_locus_tag="CNE_BB2p02840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018006585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ku protein"
                     /protein_id="WP_013954364.1"
                     /translation="MPARSLASLSLSFGLVSIPVKLYTATETSSAVRFNLLSKDGARL
                     KQQYVSEQTQKVVERADMVKGYEFEKDRFVTFSPDELKALEESASHMVDIVAFIPEHS
                     VDPLYYDKAYFIAPDKRGGKPYSLLREAMSKTGRCAIAKWASKGKSHIVQIRPVEGGL
                     VFQQLLFADEVRNIAELHIEEVAVSDAELKLAMQLIEQASEGQYDPAQYKDEEKVRIL
                     AAIDAKIAGKQIVSPEPVEVTAGGQVIDLMDALRASLSKKGAPAGRAKAAEPSTSRRV
                     GKRGTAPSEPTPIRRNTKKSA"
     gene            complement(287627..290149)
                     /gene="ligD"
                     /locus_tag="CNE_RS37975"
                     /old_locus_tag="CNE_BB2p02850"
     CDS             complement(287627..290149)
                     /gene="ligD"
                     /locus_tag="CNE_RS37975"
                     /old_locus_tag="CNE_BB2p02850"
                     /EC_number="6.5.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA ligase"
                     /protein_id="WP_013954365.1"
                     /translation="MATTPGTSKARARTAERLPNLDRYQKKRNFSVTSEPAGTRQRLQ
                     KANPLRFVVQKHWARRLHYDFRLELDGVLLSWAVPKGPSYDPSEKRIAVHVEDHPLDY
                     ANFEGEIPAKQYGAGSVIVWDRGTWEPIGDPREGMAAGKLLFDLYGEKLAGRWELVRI
                     AKPGDQSEQWILFKKRDAWARPLAEFDVLAALPDSVIAKPLGTLTQASQGSTEMASDS
                     AITDAPLAPLPAKLGPQLANPAPALPTGTGWVIETKFDGYRILARISDARVTLFTRNG
                     HDWTRMLRSLAAEIEKLDISEGWLDGEIVVLRDGMPDFNALQNAIDGHRSDAIVFFAF
                     DLPFWEGRDLRNVPLAQRRAKLGELVGDRSERVRFSEAFDAPPAQIFLAACQLGLEGL
                     MFKRADASYVSARTQTWLKAKCKLRQEFVIGGFSDRSGAVAEVGKLLLGVYADGELRY
                     VGGVGTGWDSATATELRRRLAALEIERSPFSTEARSSRRWGGGREAAVRWVKPTLVAE
                     VEFSEWTPEGQVRQASFKGLRADHPAKSIRREAIQTTVTPHGVSAIKVTNPDRVIDKS
                     TGITKVELVRYYESVAERMLPHLKDRPLSLVRAPDGIDAPTFFQKHAETAMPGLTEQP
                     QSLWPGHAALLTADSAEAIVAAAQMNAVEFHTWNSTARHIECPDRVIFDLDPGEGIAW
                     ETMVEAAMLVRTLLDELGLQSWLKTSGGKGLHVAVPLAPQRSYDEVKAFSRAAVKHLA
                     ATLPQRFTARSGAANRKGRIFVDYLRNGFSQTTAAAFSARARPGLGVSMPVSWEQLTK
                     LKSGAQWTIRDAREYLSFQVADPWQSYWEARQSLTAAIERLS"
     gene            complement(290118..290237)
                     /locus_tag="CNE_RS40550"
     CDS             complement(290118..290237)
                     /locus_tag="CNE_RS40550"
                     /inference="COORDINATES: protein motif:HMM:PF09954.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569706.1"
                     /translation="MSSGTTLAKRQQAELIVHGREVAIRMRNAYGNDPRDVKG"
     gene            290537..291502
                     /locus_tag="CNE_RS37980"
                     /old_locus_tag="CNE_BB2p02860"
     CDS             290537..291502
                     /locus_tag="CNE_RS37980"
                     /old_locus_tag="CNE_BB2p02860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF159 family protein"
                     /protein_id="WP_013954366.1"
                     /translation="MCYSAQIHASYRKYVREFGASVSFEHFVELFWEKRRDGGWSKLP
                     KAMRAAFLSAASDKERAVADLVAAGDKDQARALETELFQQKTRLTGAERALAAKPTKK
                     AENDQRIATDKIARAQRNLADLQRADLMDRDSRIFPGHYAPVMVVQDGQRVVIPMRYQ
                     CRLPGWTPAMERQKLGSYNARRDNLKKAWRQLYGYKHGIMIVNAFYENVARHRMEQRE
                     LAPGEPEENVVLEFRPEPRQDMLVACLWSFSKGGEGEADLYSFAAITDEPPAEVSAAG
                     HDRCIVPVKPEHVEAWLNPDAKNLAALDAILDDRNQPYYEHQLAA"
     gene            291572..292018
                     /locus_tag="CNE_RS37985"
                     /old_locus_tag="CNE_BB2p02870"
     CDS             291572..292018
                     /locus_tag="CNE_RS37985"
                     /old_locus_tag="CNE_BB2p02870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954367.1"
                     /translation="MRVGRPIPAPPQPLCDYCGGKAVLARVGEEAYPYLEDHGPVWIC
                     SPCQAWIGVRARSKQHTPLGRLADAALREKKSRLHDALEPLVTAKMRRDGVNAFEARG
                     KAMKWLIASLHIPVDSPSIHALSLDQCEQAIQFIAEFQASRGREPS"
     gene            complement(292039..295188)
                     /locus_tag="CNE_RS37990"
                     /old_locus_tag="CNE_BB2p02880"
     CDS             complement(292039..295188)
                     /locus_tag="CNE_RS37990"
                     /old_locus_tag="CNE_BB2p02880"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase"
                     /protein_id="WP_013954368.1"
                     /translation="MDINAAAGLPAYAELHCRSNFSFLAGASRPEELAERAAQLGYHA
                     LAITDECSLAGIVRAHTEARNAGLRLVVGAWFRLQNADGSPALSFLALARNREGYGNL
                     CELITLARMRAAKGFYVLTPRDLTAPEAPSEHLKGLPDCLIVFTPDYGVAAEKLEAQS
                     AWVSATFAGRAWMGLSLLYKPMDDIHRGTVEAAAARHHLRIVATGNVTMHVRSRKPMH
                     DVLTAIRVHRPVPECGYDLLPNAEQHLRSRLRLANIYPHRYLTESVHIANLCQFSLDE
                     LRYEYPEEVVPDGVTPSDYLRGEAYVGAQRRYPDGIPLAVQQQLEHELALIRDMAYEP
                     YFLTVYDIVRFARSNGILCQGRGSAANSAVCYCLGITEVDPARGNLLFERFISKERAE
                     PPDIDVDFEHQRREEVIQYLYRKYGRDRAALAAAVTTYRPRSALRDTGKALGVDPAIV
                     DLVAKSHHWFDSKADLLKRFGESGLDPDAELSQRWAHMAVSLLGFPRHLSQHTGGFVL
                     ARGKLSRLVPIENAAMADRSVIQWDKDDLDTLGLLKVDVLALGMLSAIRRALDLVMQQ
                     RGEAFELQDIPAEDPKTYEMISRADTVGVFQIESRAQMSMLPRLKPRTFYDLVIEVAI
                     VRPGPVQGGMVHPYLRRRQGLEPVSYPSPEMEQALSRTLGVPIFQEQVMQVAMLAAGF
                     SAGEADQLRRAMAAWKRKGGLERYHERIVTGMLERGYDPEFAESIFRQIQGFGEYGFP
                     ESHAASFALLVYASAWLKCHEPAAFLCAMLNSQPMGFYTPSQLVQDAKRHGVTVLPVD
                     VTVSGWDASLESHEGSVLAVRLGLSQLRGMRREAAERIETTRALRPFASVKDLARRAS
                     LDRHDANVLAAGNALIGLTGSRRQAMWQAAAAVPDKDLLRPADLDEPTPELPQPTEGE
                     EIVSDYRSLGLTLNRHPLALLRHKLAALRFVPADVLATYATRQIARACGIVTVRQRPS
                     TANGVVFLSLEDETGTVSVIVWPSVMEKYRREVLTASLLGVYGQWQCEGEVRHLIAQR
                     FVDLSPMLGSLDTASRNFC"
     gene            complement(295194..296657)
                     /locus_tag="CNE_RS37995"
                     /old_locus_tag="CNE_BB2p02890"
     CDS             complement(295194..296657)
                     /locus_tag="CNE_RS37995"
                     /old_locus_tag="CNE_BB2p02890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_013954369.1"
                     /translation="MLRLWICLRLSSLPLEVFRPNWSTELAVAVLDRERVHMASPLAI
                     AAGVKPAMRRGGVQTIAPQTILFDRDGCAELAALKRVTMAMLQFSPNVTASEEAAVLV
                     DISTTLRLFGGVRKLRQRMLAAVRAMGFNPVAGCAPTAEGAWLLARSGGGTALSMPTL
                     VRALVGMPVAILPAARPFDEWLDGLGCRTLGDLRRLPRAGLQRRCGAAILEALDRAHA
                     EAPEVFEWVEAPPSFDAAVDLPDRIENAESALAYIRGLLVQMVGWLTARHLAIKRFAV
                     ELCHERGRAAIAPTKIEIALAEPNWHEEHLVRLLKERLTRLTVEAPMIAVAVSAIETE
                     PVAPPSDSLFPEPGGTPADHARLLELLVARLGADHVRQPCLRADYRPEVANSWQPATD
                     KPPSATLPSGLPRPVWLLSKPMPLIERDHRPFYGSPLRIVSPPERIESGWWGGQLVTR
                     DYFVAEAKDHTCYWIFQERMGSRESDAARWYLHGLFG"
     gene            complement(296584..297288)
                     /locus_tag="CNE_RS38000"
                     /old_locus_tag="CNE_BB2p02900"
     CDS             complement(296584..297288)
                     /locus_tag="CNE_RS38000"
                     /old_locus_tag="CNE_BB2p02900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_013954370.1"
                     /translation="MLSVAPETIHPSLWLASQLARGNARTVPTGYPSLDKELPGGGWP
                     ISCLTELLQRQPGIGELRLLRPALVARSNRPVALLAPPHAPQALALANWGVPSAQILW
                     VEARHTADALWAAEQILRAGTCGALVFWQSHLRNDALRRLHLAAQASDVLFFVVRPTA
                     CAHDASPAPLRLTLEPASDGIRVQFVKRRGPQQESPLNVALQPSPILLYRHAAPVDLP
                     TPVIPAPRSIPAELVH"
     gene            297829..298773
                     /locus_tag="CNE_RS38005"
                     /old_locus_tag="CNE_BB2p02910"
     CDS             297829..298773
                     /locus_tag="CNE_RS38005"
                     /old_locus_tag="CNE_BB2p02910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954371.1"
                     /translation="MGGQGGRTLRTRVYVDGYNFYYGCLKGSRFKWLNLHALFENQIL
                     PSILHMGPGGSPDRHELRPVAVKYFTATIVETAAKGPDSVSSQDAYHTALENYCAGRL
                     QIIKGYFSVSQVRAPKVDHANPGKWPRHCERVDIWKFEEKQSDVQLALHAYHDALTGD
                     VDQVVIASNDTDLAPALQMIRDNTNVVVGLVNPTCDHRRPPNTSLVQLSHWTREHISE
                     QELAAAQLPRVVPRKRGVSLKPTSWYARPDLLTPALTLATKVRGSKGAAFKWLSTPNE
                     HLGGAVPLDLLESDEGAAAVITYMEDWIAKHPKSGDME"
     gene            299195..>299799
                     /locus_tag="CNE_RS38010"
                     /pseudo
     CDS             299195..>299799
                     /locus_tag="CNE_RS38010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011001781.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            299997..300773
                     /locus_tag="CNE_RS38015"
                     /old_locus_tag="CNE_BB2p02940"
     CDS             299997..300773
                     /locus_tag="CNE_RS38015"
                     /old_locus_tag="CNE_BB2p02940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954372.1"
                     /translation="MHMLTCHSQLSLFSSPLGRESATTGPALLLLACSGTKLDRPAPA
                     MDLYQGVMYESYRAHVRPEASPNVLILSARHGFIDPRDVIAPYDQRMTTQRADEILAD
                     LPAFAASADWPTQVGKVLLAGGKEYRRVMRAALVRQYGALPLTVHETTGGIGTQRSQL
                     GTFLDGLPSVFRDQIGQHANGTPIYRSYGWIEAGSIATLLYRAAPALPARQARVLSVF
                     NGPSGPTADVEVEEFVRGRAKICPRWVSVADLHPSTEESA"
     gene            300770..301101
                     /locus_tag="CNE_RS38020"
                     /pseudo
     CDS             300770..301101
                     /locus_tag="CNE_RS38020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354509.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            301185..302135
                     /locus_tag="CNE_RS38025"
                     /old_locus_tag="CNE_BB2p02960"
     CDS             301185..302135
                     /locus_tag="CNE_RS38025"
                     /old_locus_tag="CNE_BB2p02960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012435763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_049800775.1"
                     /translation="MDSLWLTNPTQAYRDWQAREAAGADRRPFSARSIVQHQAMFEHF
                     RRHLVVRGATIASFGTADVDAFWQSPDGRNYSQATRTRYVMLLDRLCRHLVFTGVRLD
                     NPAAPLLSAERWPDQEPTPLFLTAAEDARLQAYLLSPPDDVAGLRSRAIVAAFLGTGI
                     TAGEARAARLADLWPDATPPYLVVRAHGPRDARTVHLASFAVPILRAWSARRATLPLD
                     GDLLFTLTPDGRPITDMSLGRIVATALAEIGFSGAEPSPRTLRNTFCRRQLLAGHSCD
                     EVSQMLGLVSNRTCDRIAATLMPEAKRCETLQAAPAEANE"
     gene            302333..302782
                     /locus_tag="CNE_RS38030"
                     /old_locus_tag="CNE_BB2p02970"
     CDS             302333..302782
                     /locus_tag="CNE_RS38030"
                     /old_locus_tag="CNE_BB2p02970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013954375.1"
                     /translation="MATKAKPVAKTATKTAAKKAAPAKKDTPVTKAAPAKKAASAAPV
                     AKPLKDTFNKSSLLAHLIAQTELDKKTVQTVLAHLENTIVSAIHKKGAGEFTFPGLFK
                     VSAIQVPATKKRFGKNPFTGQDQWFAAKPASVKVKVRAMKKLKDAAM"
     gene            complement(302851..304617)
                     /locus_tag="CNE_RS38035"
                     /old_locus_tag="CNE_BB2p02980"
     CDS             complement(302851..304617)
                     /locus_tag="CNE_RS38035"
                     /old_locus_tag="CNE_BB2p02980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-phosphoadenosine 5'-phosphosulfate
                     sulfotransferase"
                     /protein_id="WP_013954376.1"
                     /translation="MQTISLFPQGAFDPIEDKADQAIRAALAILEAGHPLVLAYSGGK
                     DSSMVAALALHAAALYHAAGGKPLVVATTGDTLVESPEVAHHYRQELVRMRRFGKQHG
                     FDVITRVVQPSMALTFQVKIFSGRALPSFPGTHGDCSTDLKIAPQRTFRRQLFRSLAG
                     QGRAEPVTLLGTRYAESARRSASMRQRGDSANVPVRNQDSEFVLSPVCDWSDDDIWEG
                     IALYGGSARPCYSDFEDMRRIYAHAAGTSCAVVADAILDGAGSSRPRKCGARLGCHVC
                     QMAEDKSLASMVEYDERYAYAAGLQRLNRFIRNTRFDWSRRHWVGRTISGGYIKIQPD
                     TYHPRMVRELVRYMLQLDYDEQCRAEQAGERPKFELLPLDMLIAVDALQSLNGLGRPF
                     AAWADWRDIHQRGVRYDIPDVSQVAQTAVPTARFLHVGAEWDDTAAPSDWTGLRNPYL
                     ESFTADSPCGPKLQVTTGGRELWALPTAQQFSVDPESALLISEFEVDRLLDVHDAGLA
                     PGQVTAGYRWYAQYGCLTLSHAQRGEHDEIARRTAYKDRLGLTLEYDVGALRSRAVPF
                     EDLPATSQLAWRQAATPQQSLF"
     gene            complement(304690..304887)
                     /locus_tag="CNE_RS38040"
                     /old_locus_tag="CNE_BB2p02990"
     CDS             complement(304690..304887)
                     /locus_tag="CNE_RS38040"
                     /old_locus_tag="CNE_BB2p02990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_013954377.1"
                     /translation="MNLIVDIDIGGRTFQGTAGPAEAAQHLRQLANEIERKVVDFSAC
