GenomeNet

Database: RefSeq
Entry: NC_015726
LinkDB: NC_015726
Original site: NC_015726 
LOCUS       NC_015726            3872936 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Cupriavidus necator N-1 chromosome 1, complete sequence.
ACCESSION   NC_015726
VERSION     NC_015726.1  GI:339324158
DBLINK      Project: 68689
            BioProject: PRJNA68689
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 3872936)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of the type strain Cupriavidus necator N-1
  JOURNAL   J. Bacteriol. 193 (18), 5017 (2011)
   PUBMED   21742890
REFERENCE   2  (bases 1 to 3872936)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3872936)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002877.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3872936
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /chromosome="1"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1843
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /db_xref="GeneID:10920037"
     CDS             101..1843
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_004683852.1"
                     /db_xref="GI:339324159"
                     /db_xref="GeneID:10920037"
                     /translation="MQDFWQAAAAQLERELTPQQFKTWIKPLAPVAFDEETHALRIAA
                     PNRFKLDWVKSQFSGRITALACEYWEAQVSVQFVLDPAASGRAAAYMQPAQPGMDGHA
                     APGTGMAGYPGAQPMGGQVPFAMPGQPGYGEYPTPAAYGMGQPQYGNPVGMPSAAPVP
                     AGARAQAPGMGGQHPGQHHPQHGADMGEIDVVHMDPAEASARSYRVQPQQPQQPHPSH
                     QPHQQMGGATPMPGHQPSDTVHERSRLNPILTFDNFVTGKANQLARAAAIQVANNPGK
                     SYNPLYLYGGVGLGKTHLIHAIGNYMLLENPRARIRYIHAEQYVSDVVKAYQRKAFDE
                     FKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEISGID
                     DRLISRFDSGLTVAIEPPELEMRVAILMKKAAAESVNVPEEVAFFVAKHLRSNVRELE
                     GALRKILAFSNFHGKDITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMY
                     SKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQ
                     LNHELHVLEQTLKG"
     misc_feature    101..1840
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    104..295
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    353..>616
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; cl19732"
                     /db_xref="CDD:268085"
     misc_feature    872..1303
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    953..976
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(956..979,1142..1144,1250..1252)
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1130..1147
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1292..1294
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1565..1834
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1634..1636,1658..1663,1682..1684,1700..1708,
                     1733..1747,1754..1756,1763..1768)
                     /gene="dnaA"
                     /locus_tag="CNE_1c00010"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            2212..3327
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /db_xref="GeneID:10916393"
     CDS             2212..3327
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_004683853.1"
                     /db_xref="GI:339324160"
                     /db_xref="GeneID:10916393"
                     /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVS
                     FLSTDIEIQITTHAECGVGSDSIATTVAARKLLDILRAMPDGDVALSLNDKRMTVQSG
                     KSRFALQTLAAEEFPTVAEASEFNASVSLPQKTFKHLLAMVHFAMAQQDIRYYLNGML
                     LVVEGKKVMAVATDGHRLAYCGVELETEAVGVGARQEVIIPRKTILELQRLLEDNDDP
                     VQVQLAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVRLQQALQRTA
                     ILTTDKFKGVRCILDTHMLKISSTNADQEEAQEELELDYSGDALDIGFNVTYLLDVLA
                     NLKSEQVQVSLGDSNSSALITVPEDDNFKYVVMPMRI"
     misc_feature    2212..3324
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    2221..3321
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(2284..2286,2431..2433,2452..2454,2818..2820)
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2434..2436,2443..2445,2518..2520,2524..2526,
                     3040..3042,3133..3138)
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2728..2730,2734..2745,3184..3186,3310..3321)
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2728..2730,2734..2739,2965..2967,3070..3072,
                     3109..3114,3193..3195,3310..3321)
                     /gene="dnaN"
                     /locus_tag="CNE_1c00020"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            3557..6082
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /db_xref="GeneID:10916394"
     CDS             3557..6082
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_004683854.1"
                     /db_xref="GI:339324161"
                     /db_xref="GeneID:10916394"
                     /translation="MTEQQNPQQENTYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
                     HHLVFEVLDNSIDEALAGYCTEIQVTIHSDNSISIVDNGRGIPPLVKFDDKHEPKRSA
                     AEIAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWLRLTVRRDGQVHLIEFAKG
                     DVQNRIVETVTGPDGQPVEVSPMKIIGATDKRGTEVHFLADEEIFTNVEFHYEILSKR
                     IRELSFLNNGVHIKLVDQRTGKEEDFAFSGGVKGFVEYINRSKSVLHPTIFYANTEKD
                     GIAVEVAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIEENEVAKKA
                     KVETTGDDMREGLSCVLSVKVPEPKFSSQTKDKLVSSEVRLPVEELVGKALSDFLLET