                     REGKRLGGAEGGCAIAYLADL"
     gene            complement(304897..305172)
                     /locus_tag="CNE_RS38045"
                     /old_locus_tag="CNE_BB2p03000"
     CDS             complement(304897..305172)
                     /locus_tag="CNE_RS38045"
                     /old_locus_tag="CNE_BB2p03000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954378.1"
                     /translation="MSKIMISAEHAAKLLPRGKKVHTFFKVFGWMGADVDRTKVLAAF
                     ESAQRVEVSPDAACFGHELAVELDGMQTYIDTNQKALRKLVPKAVDA"
     gene            complement(305325..305507)
                     /locus_tag="CNE_RS40555"
                     /old_locus_tag="CNE_BB2p03010"
     CDS             complement(305325..305507)
                     /locus_tag="CNE_RS40555"
                     /old_locus_tag="CNE_BB2p03010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954379.1"
                     /translation="MNHIPMAVKAELDALREFRKVPAAAYIYVETNAAELAKWDATGE
                     SVSDIADLVLDIVAAR"
     gene            complement(305591..307918)
                     /locus_tag="CNE_RS38050"
                     /old_locus_tag="CNE_BB2p03020"
     CDS             complement(305591..307918)
                     /locus_tag="CNE_RS38050"
                     /old_locus_tag="CNE_BB2p03020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease SbcCD subunit C"
                     /protein_id="WP_013954380.1"
                     /translation="MRPLKLTLAGFHGVRDGMRRDSVTLDLTTLPPGLIALVGPNGAG
                     KTTLMDNLHPYPIMPSHASKMSADAFSYWDHLCGTRGEKDLEWEHAGKQYRSAFAFRN
                     PGKSRKAEYYLFERGANGDWVPLQLPDGTLSDGKADTYNRCIEAVMGSPEAFFTSVFS
                     AQNRRPIASYQASEIKKLLAELLGIDHLRDLSAKAGEVSKGLVRHLDALQRELVGLSA
                     QRERAARLGREIDQTDAALAVARRDRDGQTADGAKLLQERATLAAKQSASAATEARLR
                     ELRQRETELGARRRQLEADQRALAARSATRRRELEQLIASRKLVLAEGPAILAAAEQR
                     DVLQMAIGQKQGEFATQQQAVGRLEAQHTQHAALSTELQGLEARGKSAALFATSLKGQ
                     ADVIETVPCRADPMHATCPLLAQARDAKGKLAEQVILVQDLRTSYQAKVQAMKPMAEA
                     VALLPAQRAALAAMQSALARDQQELQRLTALAAKKPMLDVAQEGLAQAERDLAALTGE
                     AAASTARHDRDLAEAASQLSLVQRELSGLATEDVTGLLAAMDVRLRQSREAVVALDAR
                     IEALIRQQTSLTTECERVETVLSSLPAVQGKADRLSDEIAQWKLLAKALGNDGVIALS
                     IDDAGPALTRIVNDLLLACYGPRFTIAIQTQTTLANGDKREGFEIEVHDAESDSAKNF
                     AVMSGGQKIWINECLTRGIALYRAQDSGQSFQTLFTDEADGPLDPERKRAFMRMKREV
                     LRQGRYVREFFISHTPDLVDEADGAIDVASLAVAP"
     gene            complement(307906..308424)
                     /locus_tag="CNE_RS38055"
                     /old_locus_tag="CNE_BB2p03030"
     CDS             complement(307906..308424)
                     /locus_tag="CNE_RS38055"
                     /old_locus_tag="CNE_BB2p03030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954381.1"
                     /translation="MMLYPAGPDWAHTFQTALAAPTLAARLADAHGFTRSTQFQPFGT
                     GRGAVIAQRDHLLVLAVHAADDQHWYEVTPSLEMQNLLWSFSHGYASQWSALELKALS
                     GCTAWPDVIALARQQFAAVVRSLERALAGLPERDEPAIVPDMPSYDGDVMELPGDYLA
                     SMTGVEVSECAH"
     gene            complement(308585..310006)
                     /locus_tag="CNE_RS38060"
                     /old_locus_tag="CNE_BB2p03040"
     CDS             complement(308585..310006)
                     /locus_tag="CNE_RS38060"
                     /old_locus_tag="CNE_BB2p03040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease"
                     /protein_id="WP_013954382.1"
                     /translation="MLKAAESLLLAHFSDLHYSTGHLAEADRCFGFAVEHAIAVGSRV
                     GIVSGDSTDHRLDAHTPALRVLAERIRQLSGHMPVVMLQGTFSHEPPGTLDLFRLVGS
                     RFPVYIADRIHQVALRDGVFIASSGALFTPVEIEALLADESPEVIFTCVPTVNKAMLA
                     AAVGATEAATAVGDHLSAYLHAAGTVNRSFRARGIRTMGISHGTVNGCQTEHGVPMAG
                     FDHEFTIGALFDAHCDGFMLGHIHRAQQWDREGRLVAYPGSIGRFHYGEIGDKTYLQW
                     RVAPGLAETTPVVTPARETLCIDFNSPPDMDELARVAASATDKFVRIRWVVDEEHRQA
                     VDRDAIGVLFAKAAEVKLEGRVLPAVRSRAEGISRATSLSEKITRWGELTHVDTNPLL
                     DRLSMLEHAEPQAIADQLLQQLDREGTSEVAALAAPSMSPEFVIEATPAPVEAPAPVI
                     VKPSAPPPAMDWLTDDLFAEAAA"
     gene            complement(310146..311477)
                     /locus_tag="CNE_RS38065"
                     /old_locus_tag="CNE_BB2p03050"
     CDS             complement(310146..311477)
                     /locus_tag="CNE_RS38065"
                     /old_locus_tag="CNE_BB2p03050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954383.1"
                     /translation="MQRAIGYTDFNQPRSLIEERPARPPIIGKIRPGIKVLTKKAKEN
                     EQAVKIHDAGLARGDSFEAIGDEIERKTKLRNALVPKNTAWFTCRSSDFTNPATADEI
                     LQKYGEDRGDGLKLWRFPVIFAFDDWLANMPNQLKVWGTRGLQYFSEYGTDGKRYCKM
                     YAAPEVDQRAQRAKRLFGGRTIILRQDDAIADGVCDPHQCPQYQERKCNLSANFLFCV
                     PEIKGLGLIELPTNSIYVLQKAYAAMQTVALARGGRMAGLQFWLSKKAVEITRIGDDG
                     LPMRQEQMLTMLDAEIDMGALLDGADQMAPALDAASHAVTLLEGTNSAMSATAAPPAS
                     PVADISAMTLAPEPAPIVAPVSHAGPMSSEVDPDDRESVLADLAARLDMAKGQDKMDL
                     LAFARIEYGQGWTKRPKDVDRMIGEMQIALANPMAFREQVRARVREASASV"
     gene            complement(311429..311752)
                     /locus_tag="CNE_RS40560"
     CDS             complement(311429..311752)
                     /locus_tag="CNE_RS40560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018310419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569700.1"
                     /translation="MLSAIDQNSEIRAAIAATLARRRPDYVGLPNAWLNLCEAAHVAG
                     LAEPARAAFLSDVTTQRGADIALRLREHAASIRVAVVQYLLERRSNAPCNELLATPTS
                     TSLAA"
     gene            312386..312988
                     /locus_tag="CNE_RS38070"
                     /old_locus_tag="CNE_BB2p03060"
     CDS             312386..312988
                     /locus_tag="CNE_RS38070"
                     /old_locus_tag="CNE_BB2p03060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954384.1"
                     /translation="MDIAEQPGIFPAHLPQFPPDAVQAAQTESAAPDTGLKPITRLIS
                     EDRISRIVPETATKVQVSFSSVFTRRFLHDDYNFCAAKCSVARGGKVKALDEAFREAE
                     EWFTRVTEWLATKNQVEFSIGYETVALEVPNALAGRLVRLLNQYDKLSSATLFAHIGR
                     SISGAERDTQLDIASRRINIIHTLCIPDNDRFADDGSRLS"
     gene            313032..313637
                     /locus_tag="CNE_RS38895"
     CDS             313032..313637
                     /locus_tag="CNE_RS38895"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049800776.1"
                     /translation="MDIRDIQRLHEQFAHAPLTLEAPTSSNHTTPGLLPPPAYAYAAA
                     GATRRWAERAGGARLIVTVIVGIVAAGALGMSIATWLHGRETTAATPESAAPAPMQTM
                     APEKESAPAPAVAAVADAASVPASAQPVEPRARVAEPAQPSVQPSPPVAAPVPRPSPA
                     SGAREAAPVARKAEPAPAVAKAPPASPAARRADGAAEIKLF"
     gene            313647..314084
                     /locus_tag="CNE_RS38080"
     CDS             313647..314084
                     /locus_tag="CNE_RS38080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954385.1"
                     /translation="MKDTPLFSVLNRGMSIHGDVAADHGITCLGLVDGNLSSSAGLLH
                     IAAGGIVRGKVEGDHVIVDGIVEGDVAARSTLILNGRVKGEIFYAGTIRLGMNANLES
                     KISRVAAIAAGTGAHVFAREAVVAGSVDPAEMADANTAATPST"
     gene            complement(314271..315512)
                     /locus_tag="CNE_RS38085"
                     /old_locus_tag="CNE_BB2p03080"
     CDS             complement(314271..315512)
                     /locus_tag="CNE_RS38085"
                     /old_locus_tag="CNE_BB2p03080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954386.1"
                     /translation="MRDRISKQRSQLILSQPFFGALLMRLQLVEDPSCKTFWVNGVSL
                     GYNPAYVATLSDLELRGCLAHEVLHPANGHCWRRGVRDPGRWNHACDYAINPLVLNAG
                     LQLPAGALIDGRFLGKSAEEIYAMLRQEGSEQPQPQQPPQPAPQPQPQQDGSGQGDGS
                     GPPQPDGQDGPDDSSAGGDPSQASPEFSPGEVRQQPQAAQQALANEWKVAAMQAAKAV
                     QMRGKLPGDLSAMVASATRASVDWRSVLHRFAFEQTRSDYSWAMPNRRYTHMGLYLPA
                     LHDQSVGDAVFVRDTSGSVFDETQAQFGAEIEAVFTSLQPRRLFVVDCDTRIAQVQCF
                     ERGEAIELGPIRGGGGTSFVAPFAWLEEQGVHPAFLVYLTDMDGKFPSAPPAYPTLWA
                     STTPLRRIAPPPFGEAVEVIV"
     gene            complement(315520..316437)
                     /locus_tag="CNE_RS38090"
                     /old_locus_tag="CNE_BB2p03090"
     CDS             complement(315520..316437)
                     /locus_tag="CNE_RS38090"
                     /old_locus_tag="CNE_BB2p03090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954387.1"
                     /translation="MNIQDIIKRVMLATFNTSVWRARKFDTRATEEVEANHDTKDIGR
                     FNKKLLTEGATSYKEVCAIANRARAYFDAHSLDYDQLGVRLLPTDMYMEVADRQRQFQ
                     DEFNAATAVFLGDYPRLKDEAREALNGLFDEADYPTQAELAKKFGMRLAVLPFPDASQ
                     FDIALPANVLDGLKTDMDQRVLGAVKTANDDLVGRLFEAVQHFANRLYGATNVRLDVA
                     DKVRELSALLPKLNFSGDPALTRILEDTQQHLARHSGLDLRNSTELRKQVAEKAMEIE
                     AQMAAFMGGPPPSSDATAPASPMFQMLTA"
     gene            complement(316527..317552)
                     /locus_tag="CNE_RS38095"
                     /old_locus_tag="CNE_BB2p03100"
     CDS             complement(316527..317552)
                     /locus_tag="CNE_RS38095"
                     /old_locus_tag="CNE_BB2p03100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013954388.1"
                     /translation="MKVNPSQLHTLLAAFIPARLPVLITGAPGIGKSDIVASAAKAAG
                     YDLLISHPVVEDPTDSKGLPFPATDGAGAKFLPFGDLATALNSLRPLVWFIDDLGQAS
                     PAVQAAKMQLLLARRIGEHVLPDHVTFVAATNRRSDNAAVSNILDPLKSRFSTIVELE
                     PTIEDWTRWAVTNHVPPVLIAFLRFRPDLLLSSERSKEVENLPSPRGWGHLARQLPLV
                     PPGMEIIVSAGAVGEGAALEFESFRQIYRELPSVDSVLAAPESARIPDKVAAQYAICS
                     ALASVANENNFDRVMVYANRLFEAHLGEFAVMLATDAARRDSRICATPAWINAQGCKL
                     GELLLGN"
     gene            complement(317843..319408)
                     /locus_tag="CNE_RS38100"
                     /old_locus_tag="CNE_BB2p03110"
     CDS             complement(317843..319408)
                     /locus_tag="CNE_RS38100"
                     /old_locus_tag="CNE_BB2p03110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954389.1"
                     /translation="MYVISTGPERVDTRTTLAGVLAYLNLEPGPKPGLRAEGISVRHV
                     ERGAIPVLRLHSGQFAVRPAGDPKAILTSILDEVERFIVRPQGKVLRPHEMSRTSWLA
                     VYAAGRLAVFTNEAVDPDQVADLGAANLDLFAVVEPFDAYEFIRVEFDRRFGYGTNGP
                     EYSPGAGVNSRYEVHVAYALQRGEPVRDCILNAYRHDGDAADAGRHDLHWLRTLIAVP
                     ALRGALSPGKLQSLCDVMRQDELAITDRNAARLIALVKPLPDDCTYVTVDDALYAAQV
                     IPPLAAPVGKPPSGDDAAPVSPLAARLHSLIGAKRYAERLARAQAERARGAMSERCLQ
                     RETALAAIERDHASFSWPNRFALAVMQRDIATLLQTLDTPNDRNTSSKRALREQFGVV
                     LTGVPAVTRRRRIFELCGFSEAEQQHWEAQAQTARTERLQADDAERARERAEASRWSV
                     DGRKMNGREYVDLCINQGFSQIRHFPRGSARVYYIEQPATRTIRRLQAKDGTLDYARS
                     RLAVASASMAVAA"
     gene            complement(319478..319843)
                     /locus_tag="CNE_RS38105"
                     /old_locus_tag="CNE_BB2p03120"
     CDS             complement(319478..319843)
                     /locus_tag="CNE_RS38105"
                     /old_locus_tag="CNE_BB2p03120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954390.1"
                     /translation="MEEHIIGAGMVSYPAGLQLRVHVYRNNNRPALALICADDYLPYL
                     DLTANVPDQELAEDEVFIAAWNVPNDVLTALLESGWFVPARTIATGYIRGPVWKIQSA
                     DLLAWIADAREDALADMPQ"
     gene            complement(320102..320572)
                     /locus_tag="CNE_RS38110"
                     /old_locus_tag="CNE_BB2p03130"
     CDS             complement(320102..320572)
                     /locus_tag="CNE_RS38110"
                     /old_locus_tag="CNE_BB2p03130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954391.1"
                     /translation="MTTLIKVTFTGTTGEETTGKAQYDHASGLVTLPTSFLTLIEQAK
                     AVGIGYALVAHEDGYQFPLLHDGGATYRMDRSRRARRSLLVLAWKAVAEPTKEQRQQS
                     GRFAHTLSAAAVIGAAGYLGTNHTWSIRAVTDVISLVGVGVVLFFAGAILSKGD"
     gene            complement(320582..320962)
                     /locus_tag="CNE_RS38115"
                     /old_locus_tag="CNE_BB2p03140"
     CDS             complement(320582..320962)
                     /locus_tag="CNE_RS38115"
                     /old_locus_tag="CNE_BB2p03140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954392.1"
                     /translation="MKIPKSFTQPHQPGNAASCANLKRDASRVFRRLACDLGLRQRDF
                     TVRERRHRRHQADLYALHTDSLYVQIAHAPQQNAAHMSFRTCRGRDDHTGGRDNAVCL
                     HSIGSPEGYASLVATLRVVASRRS"
     gene            complement(321157..321537)
                     /locus_tag="CNE_RS38120"
                     /old_locus_tag="CNE_BB2p03150"
     CDS             complement(321157..321537)
                     /locus_tag="CNE_RS38120"
                     /old_locus_tag="CNE_BB2p03150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954393.1"
                     /translation="MQSITPIQTEGKTVDQVTSLLARTLRAIDLEPEWIIPANHFADA
                     NEAQYGLLPDAVWPAEHARHRFAVSVDRGCSEGWRVHVDHIATAVEGPTGSTALRKLV
                     VAKMFSRDQAWQTARVINRLLDID"
     gene            complement(321731..322225)
                     /locus_tag="CNE_RS38125"
                     /old_locus_tag="CNE_BB2p03160"
     CDS             complement(321731..322225)
                     /locus_tag="CNE_RS38125"
                     /old_locus_tag="CNE_BB2p03160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013954394.1"
                     /translation="MLAHFHVRPACSSVISSSLHLSVLSVAALLSSPNVYRGSDAMRA
                     GSAEQVTVVRVRNVTIAGDSMLSANSGVPAILSTLVGAVLGARVIGNGDGRYIAGALS
                     GTAAGVIGQVAATHLSQRDGVEVIVRTDSGRQLVVAQGADQQFVVGEQLYLVSSGGGY
                     RLTR"
     gene            complement(322350..322544)
                     /locus_tag="CNE_RS40565"
                     /old_locus_tag="CNE_BB2p03170"
     CDS             complement(322350..322544)
                     /locus_tag="CNE_RS40565"
                     /old_locus_tag="CNE_BB2p03170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569701.1"
                     /translation="MFYFKGCNPAVDAEFYENARRGFGGDDFGERLSLTGLKETLANA
                     DCKSVRITVTPRSIRIDAFA"
     gene            complement(322551..322787)
                     /locus_tag="CNE_RS38130"
     CDS             complement(322551..322787)
                     /locus_tag="CNE_RS38130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229406.1"
                     /translation="MAMRLSWQILLNRHSSFLAGQSPSGACSVHLFRMPQITLSRSQV
                     ESLVAFCDAAKSEKFFIAKDHGAYVGYSTGPKPE"
     gene            complement(322848..323579)
                     /locus_tag="CNE_RS40570"
                     /old_locus_tag="CNE_BB2p03190"
     CDS             complement(322848..323579)
                     /locus_tag="CNE_RS40570"
                     /old_locus_tag="CNE_BB2p03190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954397.1"
                     /translation="MNQIIQIDPRQLKAIALLAPKQDPRHWLNGVFVEAMARETRLVA
                     MDGQRMGVFRAEKANQLGDAICVSCILPHNVIECVKPVRGKFGLLDLRLDTERPGWAE
                     LVHGGTPFEFVRRDPCYPVYRRAIGPHRGSGEPGQCDPRHLYDFHRVFLALEGKLAAD
                     RGGVYLHHNGTDNTRVSLCGREDFVGTVRPREADGPALLFWAESPVPVARVNPADVPT
                     PDRQPTGCSVKVRFLTIPCLFGKLP"
     gene            complement(323728..324396)
                     /locus_tag="CNE_RS40575"
                     /old_locus_tag="CNE_BB2p03200"
     CDS             complement(323728..324396)
                     /locus_tag="CNE_RS40575"
                     /old_locus_tag="CNE_BB2p03200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954398.1"
                     /translation="MTSVPSRRASAARQNDSAMRDHATTPDESWGFFLRAARVQCWVS
                     SEAKRVIYGSYRGMIELIINESKHNNHLTRVGQLLEAASNVVIVSGWLKKEGVDVLKS
                     ALLAAVGRGATVTVYSNKGDRAEETEQVAIQRLTELGVSHVLVRDFYLHSKIYYFEQG
                     DRYTALIGSANLTRGALCSNEELSVEVSGNLGDTQHTQIFAYLARVKARIPAKASVLA
                     RVAG"
     gene            complement(324350..325144)
                     /locus_tag="CNE_RS38145"
                     /old_locus_tag="CNE_BB2p03210"
     CDS             complement(324350..325144)
                     /locus_tag="CNE_RS38145"
                     /old_locus_tag="CNE_BB2p03210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="WP_013954399.1"
                     /translation="MSFEHHIPETMRVNAWKVVVVGAGGTGSALLPALARLHHAMLEL
                     GHPGGIECTVYDDDTVSETNVGRQGFYPNDVGQHKATLLVNRLNLLMGTRWEARPRRI
                     GSQDRFVCDMAVGCVDSRAARKAILGALERGTGGYYLDCGNETDRGQVILGQVRGKRE
                     SRLPHVGDLFPELIDPRGDKADTAPSCSMADALRKQSLVINQAIAVQAFNLLWTLFRT
                     GTLKYSGVFVNLEAGRTNPLPIDPAAWARFGYDLSAKPTRKRGAAK"
     gene            complement(325144..325785)
                     /locus_tag="CNE_RS38150"
                     /old_locus_tag="CNE_BB2p03220"
     CDS             complement(325144..325785)
                     /locus_tag="CNE_RS38150"
                     /old_locus_tag="CNE_BB2p03220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954400.1"
                     /translation="MHPMDITLQQSFPSVMVPRFGELAPLEATGERLLIAANGVFLEV
                     SRPWLRLVRRVGQFDVKTAVPYGTAAEATDLRCGKLPAHLIGQFAELARAAMPNETGS
                     WIVWHPATCAFRLVPVTMLSHGRGHLQYDRPALADGEVLVVDCHSHGNFPAYFSSTDN
                     DDDQHDVKFAFVMGNCLAATPSLCLRLCAKGIFEAVDRVPGDWYAAARAQEVV"
     gene            complement(325794..326510)
                     /locus_tag="CNE_RS38155"
                     /old_locus_tag="CNE_BB2p03230"
     CDS             complement(325794..326510)
                     /locus_tag="CNE_RS38155"
                     /old_locus_tag="CNE_BB2p03230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954401.1"
                     /translation="MAKIHSASRDHDVALQGAILLYGTDLSAFSYATAHRIVTDAQTG
                     RPVIGAGTPLNRRALIQAVRQVAEASLPKGEFLTPNVLSIGPDAITWWCPPGNRRVYF
                     NCEELGDRSAMTPHPGLVFHASPAGFRVFALMEDERPTPESMLYEPPYFNTWDHGKIC
                     IGTAHVPKQIDAASIAGWEGAFFASAFTHPNHGGKRVDYDDGFYAFWRDMLDGRFPTF
                     PKAALIPMNQSLGNLIAGQF"
     gene            complement(326520..327653)
                     /locus_tag="CNE_RS38160"
                     /old_locus_tag="CNE_BB2p03240"
     CDS             complement(326520..327653)
                     /locus_tag="CNE_RS38160"
                     /old_locus_tag="CNE_BB2p03240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954402.1"
                     /translation="MLFDARPSDEIFIASGPGWTPSRQPPAARRRPAHGFLTLPSLSA
                     EIPARGKLQYGEGADTLRLIRKQFETGVLAARDVQGAASAGDAFAQAMFAWLRRRMPK
                     CKRLNFSFALLDLAAAREQVDQFGWDEDLHAPLYLAIELDEEAVFEIGKRADIMRRAD
                     PALLYTATHLVNEAAGRSLFVRTPDELADMFARWWWECDPTMSDEEAREFLGERFGDA
                     DSSEIERYLPSKVLPVLAPDDAVPAFARRDKSVRIDCLRAPQLEALAGQKRGLPRRIC
                     LALLDLQAVLARTRRSRALNHAQWAEPAYSAATLCMWRGHWVGQILDDHFDSLNCGGD
                     ATMYQSLIPLANTPRAIRRQFKQLADMMDVIAALDRVLTLISE"
     gene            complement(327756..327974)
                     /locus_tag="CNE_RS38165"
                     /old_locus_tag="CNE_BB2p03250"
     CDS             complement(327756..327974)
                     /locus_tag="CNE_RS38165"
                     /old_locus_tag="CNE_BB2p03250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012217989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954403.1"
                     /translation="MSLTVQQLTREFIYNGMTLMDPGPAFSTDQVRDMYTAQYPELTT
                     ATVDGPVHNGTVMRYTFVRAAGAKGCHA"
     gene            complement(327986..328444)
                     /locus_tag="CNE_RS38170"
                     /old_locus_tag="CNE_BB2p03260"
     CDS             complement(327986..328444)
                     /locus_tag="CNE_RS38170"
                     /old_locus_tag="CNE_BB2p03260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954404.1"
                     /translation="MFQELVPLVTACDKVVLTLTMKGDAMAVVVAPVVSKAADAALAT
                     PLALTASPAELDEGFAQAISSVSVSHRSLAEQVEATASILNAATSAQSTKAQKALSKA
                     NSKPVASSSDDADGTDGTDDNAEGEGKAAAPAPQASSPEPSGTNLADLLG"
     gene            complement(328509..330173)
                     /locus_tag="CNE_RS38175"
                     /old_locus_tag="CNE_BB2p03270"
     CDS             complement(328509..330173)
                     /locus_tag="CNE_RS38175"
                     /old_locus_tag="CNE_BB2p03270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_013954405.1"
                     /translation="MQSPTIALGKIRPGRNPRKYFDAAEMAELTDSVRENGVIQPILI
                     RPLGDDGYELVAGERRLRAARAAHGDDYPIPVTIREMTEEEADRLALIENVQRADMAP
                     SEEAVAAARIVGQLKGDREEAAKILGWSRSTLDKRLGLMNCSTSVLDALNTRTIQLGH
                     AELLATLAKDKQDKLLPVIVGEKKSVAELKKTIEAAACSLATAIFDKADCAACPHNSS
                     LQTEMFGEAIATGNCTNRACYTQKTDKQLETVAYGLKDEYPVIRIVRAGDNHTRVQLV
                     VDGPTGVGEDQAKACHACEHYGAAVSALPDSIGKVFRGQCFDTACNSKKIAARLKAER
                     DAKANAQKPAAAAAGSSTTAKGSTKTPAEEKAVTHISETEKVKAYRVALWRKALRREA
                     ASVPETANIYLLAVALSGLSRNIGGDIMGKIFEKLTDEKATSTDLKKNLSTVQELDAG
                     KRVTLTTAMTVAAIEGIEVNHLVALCQYHKLDLRQHWNLQKSKDFLGLLTKSEIKVLA
                     DELGLRAALGDNFAKVFNKSKPDLIEALLNVDGFEYAGKLPKVLRF"
     gene            complement(330717..331622)
                     /locus_tag="CNE_RS38180"
     CDS             complement(330717..331622)
                     /locus_tag="CNE_RS38180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954406.1"
                     /translation="MGEAKRRKLLAVSDQVTSKPASVGLWPLSNASTQQGLDAWFVQR
                     GIDPSRPRLHDTPEFLRAEAQDPKALNMVARLVETRSYTADELQQAERKILVAAEAVA
                     DRVARDGRHGLCVVASGVLSRILDELGVWNYTAKSNLAIHFPLSVSVTPRYFYSIDQR
                     QFVAPHAIVVAPPFTVVDVTVRHQMYDKDAMAQYLPVMAATKEFRPYRVTPTELVSPE
                     SRAILRRQGMPVETYLARERSAMLELMKQLPSREVTLDGGRLGYGLVAVGGYQERLHE
                     LHGKNCSINGLMPMEIFEQDVLPKL"
     gene            <331717..331992
                     /locus_tag="CNE_RS40580"
                     /pseudo
     CDS             <331717..331992
                     /locus_tag="CNE_RS40580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006158140.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
     gene            complement(331886..332212)
                     /locus_tag="CNE_RS40585"
                     /old_locus_tag="CNE_BB2p03290"
     CDS             complement(331886..332212)
                     /locus_tag="CNE_RS40585"
                     /old_locus_tag="CNE_BB2p03290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954407.1"
                     /translation="MPIYGFVSVCSLSIILDCRGQRRRKTLFAPKPRMSPFDGRIHLR
                     YFRFGSGSVQPLAAAKRSSRDDRRSQGADFSNRWLRRRGSAGSPPRLNAAAFRRPRGG
                     ATVSGA"
     gene            332228..333229
                     /locus_tag="CNE_RS38185"
                     /old_locus_tag="CNE_BB2p03300"
     CDS             332228..333229
                     /locus_tag="CNE_RS38185"
                     /old_locus_tag="CNE_BB2p03300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954408.1"
                     /translation="MRINHAAQICALSASDLEDFVDDWIAQRCKDYSAHELWRGTGDM
                     GRDVTGYVTDRRLEGPWDNFQCKQLSSKLSEHSAFVELGKIFKNSADGAFSLPRAYTF
                     VAPYGLVRNARDYIAHPEKFRQAFLDRWDTYIAEDLVENQVVKLTPKIEAKIKAFDFK
                     KVDWIDATRLAKDPACKPALVAWFDADPGSWVRDVVPDEIQASESAYIGQLLKVYDEK
                     GPGTYSDAAAALACPEVGPNLRIQRTRFFDSVAFERFYRDSTPKEYLANFKDEIYLGV
                     VDVHQGAHTDRFSRLGRVMQQAAVLQPSGVLAKHASPPVKQGTCHLLANEGLLPWDH"
     gene            333217..333729
                     /locus_tag="CNE_RS38190"
                     /old_locus_tag="CNE_BB2p03310"
     CDS             333217..333729
                     /locus_tag="CNE_RS38190"
                     /old_locus_tag="CNE_BB2p03310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954409.1"
                     /translation="MGPLGRNAPAHPFNSTLETGIRALVVLEAFYPRRCDLLEMTWLD
                     HLVVHTGDLDGQDVPGSLHPDLPNRAGELLVRRQLVEKSLRLMQQVHLIDVIETEDGI
                     AFGASEDAPSYLDLLQAPYSLALKERAKWMADRFAGMQSAEMRALIESRIGRWTADFR
                     VEELPVGNRK"
     gene            333726..335591
                     /locus_tag="CNE_RS38195"
                     /old_locus_tag="CNE_BB2p03320"
     CDS             333726..335591
                     /locus_tag="CNE_RS38195"
                     /old_locus_tag="CNE_BB2p03320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954410.1"
                     /translation="MNGIRLRHLVFTGPNIESAELEFDDGLNIIYGASNTGKSFASKT
                     ILFMLGANTSLPETEEVAAYDGAWLGVTLGEQGDFTLYRATRGGHLKLYTGLVKGAPA
                     DNGEVLREKHDQKRTDTVSHRLLDVIGLADKWVVRDGNGKKDSLSIRLLSKYAVVAED
                     DIMSETSPVYLSGSPSERPFERNLFKLLLTGNDDSAAVTVPKETERKAAKTAKIELVD
                     ELLAQLDAELGEEPPVEKETDEQLRRLDQSADGLLTRLQTAQNELDSLVVERRTTVDR
                     CRELEERADELELTLQRFAKLQGVYTSDLERLHSIEEGGYVLVAMAGRDCAVCGAPPG
                     AQIHNHAADEISMAHTAAAAEARKIEREQRELAHVVASLEAEAVGLRKTIEKHNADTE
                     KLDGTIQGLRPQEASLRESYETYNAKRTEILKVLDLYQRRAKLAARRAEIGAMPTKRE
                     GEPAPVGPDSTTMFDFGETVKAVLKAWKFPDADKVQFDGRANDITVGGKSRAANGKGV
                     RAVLHAAFNVAVIVHCIDNKLPHPGFLVLDTPLLTYREPLESKYGDLSPDEAALKATS
                     LAEHFYKHLASLAAHVQVIVIENSDPPSAMNGLARIETFSGKQGNGRAGLLARPA"
     gene            complement(335935..336114)
                     /locus_tag="CNE_RS38200"
     CDS             complement(335935..336114)
                     /locus_tag="CNE_RS38200"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229409.1"
                     /translation="MRSAPQIAQLALREAFSAIAGEAAIRDFAAGGEEGEEMCATGRL
                     RSSPANLRIFSLQSS"
     gene            complement(336177..336392)