                     PGDAKIICGKIVDAARAREAARKAREMTRRKGLMDGMGLPGKLADCQEKDPALSELFL
                     VEGDSAGGSAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITALGTGIGK
                     DDYNLDKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPDIIERGYVYIAQPPLYKIK
                     HGKEERYIKDDVELNAYLLKLAMEKAVLVRPDGTEINGDALTELARQYQLTEGVISRL
                     SRIVDTDALRAIADGVALDLDSAAAAEASAVALKAKLAEMHAKTLIGAAVNDDGTADV
                     YAQFDEKTDKHRLMIARRHHGNVRLSHLDADFVHGADYAALSNAAKTFQGLTPEGTKV
                     QRGEGEKLRDQTVNDFHGAMQWLLAEAERGVSRQRYKGLGEMNPEQLFETTLDVTQRR
                     LLKVQIEDAIAADQIFTTLMGDEVEPRRNFIESNALVARNIDV"
     misc_feature    3575..6079
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    3686..4006
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(3704..3706,3716..3718,3725..3727,3791..3793,
                     3797..3799,3803..3805,3809..3814,3941..3952,3986..3988,
                     3992..3994)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    3716..3718
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(3803..3805,3809..3811,3941..3943,3947..3949)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4298..4771
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4451..4453
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4625..4627,4634..4639,4643..4645)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4643..4645,4649..4651)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    4892..5236
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(4910..4915,4922..4924,5132..5134,5138..5140,
                     5144..5146)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(4910..4912,5132..5134)
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    5852..6046
                     /gene="gyrB"
                     /locus_tag="CNE_1c00030"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(6758..7243)
                     /locus_tag="CNE_1c00040"
                     /db_xref="GeneID:10916395"
     CDS             complement(6758..7243)
                     /locus_tag="CNE_1c00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683855.1"
                     /db_xref="GI:339324162"
                     /db_xref="GeneID:10916395"
                     /translation="MSTASSTPRMPPATENGKNDGLSRIALQRWTRGSGLRIDGRQAL
                     QNLIHDVESGAADFQVILVYDVSRWGRFQDADESAYYEYICRRAGFQVAYCAEQFEND
                     GSTVSTIVKGVKRAMAGEYSRELSSKVFAGQCRLIEMGFRQGGPAGYGLQRSSRTSTE
                     S"
     misc_feature    complement(6848..>7144)
                     /locus_tag="CNE_1c00040"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    complement(<6791..>7123)
                     /locus_tag="CNE_1c00040"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(order(7031..7033,7040..7045))
                     /locus_tag="CNE_1c00040"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     gene            7570..8463
                     /locus_tag="CNE_1c00050"
                     /db_xref="GeneID:10916396"
     CDS             7570..8463
                     /locus_tag="CNE_1c00050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683856.1"
                     /db_xref="GI:339324163"
                     /db_xref="GeneID:10916396"
                     /translation="MGKNALLWGVAATLLTLTAPAHAVADWQELGAQFYTGNGFKQYS
                     NSTDMTTGAPTGASTHLDIFQLNYSNGWKYGATFFYFQNAFDHGNYRMYTQGWEFLSL
                     NKIFDADLSFGPIKEIRLAPGWQFATSKDYYAGTQNQGNAADYGAKMVYPAVDTRDLF
                     LGLDFPLKVPGFDYLGVSVGVYKDFQPKTRYTLQPSVNLYYRSTFFIGPTRWKAQGYA
                     QWYGARNARENSNYDAVAYFTTQDALLLDTGLLLWDRPDQFYAGVQLQWSHNTYGVKT
                     IEGVSKATNEFFPQLMFEWIF"
     gene            8484..9533
                     /locus_tag="CNE_1c00060"
                     /db_xref="GeneID:10916397"
     CDS             8484..9533
                     /locus_tag="CNE_1c00060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683857.1"
                     /db_xref="GI:339324164"
                     /db_xref="GeneID:10916397"
                     /translation="MHLNRQIGNFPRVLRALGFFYAIYVACLPPAQAQPTPAPTQVKI
                     AAVLGSGPDDPWNATLISTWKQLRAAKPHGLAINDPVYTEGVFGSAAEAALRLYARKG
                     YDIIWAHANYTDEVRRIHAQYPNTLFVLTGAPNEPIGANVYLLYNRIYEPSYLAGIAA
                     GMLTRTGVVGAVAGFPTEDTNDAINAFFAGARSVRPDVKQKVSFIASWWDPPMATEAM
                     KAQVAGGVDQEFMLSSTFDVCKQQKVTCYGAYRDWSPVAPQNIATSALGNWTPGFKWI
                     LDEWHASRVGGKPLAGNMNKRYFGMAEGGAELAPFHDFPMPPQIAARISETRARIEAR
                     QQTVELDVSKPASSK"
     misc_feature    8547..9521
                     /locus_tag="CNE_1c00060"
                     /note="Uncharacterized ABC-type transport system,
                     periplasmic component/surface lipoprotein [General
                     function prediction only]; Region: Med; COG1744"
                     /db_xref="CDD:224658"
     gene            9542..11092
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /db_xref="GeneID:10916398"
     CDS             9542..11092
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ATP-binding protein RbsA"
                     /protein_id="YP_004683858.1"
                     /db_xref="GI:339324165"
                     /db_xref="GeneID:10916398"
                     /translation="MQAIPHLRVRNLSKRFGNFTALGDVSIEIARGEMHCLLGENGAG
                     KSTLTSCLSGYLQADAGTIEVYGQALDIRSPMDARRAGIGKVFQHFVLANPLTVVENV
                     IAGSPQRGFLPRTAATRARLHERCRKYGLSLDLDCPVGDLDVGQQQWAEILKCLNTEV
                     DLLILDEPTAVLTPQESVQLFSVLRTLTGEGTTVVLITHKLDEVLQCDRVTVMRKGRV
                     IDTVEAARCTRDDLSTLMVGHATSTPRRGASSPGAPRLVLEGLSASAGRRPLHGIDLT
                     VHRGEIVGIAGVSGNGQKELFEVIAGARRATAGRLLCDGVDLTNHDPGTISRAGIGHI
                     PQDRFAEGLVGELSVADNLMLGRHRDPVFSRRGFLSRKRAEAFAQDCIDRFAISTRSV
                     HTKAGTLSGGNAQKIVIARELYQASKVVLANQPTRGVDVGVIESIYRLLLDKRNEGYA
                     ILLASDELDDLFNLCDRIAVMYEGRIAGIFDATQVTIAQIGHLMAGGAHIPPAPALQP
                     APCLKDLP"
     misc_feature    9560..11029
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    9560..10204
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    9656..9679
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(9665..9670,9674..9682,9803..9805,10037..10042,
                     10136..10138)
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    9794..9805
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    9965..9994
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    10025..10042
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    10049..10060
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    10124..10144
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    10295..10969
                     /gene="rbsA"
                     /locus_tag="CNE_1c00070"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            11089..12183
                     /locus_tag="CNE_1c00080"
                     /db_xref="GeneID:10916399"
     CDS             11089..12183
                     /locus_tag="CNE_1c00080"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004683859.1"
                     /db_xref="GI:339324166"
                     /db_xref="GeneID:10916399"
                     /translation="MNARLGRALTLGSLLSFPAAGHGRTVATLAAGTLVGLSVSALLL
                     VAGGYPLGAALSSLWSGAFGGFAEGLDTLRDATPLFLVALATIVSYRAQLWNVGQEGQ
                     LVLGAIFCYGATLLAAGLPQPLPWLLPLCAGVAGGALWSTPPALARVRWGVNEIVSTM
                     MFNYIAVFLLMYLVGHVWPESSATYLQTAPIGAPAHLPAWNAEGTLNAQFLIAAVVAL
                     ALAVLFGRSVLGFEILSFGLNARTSAFKGIAAGATCLKVFAISGGIAGLCGAVMLLGT
                     QWRLAPATLASGVGYSGIMVAMLGRLHPAGALLAALLFGALNTGSAAMQLEAGVPSTM
                     ARVMQAVLLISFLLAQAINQAQPAKRGRDA"
     misc_feature    11314..12129
                     /locus_tag="CNE_1c00080"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    11809..11865
                     /locus_tag="CNE_1c00080"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            12176..13114
                     /gene="rbsC"
                     /locus_tag="CNE_1c00090"
                     /db_xref="GeneID:10916400"
     CDS             12176..13114
                     /gene="rbsC"
                     /locus_tag="CNE_1c00090"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_004683860.1"
                     /db_xref="GI:339324167"
                     /db_xref="GeneID:10916400"
                     /translation="MHDLLNNAVAVGLLAAAVRMLTPLLLAAAGELVAEKAGIMNLGV
                     EGTMMTGCFVAFLVTFLSGSLALGIAAAVLSGAALGGLMAFATVTLRIEQFIMGLAIN
                     LLSSALTAYGFRALLKQVPAEQAVIEPLSTLRIPGLADLPLVGEALFNQTWMTYLAYL
                     MVPAIALLLYRTRLGLELRSLGENPKLLDTAGHSVGVPRYGAVIFGGAMAGLAGAALS
                     AGSSMRFVEEMTAGRGWIVIVIVVAANWRVWRVPLVTAVFALLQAAQLQAQANGVAFP
                     YEILLALPYIAAVGIMIAFRSSSRMPSALGVPYRRQ"
     misc_feature    12239..13051
                     /gene="rbsC"
                     /locus_tag="CNE_1c00090"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    12731..12787
                     /gene="rbsC"
                     /locus_tag="CNE_1c00090"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(13178..14170)
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /db_xref="GeneID:10916401"
     CDS             complement(13178..14170)
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-typetranscriptional regulator PtxR"
                     /protein_id="YP_004683861.1"
                     /db_xref="GI:339324168"
                     /db_xref="GeneID:10916401"
                     /translation="MNFLLDLQAAGDGATNVIDLKMVEAFALVMRHGSLTSAENASGV
                     PKATLRRHLMRLESALGVQLFVRTAGKPVPTEAARDFYANCTRLLGELQAGLEQASLA
                     ARELGGGERGHLSIVATSHLSTSYVNHVLRRYVQTHPEVVCHVDLVSDSSAAIGNDID
                     CYVCSVPRTDLELAARLLGRLTYRLYASQEYVGTHGAPATPSDLARHKLLVQDEQRGE
                     IALRTGDGAWQSLGQLNIAASSNDLWVIKTMAARHHGIALLPEFFVHGEVAAGSLQPI
                     LPHWEAPSLPVYCMYPRQRFMNRKLRAFIDMMVDSFGKIESCSYYLVGSASSAG"
     misc_feature    complement(13229..14119)
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(13934..14113)
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(13247..13837)
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(13310..13312,13391..13393,13442..13444,
                     13628..13630,13634..13636,13676..13678,13793..13795,
                     13805..13807))
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(13415..13417,13424..13429,13448..13462,
                     13547..13549,13724..13741,13748..13750,13754..13756,
                     13766..13768,13775..13780,13784..13789,13799..13804))
                     /gene="ptxR"
                     /locus_tag="CNE_1c00100"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(14172..15149)
                     /locus_tag="CNE_1c00110"
                     /db_xref="GeneID:10916402"
     CDS             complement(14172..15149)