                     /locus_tag="CNE_RS38205"
                     /old_locus_tag="CNE_BB2p03330"
     CDS             complement(336177..336392)
                     /locus_tag="CNE_RS38205"
                     /old_locus_tag="CNE_BB2p03330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954411.1"
                     /translation="MSLCALCLSQLDRPGHVPPHPKLVKSATLRTTSGENAFAYRCSH
                     CGETLLLASVDGEAPDRWMRLEADDWS"
     gene            complement(337018..337800)
                     /locus_tag="CNE_RS38210"
                     /old_locus_tag="CNE_BB2p03340"
     CDS             complement(337018..337800)
                     /locus_tag="CNE_RS38210"
                     /old_locus_tag="CNE_BB2p03340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II aldolase"
                     /protein_id="WP_013954412.1"
                     /translation="MISTTDPHRNRKPRNISDEEWAVRVQLAAAYRLAAKFNLTDLIY
                     THISVRVPGTTDQFLINPHGWFFDEITASCLVKIDTDGRPIADDRFEVNAAGFTIHSA
                     LHQSRHDVECVVHLHTNAGMAVAALECGLLPLNQISMQFYNRVNYHDYEGISLDLDER
                     SRIVKSMGDAHYLILRNHGLLTTGRTVAEAFTRMFYLNRACEIQVQTLSMGQKVTIPS
                     GDVCEHAARQHDDYAYLSTVHLDREWTALLRLLDRDGGDYRC"
     gene            complement(337823..338188)
                     /locus_tag="CNE_RS38215"
                     /old_locus_tag="CNE_BB2p03350"
     CDS             complement(337823..338188)
                     /locus_tag="CNE_RS38215"
                     /old_locus_tag="CNE_BB2p03350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA/YER057c/UK114 family protein"
                     /protein_id="WP_013954413.1"
                     /translation="MTVTAPAIVRLDQNHRRSRAVIANGMVFLAGQVADDKAGDIASQ
                     AQEVLAKVDALLAEAGTDKGHALTAQVWLADMADFDGFNAVWDAWVAPGETPTRCCGH
                     VALADPAYRVEIVVSALLR"
     gene            complement(338197..339177)
                     /locus_tag="CNE_RS38220"
                     /old_locus_tag="CNE_BB2p03360"
     CDS             complement(338197..339177)
                     /locus_tag="CNE_RS38220"
                     /old_locus_tag="CNE_BB2p03360"
                     /EC_number="1.1.1.95"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_013954414.1"
                     /translation="MTSSRTSSAVELDGIPSSATAWRAVFVDANPTLAEVSLRIRRDD
                     DLPLAVNRQPDIRPEGLPEALAGAPIAIIDHTHLPTEVAYQCKGLRHVVFLGTGARSY
                     MNPEQLAELGITVHTIKGYGDTAVAECAFALMWAAARNFSRMDREMRAGNWLRSDAVQ
                     LTGKTIGLVGFGGIAQELARLARGIGMRVIAWNRTPKTHADIEFVDLDTLLRGSDVVS
                     LHLLLTDETRGLISAGRIASMRDGAILINTARGALVDEDAMVKALGSGKLAHAGLDVF
                     TVEPMPPGHLLTTLPNVTLSAHSAFRTPEANNNLIEAALDHCRRIVQSSN"
     gene            339809..340930
                     /locus_tag="CNE_RS38225"
                     /old_locus_tag="CNE_BB2p03370"
     CDS             339809..340930
                     /locus_tag="CNE_RS38225"
                     /old_locus_tag="CNE_BB2p03370"
                     /EC_number="1.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_013954415.1"
                     /translation="MRIGVPTESRVGESRVAATAETVKKLVQQGHQVTLQAGAGLKAS
                     QPDGAYEEAGAQIGDIHAAFDADIVLKVRAPSTEEVPRMRQGAILVGMLGRLDQTNSE
                     LLAQVGVTAFSLEAAPRTTRAQSMDVLSSQANIAGYKAVLIAAQHYKRFLPMLMTAAG
                     TVKAARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPGVKEQVESLGAKFLDVSLLTD
                     EEREIAKGVGGYARPMPSDWLRRQATLVHERAKQADIIITTALIPGQKAPVLLPEEAV
                     MEMKPGSIVVDLAAADGGNCPLTVADEVVERHGVTLIGHTNLASMVAADASALYARNV
                     LSFLTILLNSNDARVLNMEDDIVKACLVSHDGRVRDAQS"
     gene            340945..341286
                     /locus_tag="CNE_RS38230"
                     /old_locus_tag="CNE_BB2p03380"
     CDS             340945..341286
                     /locus_tag="CNE_RS38230"
                     /old_locus_tag="CNE_BB2p03380"
                     /EC_number="1.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012353833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)(+) transhydrogenase"
                     /protein_id="WP_013954416.1"
                     /translation="MEVVGHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAIS
                     AIIIVGAMLAAGLTEGGVGRVMGTLAVALAAVNVFGGFLVTQRMLEMFKKKEPKAKAP
                     EAKQALAREGA"
     gene            341286..342761
                     /locus_tag="CNE_RS38235"
                     /old_locus_tag="CNE_BB2p03390"
     CDS             341286..342761
                     /locus_tag="CNE_RS38235"
                     /old_locus_tag="CNE_BB2p03390"
                     /EC_number="1.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013957960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="WP_013954417.1"
                     /translation="MTGLVSMNLVTLLYLVASVCFIQALKGLSHPASARKGNTFGMIG
                     MAIAVVTTLVLIVKLKNEFLAAGTAQSAVGTGLALIFAALVVGGGIGTYVAKKVQMTK
                     MPELVAAMHSLIGLAAVFIAVAAVSEPAAFGISPAGSHLIPLGNRIELFIGCFVGAIT
                     FSGSVIAFGKLAGRYKFRLFQGAPVVFAGQHWLNLLLAVAMVGFGIIFFMSQAWLPFL
                     IMLAIAFVLGVTIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGS
                     SGAILSYIMCRAMNRSFFNVLLGGFGGEAVAAGAAGAQAQRNVKSGSADDAAFLMGNA
                     ETVIIVPGYGLAVARAQHALKELTEKLAEKGVTVKHAIHPVAGRMPGHMNVLLAEAEV
                     PYDQVFEMEDINSEFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTIIV
                     NKRSMAAGYAGLDNELFYMDKTMMVFGDAKKVVEDMFKAVN"
     gene            complement(342805..343731)
                     /locus_tag="CNE_RS38240"
     CDS             complement(342805..343731)
                     /locus_tag="CNE_RS38240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011301151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine uptake transporter"
                     /protein_id="WP_080569702.1"
                     /translation="MREASPRQGILPVLRPNVKGISLIIVAVVCFAAFDSLTKWVGTT
                     VPLEMVIWFRYLFQTTLTAGVLLPIRGRAVFMTRRPYLQVIRGMLLVLVSVFAFLSLK
                     YLPVAEFTAIAMITPLVITLLATILIGEEVSVQRWMLLLGGFIGALMVVRPGGQQFGW
                     PMLLPLGFVIANATFQLVTSQLAKVDHAGTTHLYTGAVGALVMSLAVPFGWQTNIPWQ
                     WWLVLVVMGSCSSLGHFLLIKAYSHAPVAVLTPYLYGQIGFAMLGGWLLFSHVPDLWA
                     LVGISIVACSGVLGTCTSARMKLSAAVGDPAG"
     gene            complement(343813..344547)
                     /locus_tag="CNE_RS38245"
                     /old_locus_tag="CNE_BB2p03410"
     CDS             complement(343813..344547)
                     /locus_tag="CNE_RS38245"
                     /old_locus_tag="CNE_BB2p03410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013954419.1"
                     /translation="MEISVATSNLEEKPSPKPEARKRTSLSSAAIYERVKNMAATFEL
                     RPGERINEIDLSKQLDVSRTPLREVLNQLMVEGFLERTTNKGFVSRPLDVKQIFDLYE
                     YRLSLETAIGRLACQRATDDEIVQLERSVQEDAAVPEDSDSNQLLALDEAFHMRLAHL
                     TRNDEFVRALSNVNARIHYVRWIDMRNGRRPYTQAEHMQIVQALKARDEVALVKLLEG
                     HIARRKEQITEVIKLGFSEIYTRQRG"
     gene            complement(344656..346260)
                     /locus_tag="CNE_RS38250"
                     /old_locus_tag="CNE_BB2p03420"
     CDS             complement(344656..346260)
                     /locus_tag="CNE_RS38250"
                     /old_locus_tag="CNE_BB2p03420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013954420.1"
                     /translation="MNTLEAPAQASATAAQSSEMRKVILGSSLGTAFEWYDFFIYGAL
                     ATALGPLFFPPSLGQTAAFLASLATFGVGLVLRPFGSLIFGRLGDIVGRKYTFLVTII
                     MMGISTVGVGLLPTYATAGALAPFLLVLLRCIQGLALGGEYGGAATYVAEHARPDDRG
                     RATGWIQLTATAGFVLSLVVVTTTQSLTTAEQFASWGWRVPFLFSIFLLALSIFIRSR
                     LNESPVFLQMKAEGKLSKKPIRDAFGNWANLKYVLLALFGTVAGVTVIWYTGQFFALI
                     FLMRWLKVDPTTAYWMVSIALILGSPFFVLSGRLSDRFGRKKVILFGFISAVALIFPI
                     FKGVTHFANPALERASAEAPVTIHSSECRLRPFSGPETSCEKAREILNNAGVPYTVVP
                     SSESGAVVRVKDLSTENADKISIEKLLASAGYPAKADPAQINRPAVILLIWILVVLGC
                     IAYGPNAAYLVELFPTRVRYSSMSMAYHIGTGYFGGFALYFATLISTTTGDIYSGLFY
                     PLVIATISILVTAFLLPETKGWTLDR"
     gene            complement(346295..347113)
                     /locus_tag="CNE_RS38255"
     CDS             complement(346295..347113)
                     /locus_tag="CNE_RS38255"
                     /EC_number="1.17.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ectoine hydroxylase EctD"
                     /protein_id="WP_013954421.1"
                     /translation="MLTEEQIKFYDENGFLVLRDVFTPEELRALQQDAVVLRSDKRGH
                     PDANVLEKDGETVRAAWAVELDSEACARAYRLPRVLGAIKQLLGETYLHQSRLNYKAA
                     GKGDIFQWHQDYASWIHDGVPHGGHRDMLTVLITLDDSTPDNGPLRFIPGSHKHGLIE
                     PFYDTTTTSYPLHIVPDEYMEKHFSQSPIYECVFPAGTMVFFCGNLVHSSKENHSNDG
                     RRNLYFAYSRDGNRPTGAATRKHKNNYIMNPSPFTLQEVDDDSLARYAAGVVAA"
     gene            complement(347193..348680)
                     /gene="gabD"
                     /locus_tag="CNE_RS38260"
                     /old_locus_tag="CNE_BB2p03440"
     CDS             complement(347193..348680)
                     /gene="gabD"
                     /locus_tag="CNE_RS38260"
                     /old_locus_tag="CNE_BB2p03440"
                     /EC_number="1.2.1.79"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954422.1"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_013954422.1"
                     /translation="MQTKMENLRKVIRNAAVLRTGHLIDGDWYENIERNEFEVCNPAN
                     GEVLATLPSATNAQATAAVSAAHRAQPLWASKTAKERAAILMKWYELILANREDLAIL
                     MTLEQGKPLAEARGEVLFGASFVSWYAEEAKRIQGEVLQTYSADRRVLILRQPIGVVV
                     AITPWNFPSAMITRKCAPALAAGCSIVLKPSEETPLSAIALCALAREAGIPPGVINLV
                     MAGRDDAAALGRVLLSDDRVRKLSFTGSTATGKHLMRLAADNVLKLSLELGGNAPLIV
                     FDDADLDRAAEGALASKFRNMGQTCTCANRILVQRGVYQAFAEKLVEKVRKLRLGPGT
                     EENVTQGPLINSRAVEKVRAHIEDAVAKGARVIQGGHVSAKGPLFFEPTVLADVNPEM
                     QICSDETFGPVAPLLAFDTEEEALTLANATQYGLAGYFYTRDLSRAFRMAERLELGAI
                     GINEAVISSEAVPIGGVKQSGIGREGAHHGIEDFLEIKQVTIGGL"
     gene            complement(350411..351394)
                     /locus_tag="CNE_RS38265"
                     /old_locus_tag="CNE_BB2p03450"
     CDS             complement(350411..351394)
                     /locus_tag="CNE_RS38265"
                     /old_locus_tag="CNE_BB2p03450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein BugE"
                     /protein_id="WP_013954423.1"
                     /translation="MNRRTLLTCVLTGTLAFFGQNAVLAAQPYPTRGPIRLVVPFAPG
                     GTTDIIARLLANKLSTELKQTVVVDNRSGGGGVIGANEVVRAAPDGYTLGMATASTVA
                     ANPAINPKVPYNPLTDFTPISNVAATPNVVAVTASFPARSFQTFVAEVKKHPGKYSHA
                     SAGVGGQGHLMMEMLKSAAHLEITHVPYRGSGPAISDTVAGQTQVIYDNIPSILPFIR
                     DGKLVPIAVAAPKRVAALPNVPTFDELGLRQVNRMAFYGLVGPKGLPQDVVAKLSSAV
                     ARVIASPDFAKRIEETGSVTIGNTPQQFAVQIDAEYKALRKLVVEQNLKPD"
     gene            complement(351631..351840)
                     /locus_tag="CNE_RS38270"
     CDS             complement(351631..351840)
                     /locus_tag="CNE_RS38270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229411.1"
                     /translation="MSLCALCLSQRDRPGHFPPHPKLMKSATLRTASGENAFAYRCLQ
                     CGETLLLAAAEADAPDRWTCLDAED"
     gene            complement(351931..352311)
                     /locus_tag="CNE_RS38275"
                     /old_locus_tag="CNE_BB2p03470"
     CDS             complement(351931..352311)
                     /locus_tag="CNE_RS38275"
                     /old_locus_tag="CNE_BB2p03470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA/YER057c/UK114 family protein"
                     /protein_id="WP_013954425.1"
                     /translation="MTSAVTHIQRHHTNARLSKIVRHGGLIYLCGQTARGSPVATGDI
                     GTQTAEVLSRVDALLSEVGSDRTRLIAVTIYLRDMADFVGMNEAWEAWLAGKQAEAPA
                     RTTVEAALATEGLRVEMTVVAAEA"
     gene            complement(352308..353768)
                     /locus_tag="CNE_RS38280"
                     /old_locus_tag="CNE_BB2p03480"
     CDS             complement(352308..353768)
                     /locus_tag="CNE_RS38280"
                     /old_locus_tag="CNE_BB2p03480"
                     /EC_number="1.-.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_013954426.1"
                     /translation="MKAPRNVDHTAGANVGGGFTHDLVIIGAGPAGMTAAATASAYGL
                     RTVLLDEQRRPGGQIYRNVTAAPAAVAELLGPDYRHGTKLAQRFAASGVEVHHNTLVW
                     DVENDLTVYAQQSGRSFHVRAPQLLVATGAMERPSPMPGWTLPGVLNAGAAQIALKTS
                     AQVPDGNVMLVGGGPLLLLVACQLLQAGAKIAGIVDTTPASNRTRALPHLVGALGAPK
                     MLGKGLRMLWNLRRARIPVWKQCTGVRIEGDERVQAVSFTVGSATCRIAADTVLLHHG
                     VVPNTQISRLLRVKHDWSDEQLAWQPVLDDWGQTSLPGFRMAGDGAAIAGALAAEASG
                     AIAAIGAAAALGKFDMTRAEHLAGPWRARLASQRPIRPFLDALYRPPEWLTDCADETV