                     /locus_tag="CNE_1c00110"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004683862.1"
                     /db_xref="GI:339324169"
                     /db_xref="GeneID:10916402"
                     /translation="MPPARTDATMPDLKLIEAFVFAMRYGSLSAAEAQSGVPKATLSR
                     LIARLEESLGAELLLRSARGTVPTEAGQQFYVRAQRMLDAVSAEYEAAAAAVQNLSSD
                     ISGELCIATPSYLSSSFVTYVVSRYMQLHPNIVCRLTLVSDPVTDISRDIDCYVTSRP
                     PLGPHLASRQLGTLRLRLFASAGYLARYGAPAAPADLARHKALILRRHAPTIALQLSR
                     DGVTESCLVPVASSTNDYWILKSMAIDGYGIAVLPDFFAQPEVDGGMLQVVLPEWEAP
                     ALPVHCTYHAQRQIGRKLGALLDLMADAFTRIHALHVYIAGGAATSRTG"
     misc_feature    complement(14229..15119)
                     /locus_tag="CNE_1c00110"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(14934..15113)
                     /locus_tag="CNE_1c00110"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(14247..14837)
                     /locus_tag="CNE_1c00110"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(14310..14312,14391..14393,14442..14444,
                     14628..14630,14634..14636,14676..14678,14793..14795,
                     14805..14807))
                     /locus_tag="CNE_1c00110"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(14415..14417,14424..14429,14448..14462,
                     14547..14549,14730..14750,14754..14756,14766..14768,
                     14775..14780,14784..14789,14799..14804))
                     /locus_tag="CNE_1c00110"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(15266..16345)
                     /gene="add1"
                     /locus_tag="CNE_1c00120"
                     /db_xref="GeneID:10916403"
     CDS             complement(15266..16345)
                     /gene="add1"
                     /locus_tag="CNE_1c00120"
                     /EC_number="3.5.4.4"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="YP_004683863.1"
                     /db_xref="GI:339324170"
                     /db_xref="GeneID:10916403"
                     /translation="MARCGQHRHTQLSFPIMDDHKRLDFIHALPKVELHVHLEGAIAP
                     ERLLMLGRRNGIALPYDTVAQVRAAHAFSNLDEFLGHFGAVCSVLNTSEDFADAVLDL
                     GADARRQNIHYREVMFTLAQHQRRGIPLEAVVAGLQIGRQRCREQHGVEIAFIADIDR
                     TMSAAEARAMVDSLATFSLSAGVVAVGMDGQEVGISPATHRDAFLRARELGFHTTAHL
                     GWDEDPEAIWEALDALPLERIDHGLRAVEDPRLIDVLVQRQIPLTLCPLSSLAVEPGR
                     YPDLAAHPLREMWRRGAAVTLNSDDPMMIGQDLLANYIDVARAYHLQRDDLVRLAGNG
                     MRAAFVPEHLKREWLQQLDRYAAPS"
     misc_feature    complement(15275..16279)
                     /gene="add1"
                     /locus_tag="CNE_1c00120"
                     /note="adenosine deaminase; Provisional; Region: PRK09358"
                     /db_xref="CDD:236480"
     misc_feature    complement(order(15446..15448,15623..15625,15695..15697,
                     16235..16237,16241..16243))
                     /gene="add1"
                     /locus_tag="CNE_1c00120"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(16483..17322)
                     /gene="fghA"
                     /locus_tag="CNE_1c00130"
                     /db_xref="GeneID:10916404"
     CDS             complement(16483..17322)
                     /gene="fghA"
                     /locus_tag="CNE_1c00130"
                     /EC_number="3.1.2.12"
                     /codon_start=1
                     /transl_table=11
                     /product="S-formylglutathione hydrolase FghA"
                     /protein_id="YP_004683864.1"
                     /db_xref="GI:339324171"
                     /db_xref="GeneID:10916404"
                     /translation="MIELLSEHMCHGGRQQLYSHTSAATGLPMRFSAYLPPAAAHGPV
                     PALIYLAGLTCNEETFVIKAGAQRFAARHGLMLIAPDTSPRGAGIEQASTDSDFGLAA
                     SFYVDAVTAPWSRHFRMESYIALELPELIESALPVARGRIGIMGHSMGGHGALMLALR
                     HPGRFRSVSALAPIAAPTQCPWGRKAFAGYFGGDVAAWADHDASQLMAAASTPYPQGI
                     LVDQGMDDPFLASQLHPSSFEDACRQARQPLELRRHPGYDHGYFFIMSFIGDHIAHHA
                     AQL"
     misc_feature    complement(16486..17319)
                     /gene="fghA"
                     /locus_tag="CNE_1c00130"
                     /note="Predicted esterase [General function prediction
                     only]; Region: COG0627"
                     /db_xref="CDD:223700"
     misc_feature    complement(16486..17316)
                     /gene="fghA"
                     /locus_tag="CNE_1c00130"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2819;
                     cl19187"
                     /db_xref="CDD:267540"
     gene            complement(17384..18361)
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /db_xref="GeneID:10916405"
     CDS             complement(17384..18361)
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /EC_number="1.14.13.82"
                     /codon_start=1
                     /transl_table=11
                     /product="vanillate O-demethylase"
                     /protein_id="YP_004683865.1"
                     /db_xref="GI:339324172"
                     /db_xref="GeneID:10916405"
                     /translation="MDTIRTVIRRKYPVAEDIIALELVAEHGGALPAFAAGAHIDLHL
                     PARGGGKPLIRQYSLCNGPDEAGCYLLGIKREPGSRGGSLAVHDHLREGDVLTIGMPR
                     NHFALAEGGPSLLFGAGIGITPLLAMVLQLRAARRPFTLHYFARSPAHVAFHERLVHA
                     SQAGQVHYHFGLSPEQTHDALRGAIAQATPATHVYSCGPSAFMDGVMQLARRVLPDTQ