                     VCRCEEVTAGNVREMARLGCEGPNQTKFFSRCGMGPCQGRMCGITVTQVLAKALNRTP
                     VEVGAYRIRAPLKPVSLGSVAALAQPTKPVDSTSKQ"
     gene            complement(353765..354076)
                     /locus_tag="CNE_RS40590"
                     /old_locus_tag="CNE_BB2p03490"
     CDS             complement(353765..354076)
                     /locus_tag="CNE_RS40590"
                     /old_locus_tag="CNE_BB2p03490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="WP_013954427.1"
                     /translation="MFKQISLPRADQPQTVLINVDGREISVTVGQSLAMALLGAGISP
                     FRHTAVSGAPRAPLCLMGVCFDCLVEVDGSQNVQSCMVEVREGMRVRLPSGSRRVGAQ
                     T"
     gene            complement(354060..355175)
                     /locus_tag="CNE_RS38285"
                     /old_locus_tag="CNE_BB2p03500"
     CDS             complement(354060..355175)
                     /locus_tag="CNE_RS38285"
                     /old_locus_tag="CNE_BB2p03500"
                     /EC_number="1.-.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_013954428.1"
                     /translation="MTSRHIDTLVIGGGVVGMSVAYGFARAGDSVCVLDGSDDAFRAS
                     RGNFGLVWVQNKGLGRPAYARWTMLAARMWPSLATELAELTGVDVELHQPGGLSMSFD
                     EKTLTASSEKLNALAKDLGITYPYEVLDASGLRKLTPQIGPEVVGAIYCELDGHVSPL
                     RTLRALVHGFKARGGQLVSNVSVDKIEHKLGEFRVTVGAETFTSGRVVLAAGLGNGEL
                     APQVGLAAPVRPIRGQILVTERVEPFLRYPCHFVRQTGEGTVQIGDSKEDVGMDDGTT
                     LPELARIAARAVRCFPMLADVNLVRTWGALRVMSPDGYPIYDASTECPGAFVVTCHSG
                     ITLAPAHAGPLVDWMRTGIEPADLLDFKAKRFHVQAN"
     gene            complement(355289..356347)
                     /locus_tag="CNE_RS38290"
                     /old_locus_tag="CNE_BB2p03510"
     CDS             complement(355289..356347)
                     /locus_tag="CNE_RS38290"
                     /old_locus_tag="CNE_BB2p03510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954429.1"
                     /translation="MRRTLPAERSWTWPFSVVAELRSKRVLRLARSLAVAGFTVSAVL
                     GATCVNAEPHSYPTRPIKLVVGFPPGGSSDATARLLAAALSVKLGQQVVVENKAGANS
                     IIATQYVRSQAADGYTLLSVSSSFAINPALQKLNYNIYKDFAPVALLGVIPLWLVTPN
                     TVPVKSVQDLVSLAKAQPGKLPYASYGPGSAGHLASELLLSLTGTSMVHVPYKGSGPA
                     LVDVMSGQVTMMMPTVASSISLVREGKLRAIAVSSKNRVAAVPDIPTISESGVPGFEL
                     VAWESIQAPAGTPTEIVAKLNTAIRDIIATPTFREKLIKLGIEPQSSKDPAEVAKFIR
                     GEAEKFAKIVRERDIKPE"
     gene            356607..357500
                     /locus_tag="CNE_RS40595"
     CDS             356607..357500
                     /locus_tag="CNE_RS40595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017449896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_080569707.1"
                     /translation="MNLRQIESFYAVMRTGTVVGAAQLMNVTQPAVSRAIGLLEIRVG
                     YKLFERRGRKLVATPEGDALYREVEPVYGSLDRIALVAEDIRHQRAGALRIATLPSVS
                     QSLLPRAIARFLSTRPKVSVYVQSLPSRQIADLVATRQFDIGLIELPLSRPAISIEPL
                     EPTPAMAVIPVGHRLAAKRHVSIRDLAGERMILLSQHSFLRHQIDDAFSKYGVSADAM
                     LETPHSLVACGLVAAGAGITLVSRWAAEAFSTADVVVRPVRDELTSRSAIIFPYPGAR
                     LLLAEAFAKDLREEIRTSKRR"
     gene            complement(357550..>357786)
                     /locus_tag="CNE_RS38295"
                     /old_locus_tag="CNE_BB2p03520"
                     /pseudo
     CDS             complement(357550..>357786)
                     /locus_tag="CNE_RS38295"
                     /old_locus_tag="CNE_BB2p03520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007748540.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cupin 2 protein"
     gene            complement(358065..359678)
                     /locus_tag="CNE_RS38300"
                     /old_locus_tag="CNE_BB2p03530"
     CDS             complement(358065..359678)
                     /locus_tag="CNE_RS38300"
                     /old_locus_tag="CNE_BB2p03530"
                     /EC_number="6.3.5.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_013954431.1"
                     /translation="MHPQLSNHSAHRKPYQRARTILIAALIAAPSWAGAGMPADKILD
                     MGLAELRSALDSGAITSAELVGAYLKQIETYDRPADGIHAVLAINEKAMEQATAWDAR
                     RAQHGANQRNAPLAGIPFLAKDNFDVAGMPNTGGSLALNGSIPATNAFVVQKLLDQGA
                     ILLGKTNMSELAASYGWYGYSSVGGQTLNPFNPLRTADGSSSGSAAAVAAKFAPFALG
                     TDTTGSIRSPASVTGTVGMRTTLGLVSRSGIIPMSLTADVAGAITRTVEDQAIVLDVI
                     QGQDKSDAATEDVARPQESLTTGLGIESLAGKTIAVVDNFDGANHEVDDIKRRSVAAM
                     EKAGARIVHVRLPQVYETLQPALLGPIGAAEFRPQFEAYLAGLPGGQPRDLREFMRRL
                     DGYTDKGTRTINPGRYKGLVENLETGATNSPAYIRMLSVVIPSLRRELVELMAQGRYD
                     ALFFPTIGCSAPVVPGKTDPTFVCKSYAYAAAKIASATGFSEITVNGGRSASNIPVGV
                     SFLGKAGDDAKILKIGAAFERIRRSERKH"
     gene            complement(359762..360769)
                     /locus_tag="CNE_RS38305"
                     /old_locus_tag="CNE_BB2p03540"
     CDS             complement(359762..360769)
                     /locus_tag="CNE_RS38305"
                     /old_locus_tag="CNE_BB2p03540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_013954432.1"
                     /translation="MNLMAIHSKLSRRALLSAAVLATAVLATGSVLAETFPAKPIRLI
                     IPAPPGGGTDGMARLTANALTESVNWAFVPENLPGAGGNIGFDQTFKAPRDGYTLAMG
                     ESSNMVVNQFLYRRIPFDIEKDMLPIALIAKVPLVLIVSASGPHANVGTLVAAGKKAS
                     LSFASSGNGTLAHLVGEMWKRKAGINMQHIPYRGAAQAMTDLIGGQVDLFFASIPVAL
                     PMIQGGKVRALAVTADKRVPVLKDVPTMAEVGYKDIEASVVFGLVGPAGIPSTVVSRI
                     NAEVNKALVRPAVAQQLAAMGVERTAGSFGGNPESLGRLLREERAKWAPVIKTSGATV
                     D"
     gene            complement(360957..362339)
                     /locus_tag="CNE_RS38310"
                     /old_locus_tag="CNE_BB2p03550"
     CDS             complement(360957..362339)
                     /locus_tag="CNE_RS38310"
                     /old_locus_tag="CNE_BB2p03550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="WP_013954433.1"
                     /translation="MPKGNEHQASTDMKPSNSRDIGLHLGRYVADLDARTIDARTQET
                     VLRCVLDALASAASALEQPGVKAAQQAAQTMYGAGGSPMWFTGRTATDAGALFANSAA
                     TAALDLDDGYRKARGHPGAATIPAAMALVHARPDIAVQDFMAAVVAGYEVGIRMAMAR
                     PGYAPSGTWSGFAVVATCGRMLGASAEIIAQALAIAAQTAPALPALAGLVGSDVKEGI
                     AAGAVSGWAALELAMAGYAGPAAVLEDGRLFDSDTALRDLGGQPLINGTYFKPFGCCR
                     HIHAPLDALLHLQRLHGLAARDIERMEVHTYRATFNLSNKPVPETLVEAQYSVPYCLA
                     LCALHGADALLPLDTRRLYDAEVSDLAKRITVVHDAAIESLFPARSPAWVAVTLSNGQ
                     LLESPLTDPRGDPDHPLSWEDLERKLQVATRATLSPASQQGVLEGMAGLRAGAWDPLL
                     LALSAPARTT"
     gene            362477..363385
                     /locus_tag="CNE_RS38315"
                     /old_locus_tag="CNE_BB2p03560"
     CDS             362477..363385
                     /locus_tag="CNE_RS38315"
                     /old_locus_tag="CNE_BB2p03560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013954434.1"
                     /translation="MKVDMNMRHIEAFRAVMISGSVVGAAKLLNVTQPGVSRTIALLE
                     MRLGYALFQRKGRRLVPTSEAEALYREVEHLYVGIDRITQVAYDIRYHRAGALRLASL
                     PALAQWLIPAVLAKFLEARPQVRIFVQTLPSTQIAELVATRQFDLGVVELPMSRSGVS
                     VRNLPPSPIVAVLPFEHRLAAREKVSLRDLAGERLVLPSPQSYLRYQIDDAFNRQSIV
                     PDVVAETPTSPLVCALVAEGAGIGLVSAWAPSPHGDTRTVQRPLDELLQSQYACLRPE
                     GAVPMVLAEEFQSLLSAQMDAMAPGH"
     gene            complement(363444..363662)
                     /locus_tag="CNE_RS40600"
     CDS             complement(363444..363662)
                     /locus_tag="CNE_RS40600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006157817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569703.1"
                     /translation="MRYIPIRDQHLAILARDRDAWRDRAERRVDVESLIWACVPDAAT
                     CDPSVVADAIREWFDSFDYGRHGVTLTH"
     gene            364321..365460
                     /locus_tag="CNE_RS40605"
                     /old_locus_tag="CNE_BB2p03570"
     CDS             364321..365460
                     /locus_tag="CNE_RS40605"
                     /old_locus_tag="CNE_BB2p03570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013954435.1"
                     /translation="MEDEALLDSLLYRGEGDALDFKKMQYAFEGADDNHKSELLKDIL
                     AFANAWRDTTAYIVIGVNDAREVVGLDKDIDDSRLQQFINGKVNRPIRFHYRSLLYKG
                     TTIGIYTIPLQDRPFFSVRDFGKVAAEAVYVRRGSATALAKPDEIAKMGAAAVQAHRP
                     RLSMRIFGADGEVSASESLAAVVNDLRIPEASEIPDHVDTSPASRFGLTDHFMNEDYF
                     RQVAAYIRQREGLVKFGLLIENLGDAYADDVKLTFRVPASEGFQLMAGDDLERTPRTH
                     WDAVRSHRWSGTVDPSVEISSNADTLTATIWLGKIHAGDRRTTVDLYFSHPPASLSHA
                     DVTVHADQLKAPLSFSIPLSFQVNTPPQVTVEQLLEIAHRFDESE"
     gene            complement(366213..366458)
                     /locus_tag="CNE_RS38325"
                     /old_locus_tag="CNE_BB2p03580"
     CDS             complement(366213..366458)
                     /locus_tag="CNE_RS38325"
                     /old_locus_tag="CNE_BB2p03580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954436.1"
                     /translation="MKTEDCTLAIGEGVATVKRRGTRGTTVANILGTVEANGIEVICL
                     DRLVHGIFEDKLDGWCAGGAVTTLLSRPIGPRQPTSC"
     gene            complement(366455..368947)
                     /locus_tag="CNE_RS38330"
                     /old_locus_tag="CNE_BB2p03590"
     CDS             complement(366455..368947)
                     /locus_tag="CNE_RS38330"
                     /old_locus_tag="CNE_BB2p03590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_013954437.1"
                     /translation="MGACSTCQRALSGRKGGGRTSIAVFARFRMRASDFVRQTVSDLT
                     QALPTLELQTEDRLYGEPWLGHQLLDDQGPAITRPVTSQKRVRISHDGRRIVLGFDCG
                     FVEAMVLNRLLERRIVSLEGQRLPRGFRYAGTGRLDLEAYLVQPDPIGALGELVGMVK
                     AAGGEPEFAQGFLEHFRQRLRRSMRQALPLRHAVWTTGVCAADTIVGTATKTHLVDSS
                     VWGGPVIKAGQAVRFDRQSDGRYQYQVRDKSYVVSLDEITTRYSVEKSAQAWEIVHEG
                     LATRYPGQASRLRKRLLALGIDRWLDWEFQQEDLVELLLKPNGAVAAWEQGCGKSRLA
                     AGLILLSGVKHGLIVVEARLIAEMGAELEQVMPASDVQVIQSPEDLVRLGRINLIAYE
                     RLRMPVDRQASRRITYAHRLRRRIGLLVADEGERLSNPASDQSRALWQLSAKRRYILT
                     GSPIANYPRDIFGLIAFTGGDGTAAQPYGYRRGYLEANWLASVQHAERGIDRFRSDFV
                     VLEWVTWEFAESLQDGAKREVPKIGNLPRYRQMLAPHVKRRLVCEPDVARYIRIEQPT
                     VEIVETSWDPAHLSLYLSTADEFAQWYREIRKDGRPNNLIAILARIRAVHFAANYPQH
                     GVDGVGGLAQLTSKQRAVIERLEAIAGEGKQAILFAENPGVVNLIASQLKAKGVETVP
                     FHGGIPIAKRVADKDKRFVGGNATGLLCTKASGRAGYNLPNADYVLFYDRSWTWRIEY
                     QAMRRALRWNRKGQLKVVYFHLPGSIDTYQDQMVAHKRDAMEAGLDWATPELEDEAFL
                     HMDTLLDEFVDDLAKLHGREARDQRELLKEAA"
     gene            369666..371162
                     /locus_tag="CNE_RS38335"
                     /old_locus_tag="CNE_BB2p03600"
     CDS             369666..371162
                     /locus_tag="CNE_RS38335"
                     /old_locus_tag="CNE_BB2p03600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013954438.1"
                     /translation="MRATWSASDGSSLHDGPSNPAASTASCTASIVVHNRPRPVHDYE
                     PRNGTQRPLPMLLADTIELVTSQREVDYFVRAAGCARFVWNWALAEWNRQRAGGGKPS
                     AMALKKSFNAIKYQQYPWMADIHRDAHAQPFANLSKAWSKFFSDIKSGIKAHAPRFKK
                     KGQCKDGFYVANDKVRFDGQSVVLPLIGRVAMREALRFPGRVIGAAVSRRADRWFISV
                     QVEVADDVAFVPRTGNGVVGVDLGINSAVTLSTGETFEGPKPLKAALRRLRIRSRRLS
                     RKVEMAKPGRAAFSRDFVGPRRPNTKPRPARSSGQIDSAARLARLHARVANIRQDFLH
                     KATTRLCRENQVIGLEDLNVRGMLRNDRLARSLSDMGLGEFRRQMEYKAKRYGTHLVF
                     ADRWFPSSKLMSCCGHKLDKLTLSERRVVCPACGMSHDRDHNAAINLERLATETALPV
                     ASDSATNRTARGMSPIAGGKVTSVRDEVGQQGASGREGNGAHSCARFS"
     gene            complement(371224..371703)
                     /locus_tag="CNE_RS38340"
                     /old_locus_tag="CNE_BB2p03610"
     CDS             complement(371224..371703)
                     /locus_tag="CNE_RS38340"
                     /old_locus_tag="CNE_BB2p03610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954439.1"
                     /translation="MKEIDLGSRPRDERAFAAPGEQYYRELATIAALAYRRMLDRVFW
                     HPPADVLRFEVRAIPASNGTEYTVTAILDGIGEVWFDYDSLPARWDSIAVFEVSWSLS
                     QLHAAEHGMECVSFEKPGGRPGNELMPDYSSTQDPAEAARDRWKVLNRLRKATERLG"
     gene            371888..372373
                     /locus_tag="CNE_RS38345"
                     /old_locus_tag="CNE_BB2p03620"
     CDS             371888..372373
                     /locus_tag="CNE_RS38345"
                     /old_locus_tag="CNE_BB2p03620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954440.1"
                     /translation="MRFTRYERHNPIDFNARRQAAFARKQARERERYPLLADHVAAEQ
                     HSVDEEIARRTVRADSFEQGMRDYYARSWRDARRIYFAQSEAVRAVIRAKWSAWVGPT
                     TSTYFAWMVDVESGNQARRLADCRDRDAAARAARTPRSQCRNSWLSDMRRWPQLPLAP
                     R"