                     IHYEYFQAAANVAGQGSADAPFEVVAARRGVHCMVPPGMSIVQALYAQGIEIEVSCEQ
                     GVCGTCMARVLEGTPDHRDVYLTEAEKATGDVVMPCCSRALTARLVLDV"
     misc_feature    complement(17573..18358)
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
                     family 1 [Energy production and conversion]; Region: Hmp;
                     COG1018"
                     /db_xref="CDD:223949"
     misc_feature    complement(17687..18337)
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="Phthalate dioxygenase reductase (PDR) is an
                     FMN-dependent reductase that mediates electron transfer
                     from NADH to FMN to an iron sulfur cluster. PDR has an an
                     N-terminal  ferrredoxin reductase (FNR)-like NAD(H)
                     binding domain and a C-terminal iron-sulfur; Region:
                     PDR_like; cd06185"
                     /db_xref="CDD:99782"
     misc_feature    complement(order(17690..17692,17993..17995,18113..18118,
                     18122..18124,18140..18148,18188..18190,18194..18199))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="FMN-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99782"
     misc_feature    complement(order(18188..18193,18197..18199))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="flavin binding motif; other site"
                     /db_xref="CDD:99782"
     misc_feature    complement(order(18083..18085,18104..18106,18113..18115,
                     18122..18124))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99782"
     misc_feature    complement(order(17990..17992,17996..18007,18017..18019))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99782"
     misc_feature    complement(order(17765..17770,17924..17932,17999..18004))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99782"
     misc_feature    complement(17408..17641)
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(17426..17431,17516..17527,17531..17533,
                     17540..17542,17549..17554))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(17426..17428,17516..17518,17525..17527,
                     17540..17542))
                     /gene="vanB"
                     /locus_tag="CNE_1c00140"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            complement(18383..19012)
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /db_xref="GeneID:10916406"
     CDS             complement(18383..19012)
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase Gst"
                     /protein_id="YP_004683866.1"
                     /db_xref="GI:339324173"
                     /db_xref="GeneID:10916406"
                     /translation="MIKLYNYELSGNCYKLRLMMHLLGVAYTSVAVDFHPGREHRSEA
                     FLAINPFGQLPVIEDGDYRLRDAQAILVYLASRYDETLSWFPMDPEARGQVVSWLAVA
                     DDITRTASAARLHDALGYQLDVETARRDAHVLFRRIDDHLAEAEIAGRGWLVGGSATI
                     ADIACFPYVALSHEGGIARDSYPALRRWIERVRRLDGFIGMPGIFAIAL"
     misc_feature    complement(18407..19009)
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    complement(18788..19009)
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="GST_N family, unknown subfamily 4; composed of
                     uncharacterized bacterial proteins with similarity to
                     GSTs. GSTs are cytosolic dimeric proteins involved in
                     cellular detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of...; Region:
                     GST_N_4; cd03056"
                     /db_xref="CDD:239354"
     misc_feature    complement(order(18797..18802,18809..18811,18947..18952,
                     18959..18964,18968..18973,18977..18979))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239354"
     misc_feature    complement(order(18812..18817,18848..18856,18977..18979))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239354"
     misc_feature    complement(order(18797..18799,18806..18811,18815..18820,
                     18854..18856))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239354"
     misc_feature    complement(18419..18730)
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    complement(order(18500..18502,18512..18514,18521..18526,
                     18533..18535,18704..18706,18725..18727))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(18602..18604,18701..18703,18710..18715,
                     18722..18727))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(18500..18502,18509..18511,18689..18694,
                     18704..18706))
                     /gene="gst"
                     /locus_tag="CNE_1c00150"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            complement(19040..19909)
                     /locus_tag="CNE_1c00160"
                     /db_xref="GeneID:10916407"
     CDS             complement(19040..19909)
                     /locus_tag="CNE_1c00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683867.1"
                     /db_xref="GI:339324174"
                     /db_xref="GeneID:10916407"
                     /translation="MMKPYIDPALAGEWLVAAASASVAPGQTFQACVLGQAIAVTRDM
                     AGGLRAQVRHDDASAQPEEIRVLEQYATIWIAFETPTRPLFAIDEFDQPGRRIIPCGA
                     IGVHTSGLRIVENFLDMAHFPYVHTDWLGKEPHSAVAEYKVEWRQATDELWATDCRFW
                     QPRAAPSADGGLDIVYTYRVMQPFTTMLYKSCPTRPGDVDFILLQVQPQDEEHSLVYS
                     LLGYFDDVSSNAEMISFMQLIFAQDKPILESQVPRRLPLDPRTEVPARADAMSIAYRR
                     WLRDKRLRFGVHA"
     misc_feature    complement(19073..19639)