     gene            372464..373595
                     /locus_tag="CNE_RS38350"
                     /pseudo
     CDS             372464..373595
                     /locus_tag="CNE_RS38350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012435668.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            373801..>374034
                     /locus_tag="CNE_RS38355"
                     /pseudo
     CDS             373801..>374034
                     /locus_tag="CNE_RS38355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011798730.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            373953..374474
                     /locus_tag="CNE_RS38360"
     CDS             373953..374474
                     /locus_tag="CNE_RS38360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954441.1"
                     /translation="MAPAQGSDGSLLARGVHLRPTPCPCPGATYSCDHAASQRCTAGG
                     QVIEGQAMPRDHQLTTPEAFDAAYAKAISLVHAHRAASVPLVQRHLRIGSDAARRLLA
                     RMARETTFVRPMLSGLYIYTPEPLANELKSLHGFVAEVLARSAKGPLDPDTIRSLGEK
                     HALQNYLQAGGCQ"
     gene            374499..374780
                     /locus_tag="CNE_RS40610"
     CDS             374499..374780
                     /locus_tag="CNE_RS40610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080569704.1"
                     /translation="MNPLPDDDYPQPETMLAIRGAIAIGRQGGPRPPNGSWLSEFWEV
                     GHLVRNAADAMHEAIEPLQRLVGDATAHLQDHVAALERAAGDIDGLYPE"
     gene            374939..375580
                     /locus_tag="CNE_RS38370"
                     /old_locus_tag="CNE_BB2p03660"
     CDS             374939..375580
                     /locus_tag="CNE_RS38370"
                     /old_locus_tag="CNE_BB2p03660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954442.1"
                     /translation="MRARFPPTRPSMADDLLICAHCGSQPRFIANRFEAVITCTGCGI
                     TTPPESLEAGHDQAHTVLRGIWNTRLTPRPPEQHELSAIVRKELSSSDLGTVLALIAR
                     NEDDWETRGPLFAAMAEKLLQPEPFLQELVPAEALLKDASRYRKLMRRAKLIHIDGRP
                     WVRIEPIDALPATVSEELFGGTIILEEFLARVLDTTPDAGEGVASPQGMQPKP"
     gene            375632..376570
                     /locus_tag="CNE_RS38375"
                     /old_locus_tag="CNE_BB2p03670"
     CDS             375632..376570
                     /locus_tag="CNE_RS38375"
                     /old_locus_tag="CNE_BB2p03670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA non-specific endonuclease"
                     /protein_id="WP_013954443.1"
                     /translation="MQKPLFLAAAIAATFVGSTISTAVSTAAYAKGPATDCPHIFGTN
                     GKPRVASSASASRTQFLCFRGYAVQTSATTRTALWSAENLTAPAVLAARSVPRGSDFY
                     EEAEIPAADRARLSDYGRGTGLDRGHLSPSGDFPDLASQAESFSLANIVPQAAASNRR
                     LWSHIETSTRRMVREYGQAFVVTGPAFDPAQAARLNGRISISTYMWKAVFVPGVGAAA
                     YVARNDATPQYSVLSIAELASFAGVDPFPRLDKSYRDSPMALLAPTPHPGEKTGRKVS
                     LATLTSTAVERPDQSVAQEPRHSSVLPFVRAVLNHN"
     gene            complement(376831..377466)
                     /locus_tag="CNE_RS38380"
     CDS             complement(376831..377466)
                     /locus_tag="CNE_RS38380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229416.1"
                     /translation="MLIDRIYSDKEIRVIVERGLDAAAVAEWPWVALPDYVIAVARVN
                     CMEDKHDPYVQEDLEEATRLRRGLRTHWGLLVVDQKEDEEGLITAVIGYLAADPYVEL
                     SRLRRNGDTAGIFLSDLVSFEFTKAVGGVLDGGGWDWADNDGTGQFLSVMWFQEVGEG
                     WEGAPNAYSMGSAILRADVTEISLRCQQPRYLADLRDGIGAGRHVTRAVLN"
     gene            complement(377486..378640)
                     /locus_tag="CNE_RS38385"
                     /old_locus_tag="CNE_BB2p03690"
     CDS             complement(377486..378640)
                     /locus_tag="CNE_RS38385"
                     /old_locus_tag="CNE_BB2p03690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_013954445.1"
                     /translation="MRQAIALDVRGLLARYDMPTRMKAEIEVAVAGNVKRILSQTRIS
                     HKNASIKTQERRMYTVCRSFVELRACGFHIESPYSLRHKHVQALVDYWVSQKQSGGTI
                     ENKLSHLKAFCQWIGKHNLIRTIGDYVDRKEHGLVRSYVTTTDKSWSGNGIDATAKIA
                     EIGAEHPRVAIQLKLQAAFGLRIEESFSLKVSTALRNLDTMRVVDGTKGGRAREVPVQ
                     LRLAVLGEAAALVDPSSGSTTPASYSINEWRSHYNGVLRKYGIYKKGLGVTSHGLRHQ
                     WLQEYYKTLTGVDAPVKGGKALDLEAHRQAIQAVVEAAGHSKASKTGAYLSTFSAMAR
                     KDKPQVNPDQAKEALVAAGGNKAKAAQALGISRQALYRLLDRHQAGGKSV"
     gene            379740..380741
                     /locus_tag="CNE_RS38390"
                     /old_locus_tag="CNE_BB2p03700"
     CDS             379740..380741
                     /locus_tag="CNE_RS38390"
                     /old_locus_tag="CNE_BB2p03700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid segregation protein ParM"
                     /protein_id="WP_013954446.1"
                     /translation="MKLSTVAIDVGYGNTKSAFPLGSDIATNMFPSLAPIASTTSLTP
                     HSGSILRSRDVVNVLVDGARYEVGPEVSLSAPRGNTGRSLSEDFVTTANYAALLAGAL
                     HYSKATEIDRLVLGLPVHNTQKYAGYLKDRFSGELEFGWGPIHVRSVLPLPQPLGTLI
                     TFIQQSGKQYDPDNSYLVIDVGYFTTDWVVARGYTMDDSRSGGVPGGASSIYQQVASL
                     IAKAEGEPVDSIERIDKAIREVKPMLFFNKDLDVRPFLEEAIAVSRASVKEVQARVGR
                     TEDIRAIILTGGGANLYAPAIKAAFPRNTVQVMDAPCFANVRGFYTIGSARQMSKSS"
     gene            380738..381154
                     /locus_tag="CNE_RS38395"
     CDS             380738..381154
                     /locus_tag="CNE_RS38395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229417.1"
                     /translation="MILLSMDKLQITLTLSREAAPDLLAYLGQIPGARERAFVFRLLA
                     QRGLRSLGNAGTDGLLPAPAGLLSSISPPATTPLATVGNVRATGDEQGAIAPLVPALA
                     DTSIASPEASPLTMDTSDQFAVLDVGALNDAMERFV"
     gene            complement(381875..382093)
                     /locus_tag="CNE_RS38400"
                     /old_locus_tag="CNE_BB2p03710"
     CDS             complement(381875..382093)
                     /locus_tag="CNE_RS38400"
                     /old_locus_tag="CNE_BB2p03710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954447.1"
                     /translation="MSFKGFSVIVGRLQIRAMRQMASGTVPACQSDAETYHVYRRNAD
                     GSTQLQHMEADFDAAFTYCAGKQRPTLH"
     gene            complement(382205..383278)
                     /locus_tag="CNE_RS38405"
                     /old_locus_tag="CNE_BB2p03720"
     CDS             complement(382205..383278)
                     /locus_tag="CNE_RS38405"
                     /old_locus_tag="CNE_BB2p03720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding protein"
                     /protein_id="WP_013954448.1"
                     /translation="MTRLSVIVKHWTPAQWDALIMQYLPANVLTDKFWRGRPGPCPIC
                     GGQDRFTYDNKRGRGDWVCRHCKDGEPMAGDGLELIRRLRGMSFAELANELEGNRPPC
                     PLPQVARPATPKAPMSDEAKAKRIQRVWANAAPLVPGDAAMRYLAARVPGLVAPRPSA
                     LRLATMDYYHDGELMGRYPTIVAQFTLPDGRTATVHRTALDPAKPAKAYIVTADGEIL
                     PAKRNDVSALPTAGGAVRLMSPRDGVLGVAEGLETAYAAHMLFGVPTWYCLNRVLLNR
                     FVVPQGMGIHTLHIFADFDEIDPKTGKSPGMADALALAKRVRNEGLTVHLHRPMVRGT
                     DFCDQWLTANRLQGIAGQRAACA"
     gene            complement(383505..384023)
                     /locus_tag="CNE_RS38410"
                     /old_locus_tag="CNE_BB2p03730"
     CDS             complement(383505..384023)
                     /locus_tag="CNE_RS38410"
                     /old_locus_tag="CNE_BB2p03730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_013954449.1"
                     /translation="MASVNKVILVGNLGADPEVRYMPSGDAVANIRIATTDRYKDKQS
                     GEMKEATEWHRISFFGKLAEIAGQYLKKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVA
                     DQMQMLGSRQDGNAGDDDGYGQRSTRQSQGQQPARQSQGEQGGQQRQSAAPGQQPGSS
                     DGFDEDSDDIPF"
     gene            complement(384048..384812)
                     /locus_tag="CNE_RS38415"
                     /old_locus_tag="CNE_BB2p03740"
     CDS             complement(384048..384812)
                     /locus_tag="CNE_RS38415"
                     /old_locus_tag="CNE_BB2p03740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954450.1"
                     /translation="MAFIQRFLGALQDALQPRPAETAPAGAQAVGTGARNEVHIEIGG
                     VPNLFRDEGERIVHFIAVFDPRPTPTRFGQKLLPDPVPYWSVAGEHPGAELSGVIATA
                     IREHAPPAVRMEMPGGNGAAQSSHEAQPGAQRAPAATPKVSERRDHASSVYRGTIAFW
                     GEAEFPDRKRIGGTYTSFALKLETATGAVETLQGEGLKDAIAEAGCQLGDRVEVRRLK
                     KVKVPAFHRKSGKPKLDDNGQQVLWDKWLWSIARSH"
     gene            complement(384821..385249)
                     /locus_tag="CNE_RS38420"
                     /old_locus_tag="CNE_BB2p03750"
     CDS             complement(384821..385249)
                     /locus_tag="CNE_RS38420"
                     /old_locus_tag="CNE_BB2p03750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954451.1"
                     /translation="MEMKPAAWQLDFFGEAAPVANDPPKREPLPDPMYWSEAVRDQMI
                     DALISLACDSRRGDNLPESLADCADLMRARMHDKAVEKDDFDMTLGWIFGYWDGALPY
                     AYVCAVSGIDPEVLQDIILNHPRLKRDLEEVRRMRCGTLL"
     gene            complement(385347..385652)
                     /locus_tag="CNE_RS40615"
                     /old_locus_tag="CNE_BB2p03760"
     CDS             complement(385347..385652)
                     /locus_tag="CNE_RS40615"
                     /old_locus_tag="CNE_BB2p03760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954452.1"
                     /translation="MESLANLLRSPVRLFFTLMAIYVASQSALCAFFLVIVAGSWCYH
                     KLIGRGHTVPTPRDVVMPKPQAAVAEPEQSKAPQVPTYAKSPVVVPLKRQDAARRAA"
     gene            386394..387563
                     /locus_tag="CNE_RS38425"
                     /old_locus_tag="CNE_BB2p03770"
     CDS             386394..387563
                     /locus_tag="CNE_RS38425"
                     /old_locus_tag="CNE_BB2p03770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954453.1"
                     /translation="MDKNSKFELTEPPRQPSILDLAREQLAPHFDQTAIARIVQAGEE
                     IAIARERIFSEHVIIGSRLTQIQQIMCTSLTAHRSDPAQAANEARMLLYRFADHSLKI
                     PKWSAKRYVQIYERFMHHNDALTFLNVGELNILKRHDITADEVALVVKAKKANETFSR
                     NEILPFIDRYRALAAEMETLETQLAGTEEELSASMAQQDQNQFELKYLKEQIAVAGRS
                     TEAQQAALIEAQTALASQSANVDALQTAVEMVNREKADLQRQISEMKIRVEVKEVPVV
                     PERYASVTQAIEDAQARLQQVTRELQESEAQLANRRGAVAANELPAPASTTPPAERHI
                     GLRLDGLIADFDALRDKFQSCRQARELRDHRNTISTLAASVATFHQELLTAAKTA"
     gene            387574..388755
                     /locus_tag="CNE_RS38430"
                     /old_locus_tag="CNE_BB2p03780"
     CDS             387574..388755
                     /locus_tag="CNE_RS38430"
                     /old_locus_tag="CNE_BB2p03780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954454.1"
                     /translation="MTRRHTKKFHEQFLHPAWVQDRTLSANLRLSTAMVNTLAVKPMF
                     EMIFGAKKDDVQALRDSVEQSSTVLGSPFLAFAPTLETPADWACFTEGSTSTLTFDRL
                     ARMTPELTPVDKMLLEHYNRLYIGALYDVLNMSVLASPLLGISNELADYLRTVPQHRV
                     ELAISSRAIPLFKWRFANPVFWAEASGGRMSSELMAHYLMVQSPVKADKLPHSGAWGG
                     LRIARPLQEAYAEAFVYFKCRAKGVASLFNMNVTTVRQMYLRIHGESSPSGHSPTSCA
                     WYLDSAGKRLQSTFHLWLFRSALSADASIPEAFIAAVNIAKHMFGDESKVPAERAFHL
                     LRSMATEHELDVRTCRSCGTAYVTAIGDLAHSVLCPCCSGTLSSPNVGRVGRTRPRKK
                     R"
     gene            388945..389139
                     /locus_tag="CNE_RS38435"
                     /old_locus_tag="CNE_BB2p03790"
     CDS             388945..389139
                     /locus_tag="CNE_RS38435"
                     /old_locus_tag="CNE_BB2p03790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954455.1"
                     /translation="MFVARQKRVSLKDYLAKYPHCRTNRGIACAHCNSGSIRMWRNSG
                     LLSNRDQHLCNHCGSYLYDS"
     gene            389379..390209
                     /locus_tag="CNE_RS38440"
                     /old_locus_tag="CNE_BB2p03800"
     CDS             389379..390209
                     /locus_tag="CNE_RS38440"
                     /old_locus_tag="CNE_BB2p03800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954456.1"
                     /translation="MKTTLKLGLSAISLATLLALAACGGGGGGDETPAGAPATTPPSA
                     PTPTITVQGSAPAVSADPLAVVFVPQTETSTRSVLQSIASNAFPAQFQKAPNDGAYTQ
                     LGIDASSLITLNGGTVADVAGNGDFAIGRWTNGSNSIGSISANQGAHYVVGKPLALVR
                     TPGPTAKLTCTYLSGTRPTSVSGNFTPGSVNSATATIDLNGPALDSFMIDVNIGADAH
                     AASTATGTTISGVLQASGVLHHVQVMGNDPNKPYLAIGYAMPTPSSGDVTGVVVMKCQ
                     "
     gene            complement(390317..391573)
                     /locus_tag="CNE_RS38445"
                     /old_locus_tag="CNE_BB2p03810"
     CDS             complement(390317..391573)
                     /locus_tag="CNE_RS38445"
                     /old_locus_tag="CNE_BB2p03810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin"
                     /protein_id="WP_013954457.1"