                     /locus_tag="CNE_1c00160"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(19169..19171,19178..19186,19193..19195,
                     19199..19201,19211..19216,19250..19252,19256..19258,
                     19262..19264,19268..19270,19286..19288,19289..19291,
                     19295..19300,19352..19354,19358..19360,19364..19366,
                     19370..19372,19376..19378,19433..19435,19439..19441,
                     19445..19447,19451..19453,19478..19480,19559..19564,
                     19568..19576,19616..19618,19622..19624,19628..19630))
                     /locus_tag="CNE_1c00160"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(19936..20817)
                     /locus_tag="CNE_1c00170"
                     /db_xref="GeneID:10916408"
     CDS             complement(19936..20817)
                     /locus_tag="CNE_1c00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683868.1"
                     /db_xref="GI:339324175"
                     /db_xref="GeneID:10916408"
                     /translation="MNRPTLDNIDPALRDDWFVVSAASRVTAAASKTMLLGQPIAIWR
                     EHGQPVAASDIAPHARYRAMDCYGFTWVSLGAPQQALFAWPEYGEAQRRHVDCGAIGV
                     KTSGLRMIENFLDMGHFPYVHTGILGQEPHTEVKEYRVAVDDANELWATECRFWQPRA
                     AATAAAGIDVDYVYRVVQPYAALLYKTSPACAPARDVIALFVQPLTECESRAHLMMLL
                     FDETHGDSELIDFQQTIFGQDKPILESQLPARLPLDPRVETSARADASSSAYRRWLRA
                     RNVRYGTCETRADAPGR"
     misc_feature    complement(<20644..20781)
                     /locus_tag="CNE_1c00170"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(19972..20778)
                     /locus_tag="CNE_1c00170"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    complement(20080..20541)
                     /locus_tag="CNE_1c00170"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(20089..20091,20098..20106,20113..20115,
                     20116..20121,20170..20172,20176..20178,20182..20184,
                     20188..20190,20206..20208,20272..20274,20278..20280,
                     20284..20286,20290..20292,20296..20298,20353..20355,
                     20359..20361,20365..20367,20371..20373,20395..20397,
                     20476..20481,20485..20493,20533..20535,20539..20541))
                     /locus_tag="CNE_1c00170"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(20814..21527)
                     /locus_tag="CNE_1c00180"
                     /db_xref="GeneID:10916409"
     CDS             complement(20814..21527)
                     /locus_tag="CNE_1c00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683869.1"
                     /db_xref="GI:339324176"
                     /db_xref="GeneID:10916409"
                     /translation="MHTTVGSDFEASAHWFPVAVSGDIRQGEITQAFLDGQELALWRS
                     ADGTVHAWENRCPHRGTRFTLGRIIDDTLSCAYHGWRFEASGQCTLIPANPTLTPPRN
                     ACAKVFGTHEAGGFVWATLGTAPWSPAVPAAAATATAHCRAFVVEAAAQTVRERLLEH
                     PAYGYRGIGASVVGATDADGHATLAYLTPMSPERTLVHLVLSGPGAAAPGVAERLRAA
                     RSFKPRRAYVEAAGLENRP"
     misc_feature    complement(21162..21485)
                     /locus_tag="CNE_1c00180"
                     /note="Rieske non-heme iron oxygenase (RO) family,
                     N-terminal Rieske domain of the oxygenase alpha subunit;
                     The RO family comprise a large class of aromatic
                     ring-hydroxylating dioxygenases found predominantly in
                     microorganisms. These enzymes enable...; Region:
                     Rieske_RO_Alpha_N; cd03469"
                     /db_xref="CDD:239551"
     misc_feature    complement(order(21288..21290,21294..21296,21303..21305,
                     21351..21356,21360..21362))
                     /locus_tag="CNE_1c00180"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239551"
     gene            complement(21852..22964)
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /db_xref="GeneID:10916410"
     CDS             complement(21852..22964)
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /EC_number="1.1.1.284"
                     /codon_start=1
                     /transl_table=11
                     /product="S-(hydroxymethyl)glutathione dehydrogenase FlhA"
                     /protein_id="YP_004683870.1"
                     /db_xref="GI:339324177"
                     /db_xref="GeneID:10916410"
                     /translation="MKVKAAVAWEAGKPLTIEEVDLDGPRAGEVLIEVKATGICHTDY
                     YTLSGADPEGIFPAILGHEGAGIVVDTGPGVNSLREGDHVIPLYTPECRQCKFCLSRK
                     TNLCQAIRGTQGKGLMPDATSRFSLDGKPIFHYMGTSTFANYIVVPEIAVAKIREDAP
                     FDKVCYIGCGVTTGVGAVVYSAKVEAGASVVVFGLGGIGLNVIQAAKMVGADKIIGVD
                     INPARVPLASKFGMTHFVNPLDDQVGNVVDHIVQLTDGGADYSFECIGNTLTMRQALE
                     CTHKGWGQSFVIGVAAAGQEISTRPFQLVTGREWKGSGFGGARGRTDVPKIVDWYMEG
                     KLNIDDLITHTLRLDQINEGFDLMKRGESIRSVILY"
     misc_feature    complement(21855..22964)
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="Zn-dependent alcohol dehydrogenases, class III
                     [Energy production and conversion]; Region: AdhC; COG1062"
                     /db_xref="CDD:223990"
     misc_feature    complement(21861..22964)
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="class III alcohol dehydrogenases; Region:
                     alcohol_DH_class_III; cd08300"
                     /db_xref="CDD:176260"
     misc_feature    complement(order(22023..22025,22095..22097,22458..22460,
                     22698..22703,22779..22781,22806..22814,22839..22841,
                     22845..22847))
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176260"
     misc_feature    complement(order(22458..22460,22776..22781,22845..22847))
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176260"
     misc_feature    complement(order(21870..21872,22020..22028,22098..22103,
                     22155..22160,22170..22175,22296..22298,22308..22313,
                     22371..22385,22446..22448,22458..22460,22839..22844))
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:176260"
     misc_feature    complement(order(22647..22649,22671..22673,22680..22682,
                     22689..22691))
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176260"
     misc_feature    complement(order(22023..22040,22047..22055,22062..22085,
                     22092..22094,22119..22130,22149..22154,22185..22187,
                     22200..22202,22644..22646,22650..22652,22656..22661,
                     22665..22667,22674..22679))
                     /gene="flhA"
                     /locus_tag="CNE_1c00190"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176260"
     gene            23217..24133
                     /locus_tag="CNE_1c00200"
                     /note="response regulator receiver modulated diguanylate
                     cyclase"
                     /pseudo
                     /db_xref="GeneID:10916411"
     gene            complement(24173..25435)
                     /locus_tag="CNE_1c00210"
                     /db_xref="GeneID:10916412"
     CDS             complement(24173..25435)
                     /locus_tag="CNE_1c00210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683871.1"
                     /db_xref="GI:339324178"
                     /db_xref="GeneID:10916412"
                     /translation="MPPTPPIREALQAIACRRRALHNDQKYQKFLIAVIGRDVAVAGE
                     KLRIPNVTQATIRSALDEFDRVLRGTQKWEDWEIKKSQLYAISDQGKLYPPKQILSMA
                     TGVPVSRFSGGEQTNAYLENLGFSIVRLPGGSPPFAGFEPPKFALGRVYHRQTEIHDR
                     FGGSRQSGIAPSSKVPAVFIFTGESGEQYGYFDGRDELGMFSYTGEGQVGDMEFKRGN
                     LAIREHAANGQALHLFKALGKGKGQEYLGEHAYGGHSIRRGPDRKGAQRNIIVFQLVP
                     VALLDEESNTLPEDEATDDPAPTSLEEARKRAIEAIHNSSDEMGKAALRKLYRRSKRV
                     KDYVLLRAEGICESCQQPAPFKRKDGSAYLEPHHTTRVSDGGLDHPRYVAAICPACHR
                     HIHHGIGGDEKNFELILAIAAKEPDACP"
     misc_feature    complement(24380..>24604)
                     /locus_tag="CNE_1c00210"
                     /note="Ferredoxin reductase (FNR), an FAD and NAD(P)
                     binding protein, was intially identified as a chloroplast
                     reductase activity, catalyzing the electron transfer from
                     reduced iron-sulfur protein ferredoxin to NADP+ as the
                     final step in the electron transport...; Region: FNR_like;
                     cl06868"
                     /db_xref="CDD:263080"
     misc_feature    complement(24251..24424)
                     /locus_tag="CNE_1c00210"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(24251..24253,24263..24265,24272..24277,
                     24287..24292,24323..24325,24329..24337,24341..24343))
                     /locus_tag="CNE_1c00210"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            25979..26308
                     /locus_tag="CNE_1c00220"
                     /db_xref="GeneID:10916413"
     CDS             25979..26308
                     /locus_tag="CNE_1c00220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683872.1"
                     /db_xref="GI:339324179"
                     /db_xref="GeneID:10916413"
                     /translation="MTSTTPAPQEPTLAQKQAQLAENLAKIDRAQARRHAKAAPPPPS
                     KAVTLEDHILEATDDILRVSAGLQSFLTLLELQSDTIPQGIGLHALLLPLKQQLVDTA
                     DRLQALV"
     misc_feature    25985..26305
                     /locus_tag="CNE_1c00220"
                     /note="Protein of unknown function (DUF1484); Region:
                     DUF1484; pfam07363"
                     /db_xref="CDD:148780"
     gene            complement(26411..29053)
                     /locus_tag="CNE_1c00230"
                     /db_xref="GeneID:10916414"
     CDS             complement(26411..29053)
                     /locus_tag="CNE_1c00230"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_004683873.1"
                     /db_xref="GI:339324180"
                     /db_xref="GeneID:10916414"
                     /translation="MPERSTTRYGKALQRLHQVFSPLNLAAAAWLIATWAFAAFQLVS
                     ERDRLLHDAAERTQAQAQAFGAYSRSSILRLSEFLLDLRASWLVGQPGFIDMVREREN
                     LVVDLSFQVSVIDKHGLLIYSSIAPPAPGQKVDLSGREHFRVHQNAGGRDMLFISDPV
                     KGKVSRKWSIQFTRPILRAGSFDGVIVVSVSPEQFASFAQSFTNRDGEVASVIKTSGQ
                     VLARVPAMEGTLARAVSNRPYLASGSPQSGSYRAVSGSEGVERVFGYYRLPEFGLNFV
                     VGESVGLVLAPYEVYRRVALAGAIASTLLLGLLYYSLRRSMGERQRHMEEMRLASLVY
                     SSSSEAMVVTSLDGTIIDVNPAFAAATGYTAKEVKGRPGYIVSGAGNVAGLVERLRAT
                     VAAKGRWSGEFSIRRKDGSEFPAYLTVDTYLAHAYGERRRVALIHDMTEKRQAEEVIR
                     HQANFDALTDLPNRRLFFDRLRQEIERSRGTQDVLALLFIDLDRFKEVNDTLGHDQGD
                     LLLLEAARRIAASVRASDTVARLAGDEFTVILSAVGDAGVAGGIAEAILERIAAPYHL
                     AGELVVVSASIGVATYPKDADNAEDLLVCADQAMFAAKEEGRNRWKVFTQALLHAERE