                     /translation="MFLTEAAFQLTIAAAGMAVMIHNTNNLVDDALAMGTGQYMANVA
                     SAVNTYVFDNMTVLAGSPSGPTTIAAGSVTATVANPLHPTVQDLINLKLLPIGFSDVS
                     PLGLTFRVDLTPTNCSTGLTNCTIPGAMYSTTAYRDSAGRVRIDQLASVIATAGVDAG
                     MSYAESPAVITGMAASWSAPNPLAGSQPGVLMMRVGNTSLLAQSMNQFYKRDGSLNLT
                     GPMDANNQGMNRVGNFQSNGSVSAAGDVAAGSNVSGNGVYGNYMQSNGDLRAIANVSA
                     NGVYGNYVQSNGSAYVAGLISSGSQISAGGNVTSAGSVLSSGYLYAAGAVVPSTGGGQ
                     QVWEGWGCGDPQGAIRSDPNGKILSCQNGVWRNSSGGAGLVDFAFVTGCDANGNSGAL
                     YRFYFANGATKDLFAPNGGTCGSGGG"
     gene            complement(391733..392371)
                     /locus_tag="CNE_RS38450"
                     /old_locus_tag="CNE_BB2p03820"
     CDS             complement(391733..392371)
                     /locus_tag="CNE_RS38450"
                     /old_locus_tag="CNE_BB2p03820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein PilS"
                     /protein_id="WP_013954458.1"
                     /translation="MTDATKTLTADQAALHVAPATTGQPALMNPKTAPAGQRNRRTRK
                     QWGGGVLDEYGFYLLLAGIALVAILVLFSRNQTDSQVQQLTTELNGVVGKVKTSYRGQ
                     YNKVSIGALINNGVFKDLTTMTESGTTVILQPGGGALTVAPAQLLSANDSLQWTIPQQ
                     PDAACISIVASYQGSAGKILVNGTTIKAVGGSVDPSKVACSGGSNTIDLFIA"
     gene            complement(392436..393662)
                     /locus_tag="CNE_RS38455"
                     /old_locus_tag="CNE_BB2p03830"
     CDS             complement(392436..393662)
                     /locus_tag="CNE_RS38455"
                     /old_locus_tag="CNE_BB2p03830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954459.1"
                     /translation="MMQNLIKRFAGVFSRKVGTPALRAGDRVFADKLFWAKYRFRSMR
                     ATYYYDLAKRIQHMPGEPIANHFAKDAARRAGEPLGILAAHWLSRSEGIDGQMQRSRV
                     TEIFRGTVPDEDIPILAVAEDGGDIREGLETLARNLTALGEARAGIALTLAGVLMTLV
                     ILHAYLAAMAFLVGPKVDDSFRTMLDVSQYGPIGKTFHNTTTFLRHWGWLVVLLEVVA
                     CVWVLRALKSYVGPHRAWLDRKVLVFDFFRRFQSAQFLAGLSAVTKRFGGDLRSLADG
                     LTLMRANAYPYLSHHIERMELNLEYNPNEGGKVFDTGLFDRDTSYRIQDIAEYESDLS
                     KMLHTVADDLLVTTPKLMLQRAAQFNRRATIVLIILITGLAFMPAFMAQEMKVRTQLA
                     GMAGKRPVQPAPSTQP"
     gene            complement(393659..395503)
                     /locus_tag="CNE_RS38460"
                     /old_locus_tag="CNE_BB2p03840"
     CDS             complement(393659..395503)
                     /locus_tag="CNE_RS38460"
                     /old_locus_tag="CNE_BB2p03840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin corregulated pilus biosynthesis protein T"
                     /protein_id="WP_013954460.1"
                     /translation="MGLFSKREKSDGFGGGGSGVTVVTGGAAAFVPGTPGAPGGPAAA
                     RPVPQGSEIRTDEIATVDDLPEFVRTLYDELDMAPSLRHVICPVLVEAAASADGRGRF
                     ALILTRDMANSDVTEEILRQLRLRFDPAAPVMHLAAAQVMVALSRGSVEPTGGSDKLA
                     VGAGRRPASALWQNFDAVGRFALREGASDLHWEVEDQGGYSKVRLAIDGYLVDPPEFR
                     METGVMLDTLSHVWQKGKGGSQGVFSRVLPQQTSIRAKIDGQPVVFRWASMQSATGHV
                     TVMRMHREEVATKRVDFVDDLGYFEQQAQLLDRNTMQLGGGTVLVGVVGSGKTTTAHA
                     IMQRLPAWMNKMAIEDPVELLAEGTHHFSVSRTLDGANRDEDPFIAAKRQIKRMNPHF
                     VMVGELRDHESAGLFRDVAGAGLRALTTVHAPSALTAPDRLSDGELRIPRSVLATPGF
                     VNLYVYQALLPKTCPCGLCGADMKRMLGADKLRQIERLFQFDVEGIRLRNPQGCDLCR
                     RPNLPDLNGARGRTVVAEMFEPDELDLSFIRDAKNIELAAYQRSKRQVGFDVSDSTGK
                     TVFEVAMYKVFAGIVDPREAEKLTSLDAYEARRQRELARATNTMGIHA"
     gene            complement(395513..396211)
                     /locus_tag="CNE_RS38465"
                     /old_locus_tag="CNE_BB2p03850"
     CDS             complement(395513..396211)
                     /locus_tag="CNE_RS38465"
                     /old_locus_tag="CNE_BB2p03850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954461.1"
                     /translation="MRATPFPLSFPLRRAAVAAFALLVAGPVLADDDKSLTQKLIDAD
                     AKVALQKLQQELDKGAPPPAVSAAPTGAAAKPAAERAPQTIALYGVDGRSAGGGMTLR
                     SYVRWGDQVYPAKVGAKWRGYIVSAITESGTTFTRGKARVFAPLVQDDAAVLVDTPQT
                     GSASTAARTGPLPNQGMPTGQGTPPFFPLPPIGPAPGAASVPTPPPTLPPVSVSAMGA
                     PTALASPPATVAQR"
     gene            complement(396225..397568)
                     /locus_tag="CNE_RS38470"
                     /old_locus_tag="CNE_BB2p03860"
     CDS             complement(396225..397568)
                     /locus_tag="CNE_RS38470"
                     /old_locus_tag="CNE_BB2p03860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_013954462.1"
                     /translation="MILDIHGKKLVFGMQWRTLTGSDAPSALAANIAREVRAARIWHE
                     DQALHMGYLDTADAQAKIKDKLYSGAAAIARVPELVPNALFVFRLEAPGQAPVYLVCG
                     IVKGRPRVGFDQVVRDEKTLAQLAVDFPAKCDGEFKLVGNMPELLPLLPPERHVMHVP
                     YTLDMLVAHAGPAALLKKPRTTSQRKRVLTLAVLAGSAAVSWPYGKAEYDAYQRRLHP
                     PPPQKTPAERYADDLAARAARPVALTGVALPAWAQWFANDVPLQVGGWSLASIQCADV
                     VTPKANCALTYEIRQGAKGLTNQTFVASLPDAFRAPVFQANDTKAVVSAQVPVGEVRN
                     LGAVLEQPPKAMALRVGFGSQLQTLRPVATKAELKELLIFGTVPPEGPASLLHPVLSA
                     TWEISGPLRNVTEFAAFPPNVTVKALDLVVNLDAAPDIKQSKFMLTVKGDAFARD"
     gene            complement(397565..399367)
                     /locus_tag="CNE_RS38475"
                     /old_locus_tag="CNE_BB2p03870"
     CDS             complement(397565..399367)
                     /locus_tag="CNE_RS38475"
                     /old_locus_tag="CNE_BB2p03870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilN"
                     /protein_id="WP_013954463.1"
                     /translation="MKLNRLFRPTAGAVLVCSTLAGCVSPQLQRDIRQAADDARAEQM
                     ARTESLYAQMRRDRTAVEAEQEVLKPYLVGKPVPTARNVTLPLALRNNVDTWVMFPER
                     VMPLAVAAQRITMATGIPVKIESDVYLPSNLLMPRSLMTQAGGQVRNQNGTAGGNPLS
                     TTGLGPAPTTNGPLPGALLAGGANATAANQATPLIETALNVEFKNSEKMPLANMLDLI
                     ATRLGINWEYNASKGVIRFYRLTTKMWQLPMKAGTSSFTTEFKQSAQGGSNANVGGGG
                     QATQIDAAVKSEAKELDDMDGIRKSIEPALTMVGRAELNPATGILTLKDTKEAVEAAD
                     EIVRKQIAIYSRMVYVKFQTIDFTVTDNGEAGADWNAVLTKALEHIPSFTFTALSPAS
                     LVSSNAGSFGLGITSGGWNGTQAIVNALKQYGTVTTSVTIPMALRNRHGAQYNNRRQF
                     TYVSSTTPASTTVGGTGGIPGITTSTGTVGFKLTLFPDATTRDDVNLTLAFDQSALDG
                     PIETFTSGSGINQQSVQVPKIVAKGIPAQDLIVRNGQTVIVTAFDQTDSQFSHRTLGE
                     YLPTILGGSLTASKSRTFTLVLATVMVQDQGEAQ"
     gene            complement(399379..399999)
                     /locus_tag="CNE_RS38480"
                     /old_locus_tag="CNE_BB2p03880"
     CDS             complement(399379..399999)
                     /locus_tag="CNE_RS38480"
                     /old_locus_tag="CNE_BB2p03880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954464.1"
                     /translation="MFQSLFPARLSRTLVAASALPLCAMAQAAVPASTSASASPFGVD
                     AAGQFEPAAPLAGAGWQLLAANAKRVADKPAAPNAAPSVAVPATDRTAIPVPATPVAT
                     VAATRAAAPAAPAALITWTVSPADANFRQLIEAWASRAGWSAAPWELEKDVPIVGSDV
                     FDGDFKAAVRRVLSSTEMTDYIIKPCFYSNNVVRVVKLTTKCDLSQ"
     gene            complement(400034..400483)
                     /locus_tag="CNE_RS38485"
                     /old_locus_tag="CNE_BB2p03890"
     CDS             complement(400034..400483)
                     /locus_tag="CNE_RS38485"
                     /old_locus_tag="CNE_BB2p03890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_013954465.1"
                     /translation="MIRRLAAGVAALTLCTAASVLASGNAYADCLDDAAAYHRLSPVL
                     LRTIARHESGMRANAINRNTNGTEDIGLMQINSVHLPRLARYGITRDKLFDPCVSAYV
                     GAWILRDCLDRVGATWAGVGCYNAGAHDKRMRYANRIYQTLLSTQPK"
     gene            complement(400480..401784)
                     /locus_tag="CNE_RS38490"
                     /old_locus_tag="CNE_BB2p03900"
     CDS             complement(400480..401784)
                     /locus_tag="CNE_RS38490"
                     /old_locus_tag="CNE_BB2p03900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilL"
                     /protein_id="WP_013954466.1"
                     /translation="MMKPLLISVLALAASGAAVAADTDPLDFDYQVVARASERPALIF
                     NDGQSTYIQPRAGQLVTADGAQQNGPYWVIDGVPDVVRYSVNGQSVIARWKRANGFTG
                     EPANPVGDLPGSLAGFSGRIALIGQHGDLALVRAGRSVMPLAAMVKSLAPAGWSGTAQ
                     KDIALTEDVSLQRAAGENWLQALGRVLEQRNLYAEVDFERQHVTLRATAPKAFAVDSR
                     RRADAPAASSLAAAPAPVAAELVSTSVPTSATAASATTRAAAPAPAVGTAAEPLTLAT
                     AFDANAIRDTKTGRIEIRFDQKPGELLFHDGAGKRLSTEWRDEDKALSLATVDRFTVR
                     GGGKAVEVARVPGIHYLFAQQNEAGLSRVFEKDGATYLSFDKSMGSISVFDESRRGSG
                     EHKDRYYKFNGISTRLTVVADGNVVQVDRVPEVRFYERAVTQ"
     gene            complement(401781..402587)
                     /locus_tag="CNE_RS38495"
                     /old_locus_tag="CNE_BB2p03910"
     CDS             complement(401781..402587)
                     /locus_tag="CNE_RS38495"
                     /old_locus_tag="CNE_BB2p03910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_013954467.1"
                     /translation="MIKPSAAVLLALAMSGAGAQTIEAMVSPTALVVSDAAGARVVTL
                     TGKPVLFCGLDSFLGWSARWIGATLRMEGGQAPAVVVQGQAVPLTALLARDGWLRPER
                     LDDGAQVALVERRGGWACAPKTEAFAQMSEKVDPRILAGIAMNESAYRGRPWPWTLNV
                     AGRGMFFATREDAHATIERLLAAKRCDFDVGIMQINWCYHGKRFASAWDALSPATNIR
                     AAEAILTDNLQRSGSPMKAVAWYHSADPARGGPYFARFMTHFQQLKAPQP"
     gene            complement(402580..403833)
                     /locus_tag="CNE_RS38500"
                     /old_locus_tag="CNE_BB2p03920"
     CDS             complement(402580..403833)
                     /locus_tag="CNE_RS38500"
                     /old_locus_tag="CNE_BB2p03920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="WP_013954468.1"
                     /translation="MKQPVTDVSDAKERLTSGKVPRNIVTTLGVVAAVLVGTLGYFYQ
                     SSMESDLAKQAEDKKAKKLQERTSTPDNGGLDQLIRQQQDEARKQAAQQAAEATRPEP
                     AKAPVMTAKDFVQPATAGPAAAELKQANDLDTVMTSPIFKSDGKAMRRDVKRQPDLSG
                     VVDPAQMRAQQLAAVGGMNGTGGVGGAGGMPGMGGPEGGNTAPTSSDGQFLRGAAATS
                     FTRTGFAGKLAPCTVSQGFVIPATFVGGLNSDKPGEFRATVTNDVYDTVNGTCKAIPA
                     GATLVGTYSSDIAIGQERILAAFVRMQLPNGKWVPLLGMGGADPNGYAGISGDVNNHF
                     FKIFAGALIIGVLEQHFNDSATATTVGPNGLTTFGNTAGQVAAQTAQTILNRNQNIRP
                     TITTKPGQKLLVQVKHDIVLEPYRD"
     gene            complement(403848..404741)
                     /locus_tag="CNE_RS38505"
                     /old_locus_tag="CNE_BB2p03930"
     CDS             complement(403848..404741)
                     /locus_tag="CNE_RS38505"
                     /old_locus_tag="CNE_BB2p03930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
                     /protein_id="WP_013954469.1"
                     /translation="MSQSLRSRFSVVGLTAAMCLMLSAGPGFSADKPSRKAPPPPLPG
                     LGIGDMADAMNPMNPFNGGVEPVALPGDSRLVVFPYSPDQIFRVLTAPLKVTTIEFAP
                     DEQIVGDPAWGENIRWSFETDGANHLYVKPSGPGLVNTLSVNTNKRSYEFTLVSSPLG
                     GIFYQKVRFRVQGAFGAKAKARAEHGAGAAEREPPNSAPDAVAVSPDKLNFDYRVEGG
                     AAFKPETVFDDGTAIWMRIPRGADWPVALYKDGSDYVVANFIRRGEFLVMQRLADEIA
                     LRSGDTEVKVLRGKRRILGLF"
     gene            complement(404758..405465)
                     /locus_tag="CNE_RS38510"
                     /old_locus_tag="CNE_BB2p03940"
     CDS             complement(404758..405465)
                     /locus_tag="CNE_RS38510"
                     /old_locus_tag="CNE_BB2p03940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_013954470.1"
                     /translation="MPLFSRRNESKKVLSPAPGMYAGEDVTQFLFDRTARVVVERNHW
                     KLATLVAALVAVAAVITRQPPEPVVRVVGVSADANGKPVARELDAYQPKALEIQVAFR
                     DVVTRMFTIEPVLTPEIENSRIFQNINGVKKQMVGAARKQFEDWLSEDAPFRAIAQSP
                     SLVREVQVTNIALLPDNTVAVEFVTSTREEGAKPRKQRYAMTFRYQIDPPKSDAALTG
                     NPFGIYPVFFSIQKSAA"
     gene            405849..406898
                     /locus_tag="CNE_RS38515"
                     /old_locus_tag="CNE_BB2p03950"
     CDS             405849..406898
                     /locus_tag="CNE_RS38515"
                     /old_locus_tag="CNE_BB2p03950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011875532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="WP_041229419.1"
                     /translation="MSAPAAHPTLQFDQLEASAVAMFFEALGPIKAYVEASDIAEVMI
                     NHADSVWIERHGELRRLDIRLDPAMIEGAVRALAASVQKSAVRGTDQGIINAGYQGMR
                     IAAVMQPTAIDGNALSIRRHREQNLSLSDYVEMGAFSARVARNTADDKPIFDGPVEDE
                     ALKAALTQLVVQRKNILVAGGTSSGKTTLLNALVAEIPHSERVLSIEDTMELKMTVPN
                     KVRLLSNADTRVTTQQLVALSLRFRPDRILVGEVRGGEAYDLLQALNTGHDGGMASLH
                     ANNARSALSRLESLAMLGIPAGSRWELDDMRKLIAECFHYVLHLRRTCEMRHVSEVLE
                     IQGFKNNDYVVNRVF"
     gene            406945..407268
                     /locus_tag="CNE_RS38520"
                     /old_locus_tag="CNE_BB2p03960"
     CDS             406945..407268
                     /locus_tag="CNE_RS38520"
                     /old_locus_tag="CNE_BB2p03960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012218005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229420.1"
                     /translation="MQSNTTVTRSQHTALVMGAALMLCAQSAMAADLGIFSGLTNMIC
                     SIQALVSGPIIFVIGVVVIILGAIGIANSESTIVKVVMTAIVGIGLAAAAIPIAKNLG
                     LTQYC"
     gene            407271..407600
                     /locus_tag="CNE_RS38525"
                     /old_locus_tag="CNE_BB2p03970"
     CDS             407271..407600
                     /locus_tag="CNE_RS38525"
                     /old_locus_tag="CNE_BB2p03970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008645668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrbD"
                     /protein_id="WP_013954473.1"
                     /translation="MRQHAVSRSLSLPRMLGGAVRGLAIANGTITALLCYATYTGGFW
                     TVAGFFLLGLCVHLFLRWLTTSDPWWNLVLNVYNHYGDVYESAPWHGKFSPRFRRPYG
                     FDSDLPC"
     gene            407594..410038
                     /locus_tag="CNE_RS38530"
                     /old_locus_tag="CNE_BB2p03980"
     CDS             407594..410038
                     /locus_tag="CNE_RS38530"
                     /old_locus_tag="CNE_BB2p03980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrbE"
                     /protein_id="WP_013954474.1"
                     /translation="MLKRRPMQEIAPWMTLVTPDLVLNKDGSLLATFDFDGIDADSPN
                     TLDVSAARDQLDQACRSFDSRVTAWWRLRHRRTRDYIGGTFPATSDARLDALNREHMT
                     SGKYFRNSHSLALAYTPENGIDKVFERMAYHMTVGGKNFAIAAFETAKDVLLARNAFA
                     FDLQRTEADAKRFESMLDAFTGGVTKLGLTRLSMQDSLAALHQTVNPTVPPRRVRFPV
                     TLLDTHLTESEVISGADKLFFESAHGKRFAAVVAVKEWMGFQEAALDVLTQIDAELDI
                     CILYRFLDTHKATHYIEKIRRFYKMASFNLWSIAKQMAAKEETQNDEGREQLAAEAGD
                     ALRRLTAEGQQHGFVNISVIVYGDTEAECEDAVSEVVGAITNAGFGPIREKANLLPAW
                     NSTLPGRWDKQRRLQFVETPAVSDIAPLRSVRPGPTRNNWLTDLSGVETPPLTYLPTR
                     HRTAQRLDMHQPGGNGHLLVLGPIGAGKSVMLNFLVTQAGRQRARRIRFDKDRSTRIP
                     TLLAGGKFVDVTGRFQAATQTNPLSLLTDAANFAYVTDWLVLAIEDDDFRCTPQQRTD
                     LFQAVQILARFPRERWTLSNLCTQLHATLRERLQIWVKGGQYGHFFDHVEDAFEVSDD
                     LSIEMGDLFTNFPRAAALFMDYAFYRISQSMGTRYTIIEVEEAGFFFTNPRFYARLET
                     WIVTIRKLNGAIWMATQSLQQVARVADFEILKDNIANIIYLPNSQAITSKELYRDVFG
                     LTLDQVKMITEAVPNRDYYWTTKTQSRMLQTAFSKEMVAMLRSDGYAQEVLDRHHASG
                     LPDWQDRYVREVLTRG"
     gene            410081..410845
                     /locus_tag="CNE_RS38535"
                     /old_locus_tag="CNE_BB2p03990"
     CDS             410081..410845
                     /locus_tag="CNE_RS38535"
                     /old_locus_tag="CNE_BB2p03990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbJ"
                     /protein_id="WP_013954475.1"
                     /translation="MNKVLAGVLASAALTASSLAHASGWPVFDAANFIKNTMTAAQAL
                     KTEIYENTNIVYQNKMMLNQLQQAVGLDSVAMATQAMGIQEDFQKHQRYGQAMQELYG
                     SLANNADFLSNVQGLVASSGKTPDQWFRDQRTLLETGDKTAKRLFGLGQDVTKNNEKL
                     AQRRRDLQQDLNMNQTAQATAQLTNQMLDVMAGQNADLLQLIGAKTQADAVKDQKVNA
                     DTAEKTAAAEQLARQQADELQKLRQQVFSRGTLSGK"
     gene            410847..411848
                     /locus_tag="CNE_RS38540"
                     /old_locus_tag="CNE_BB2p04000"
     CDS             410847..411848
                     /locus_tag="CNE_RS38540"
                     /old_locus_tag="CNE_BB2p04000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbL"
                     /protein_id="WP_013954476.1"
                     /translation="MGYSAPLRLLLCAILVALSLVSGPATAQPSGETSNIASSLTPAA
                     GSTGEALSSTIRELLALRDGLLDGGIAISRTTAPEAGKFAWALTVLTLVIAGFRFTAH
                     RNPVGAWVEFIESLTVLGIFAAMYLSFDSFGTGIFKWFDQLARSMSAGNYDTGSLLAY
                     TAGKFLDSFFKAFRVAAWYDKLDVIFSCLGLLIAFALTAAASIVYTYFVMIGQLQAAV
                     GLAIGLIAVSLGFSEYTRKYFWAWFDFMVTASMYVVTAAIIANLVAASTGETIQKVAD
                     IGTSTAAAGWKAASLSVLVLLISFEIPKLAGSLFGTGGGVSGGAAMGLAKGAWKLGK"
     gene            411860..413125
                     /locus_tag="CNE_RS38545"
                     /old_locus_tag="CNE_BB2p04010"
     CDS             411860..413125
                     /locus_tag="CNE_RS38545"
                     /old_locus_tag="CNE_BB2p04010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_013954477.1"
                     /translation="MNQHLPQDASTLLASHEQRIALIRQYANEANPADFDAKWLVVLR
                     ACASWFSTMPLQPDQHSEPGGAFRATVEVAYFAMRLSGGQKFAADQPSERRRRLEPQY
                     LYALFLAACCSWLDEPCRHFHIVREDTGEQWLPAAHGAFHTWLAGNAYRVIRLEAPLP
                     VERMRSALLARSILGAESLSWLDGPVLSELFGAINPAPMPTGFEAQLHKIVRQAVAAA
                     RDYEQKARRAVFAPDTTVPPSAEQLAAAATPGVPAVSDTRSPAGRVPEPVAPTPSAAA
                     AAAALFQAPVAPAEPVVATALAPHAETATPLAPPTPAPAAIDAAAIGRARRDAPDPFM
                     ALLGGSRMMSEFFRALAQDVTAGKIKVVWAEKGLVLPKKMLGNYGIASDTLIENLRKL
                     SLLYAMQGTDLILAERIGTLILPRPNTLA"
     gene            413130..414986
                     /locus_tag="CNE_RS38550"
                     /old_locus_tag="CNE_BB2p04020"
     CDS             413130..414986
                     /locus_tag="CNE_RS38550"
                     /old_locus_tag="CNE_BB2p04020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018432937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_041229421.1"
                     /translation="MVKYINHLRPMFEARAAAGWALALMLIATSGMPHAGYFAALCVG
                     MLLLRGTQVWRALAFRMAISTKWLAKIRIDRLLTASATLRESDDAMYLGTGFEWTQKH
                     CQIAHDILRMPASEIPGLPRWLPTKIARAVEARFAPPESIRDHTPQGQSWIHGMEPKK
                     APVPLHYKALGGHTAVGGTTGAGKTRTYEIIATQVIHNAEDVLIIIDPKNDRDLKDRV
                     KQECERTGRKFLYWKQAAPSESIRLNPLENWSQPSEIPSRIAQLMEEGPFRDFAFLFI
                     DRAVKGELYVGDKPNLRSILNYAQSGINSLLERCLKRFFPESGMADWEDEVNGFMQKL
                     GQKSGATLLDGMVQLYLQRFANVGRGHESIDGLVSTFTHDRDHYMRIIASALPLLQML
                     ATGETGLMLAPKADDFEDDREIWDIDKIIKQKAVLCVGLDSMSNSIVAKAIASMILSD
                     IASVAGTIYNFYDKPPGVVLIIDEVAEAINEQVIQILNKGRGAGFKAFVAFQSRSDLE
                     AKLGNAAKMLQVLANLNNQIILRLEDTDTAQWFSDKVGETGITNIVQSSTTSTGSEAH
                     VGEFSGSVSRSRQLEKVPLIPVRLITQLPNLQYFLRVSGGAVYQGRIPIIEG"
     gene            414995..415501
                     /locus_tag="CNE_RS38555"
                     /old_locus_tag="CNE_BB2p04030"
     CDS             414995..415501
                     /locus_tag="CNE_RS38555"
                     /old_locus_tag="CNE_BB2p04030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018310251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954479.1"
                     /translation="MTSLFRQIVKEHKLSAKLSPVFICFPELDDVCTRLVDFIGLNFI
                     VRDDPLVKEMLMDALAGFKAERKDGYGNVAFMRGLFGRAHELYAKRYAAFKGEKYNVW
                     APFLEPIPLFEGRQAPGYVCRMVDEPCPEPITPRSAAFQLAARVLKGPTFRRYFEEYD
                     VCGQLAHC"
     gene            415536..415718
                     /locus_tag="CNE_RS38560"
                     /old_locus_tag="CNE_BB2p04040"
     CDS             415536..415718
                     /locus_tag="CNE_RS38560"
                     /old_locus_tag="CNE_BB2p04040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954480.1"
                     /translation="MRAWVRANDAEASVPGQFAQGRHAFAMAMVKLEQSRPAQFWGGL
                     LAFVAIPFLALHALVR"
     gene            415720..416337
                     /locus_tag="CNE_RS38565"
                     /old_locus_tag="CNE_BB2p04050"
     CDS             415720..416337
                     /locus_tag="CNE_RS38565"
                     /old_locus_tag="CNE_BB2p04050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013954481.1"
                     /translation="MSNSRFVSHLRLWLIVTPVLLATLAPMLPDDGHFEVDGAEQASV
                     ESLFGEARAEDIASRANARFGAWFADSGAIRRSYSGSANQSLISDGGAAGVAASWMRH
                     FWMEMYRSIYRATVAGNWAWGALFFAVAMLNDGAVQRRIRAAAAGVASPVGFHLAAHG
                     LLIALGVSASALLLPFSLPASVWTVATACVGVLAWRLAASFHVNR"
     gene            416416..417300
                     /locus_tag="CNE_RS38570"
                     /old_locus_tag="CNE_BB2p04060"
     CDS             416416..417300
                     /locus_tag="CNE_RS38570"
                     /old_locus_tag="CNE_BB2p04060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013954482.1"
                     /translation="MTTNTDTAVVTQDDALLAATMDALAPNTAIEEPADAAPGTNPGV
                     TDGADDGSIERELADMETAADSLRKEGLISADEAEEKKAEVANTRKRFRELKPEDRAV
                     IIRRRREIGAQILTRQLAGAAVVPVAIKLNHTRLRPLFEQWWPFMNRMSINLQRFGGA
                     TFGKGELSTVETYFERELTRMEDYVDEQLRVAEAYRDQRESEMRARNDIVFEPTVTLP
                     SLNLTVEAYSRFSMRVLGVLAKFDRTMDQFDFMVWNGIRDQSDINDEVASFLRKFHPL
                     GLRSYMTHLKLMTTVRAV"
     gene            417363..417554
                     /locus_tag="CNE_RS38575"
     CDS             417363..417554
                     /locus_tag="CNE_RS38575"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041229422.1"
                     /translation="MNIRGAWVEFQTDLDSYGEGRVIAHNERTGDLVIRDDDGIHWRG
                     AEDHIELIVQPSELDTHAG"
     gene            417544..419265
                     /locus_tag="CNE_RS38580"
                     /old_locus_tag="CNE_BB2p04070"
     CDS             417544..419265
                     /locus_tag="CNE_RS38580"
                     /old_locus_tag="CNE_BB2p04070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018310256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_041229423.1"
                     /translation="MLAELNPAQREVVELRRHCVAVACPGAGKTKTIATKAAMLLAEP
                     KATVGAVTFSKDAALELRERILALAGPATKKRLLAGTFHSLAYKQLGRRDGGAPDIAT
                     EGDRTGLLIQVLSDVGLDWKVEDGIAAIEAIKTNFGQVQSGSAEELLYRGYQDSLDRN
                     GKIDFQDMLRLAVEGMQNGTIEPYPFTYLLVDEFQDTDPLQYQWIALHARAGSIVTVV
                     GDDDQSIYGFRSALGFRGMESFIRQFDAQPVVLGNNYRCHAEILGAADRIIRNNRDRI
                     PKELVAHKGPGGQVRFQRFPDEYAEAVAAMEHLAVALRNGQSAAILARTNRILDPVEA
                     VCRSHGVKYYRASGKSILSRPEAALMCNLLELVQKTKSTGVDALLSFVGIGTQELRLL
                     HSKGRASTEQRQRKELLELGLSEASTDRYRELMKRLAEWRSLCDRQFYSLVLEGAREW
                     MMQHTDADPARRAITTTYDVLSRLNGPFSDRLEFLRRDNNEPAPDALILTTMHSSKGL
                     EWDRVWIIRAEETVVPDEKSTESEERRLFYVAVTRAREDLRLSMAKKNPTSRFVLEAG
                     IDVAIAT"
     gene            419654..420883
                     /locus_tag="CNE_RS38585"
                     /old_locus_tag="CNE_BB2p04080"
     CDS             419654..420883
                     /locus_tag="CNE_RS38585"
                     /old_locus_tag="CNE_BB2p04080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013954484.1"
                     /translation="MKFSFDGLPIARRTTMCGGTSHAPNPVAADGRQPKAARLDAGRL
                     PERILRAIALVYESDGLRTLHITNRQVLATLVRFALNQKDPSALAFIKKATIAQHLGI
                     SEATVYRALGALENAGLIERERQRRTRAQLEVVGRIGFSAKLLRCIGIASPQFQSTVH
                     VPARSDESRTSACLASVSGVNKTMQSSTKKHPGSGSSLRIDGRAVPMDLAPLVRDQSL
                     KMSALFLLMRLARTAGHRLSDVVSAAGNALGPLRGRELFAYLKSLLERPVDYGHVVRT
                     RKLREDDERAAEARATQERQQIAELVERYRGKRVSAPDGSTYEVDSASIVITDANGHR
                     SSLAHDRARAWLIELDKVAGGLAPAVAQPAQARQRSSVVAHAAIEDIRRLMRARQAPQ
                     YVSRRPVRPDAGVCRSA"
     gene            <420847..>421399
                     /locus_tag="CNE_RS38590"
                     /pseudo
     CDS             <420847..>421399
                     /locus_tag="CNE_RS38590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012354593.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start and stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            complement(421569..422936)
                     /locus_tag="CNE_RS38595"
                     /old_locus_tag="CNE_BB2p04110"
     CDS             complement(421569..422936)
                     /locus_tag="CNE_RS38595"
                     /old_locus_tag="CNE_BB2p04110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013954485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_013954485.1"
                     /translation="MDSASQQLALALFEDFGPRGRSVTEAPKDLGFRRSNAFVKIIDL
                     SLAGRRLIDVAYFLVAEDQEVRREYRVDVGLFKWLLATTSNNRRHLGKLVREAQKAAI
                     ELNEIDVEDPSKDRWGAVPLMGSAFIEKGEFIFELPERLQRAIKNPKSSHFLSLRYVF
                     KSVHSKVLYDRLQQFMVEGITPWFEVQALRAWLECEKKTYDLFKHFRSKVLEVAISEI
                     REVTGLHIEMLTLNVPGSKKIGQVRFRLNAIEQPNEQKTAFIVLRNVYETLRKEFALN
                     QSEFNEIITNRDLYNDERIHQAMEYTRHNVKVGKVKVRAGGYFMKALREGYLLGELDK
                     QIHHQSAIAESTRKAADQEMAEREARVKAAGAERDQREADLGWEAYNKLSAEQQSDMI
                     AEFCQSQAAKLLARRLKVGSLNVHEHINDPNVRSTFGGFVASRMHKAAKAAKRVGAAA
                     SASLI"
CONTIG      join(CP002880.1:1..424140)
//
DBGET integrated database retrieval system