                     RLRITQDLRTALASGQFALHYQPIVNLRTGKVCKAEALIRWDHPARGPIHPADFIAVA
                     EESGLIIDIGRWVLTEALDQLARWQVLLGNGFQISVNKSPVEFSAPASGPESWSSMIE
                     RRNVPVGSLVIEITEGSLMEQNADVMDQLSRFQAAGIEIALDDFGTGYSSLSYLRRLD
                     IDYIKIDQSFVRSLTRGPDDVALCRAIISMAHALRIRVIAEGVETESQRDILVAAGCD
                     YGQGHYFCPPVEASAFEAYVSAVT"
     misc_feature    complement(27737..28045)
                     /locus_tag="CNE_1c00230"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(27731..28042)
                     /locus_tag="CNE_1c00230"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(27824..27826,27839..27841,27917..27928,
                     27965..27967,27983..27985,27995..27997))
                     /locus_tag="CNE_1c00230"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(27797..27799,27803..27805,27887..27892,
                     27899..27901,27923..27925,27935..27937))
                     /locus_tag="CNE_1c00230"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(27221..27694)
                     /locus_tag="CNE_1c00230"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(27452..27454,27581..27583))
                     /locus_tag="CNE_1c00230"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(27449..27460,27464..27466,27530..27532,
                     27542..27544,27554..27559,27566..27568))
                     /locus_tag="CNE_1c00230"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(27389..27391,27476..27478))
                     /locus_tag="CNE_1c00230"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(26441..27166)
                     /locus_tag="CNE_1c00230"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            29232..29597
                     /locus_tag="CNE_1c00240"
                     /db_xref="GeneID:10916415"
     CDS             29232..29597
                     /locus_tag="CNE_1c00240"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc finger SWIM domain containing protein"
                     /protein_id="YP_004683874.1"
                     /db_xref="GI:339324181"
                     /db_xref="GeneID:10916415"
                     /translation="MCHSGLIDAPQKGAKAFSPQTFRRRCRSQGAYGDSLMSLADVLR
                     QRLAGPHAAQVVELSELAIAGAEKSLEQIDDSGGGVMPAILALASVHLDACKQTGPDP
                     MKLAEQLFRLQAEGGWDTF"
     gene            complement(29883..30728)
                     /locus_tag="CNE_1c00250"
                     /db_xref="GeneID:10916416"
     CDS             complement(29883..30728)
                     /locus_tag="CNE_1c00250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683875.1"
                     /db_xref="GI:339324182"
                     /db_xref="GeneID:10916416"
                     /translation="MHRFASRRSPNDSMTAMQEMNTSARWRRIALALFGAVLLADAIA
                     LMTIGLFNFGIVLPGCIGASFLLLAWQWPLVAHWRAASHRRQQLWQAAWIAFALWLAT
                     VAVFFYNIHHNTEVAIPGNSPVKAIIILGSGTPNCVASPTLVARLDQGLKHAQQWPQA
                     KVAVSGGQDFGLRCREADIMAEYLIARGVAADRVIREGRSTSTEENLMFSRHLLEEQG
                     VAATDPIVVVTSDFHVQRAVRIARKAGFVEVAGAGAGTPLYLRYNAWLREYFAAISGW
                     VLREY"
     misc_feature    complement(30519..>30728)
                     /locus_tag="CNE_1c00250"
                     /note="ABC1 family; Region: ABC1; cl17513"
                     /db_xref="CDD:248067"
     misc_feature    complement(29916..30353)
                     /locus_tag="CNE_1c00250"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    complement(order(29925..29927,30021..30023,30030..30032,
                     30042..30044,30111..30113,30120..30122))
                     /locus_tag="CNE_1c00250"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            30866..31153
                     /locus_tag="CNE_1c00260"
                     /db_xref="GeneID:10916417"
     CDS             30866..31153
                     /locus_tag="CNE_1c00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683876.1"
                     /db_xref="GI:339324183"
                     /db_xref="GeneID:10916417"
                     /translation="MRGVGLETMMRHFIAIGVLFFTATSANACRPPYLEFSAVFEPGS
                     ATLSGAEVKRLADWRINSRRAFPAGYTVYMYLRQNEILGIPRQLAEARRVQ"
     gene            31982..33769
                     /locus_tag="CNE_1c00270"
                     /db_xref="GeneID:10916418"
     CDS             31982..33769
                     /locus_tag="CNE_1c00270"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA protein"
                     /protein_id="YP_004683877.1"
                     /db_xref="GI:339324184"
                     /db_xref="GeneID:10916418"
                     /translation="MHNENKTTVGASRRAIGKAARPAASGVWRWTSLAVACSMVTGCA
                     TAPGAYLKETFASDDPCSNNARNIGIAAGVIAGAVLGNVVSSNKKVGTLLGAGVGAAL
                     GGLIGADMDRRRCELSRIAKKHGLDVTVVDIAADGSALAPATRDREQGGLGMSVSVRD
                     AGTGGSSQFASGSSVLAPDARVAFTEIAQQYAYAAQARMLGPKSTTQERQAVEALKSR
                     RILLIGNTDDTGSSRLNAELSEQRARAVAALFRDAGVTESQLYYQGAGETMPLADNRD
                     ETGRAKNRRVEIVDVTDESAFAKYLAARRPNVAFYRESAADRTQSGRDSGEANGAAQK
                     KSATTARAGDRPKTQSPVRTASAASPRQGDARSDAVKVPAGDRPVTSASATASPAPAQ
                     KQGPVTQTRIVSAPSIDFGGTPSGRSVMVPDLGKLDRPTGFALISSAVADTPLARCDQ
                     DRPREARAVKSLSDDKAYRTADYMPGLYNTIWTDTVNGHLVALKGVAVLRDGGAPARS
                     PEVLVYRDYHDAGQVADLRTEAQVNTYRGDKGLLYRVFVNKAPLQCLDIVIPHATPDQ
                     ARGSWLRYDKDGNSYSAAFSPRMAGGGKI"
     misc_feature    32072..32845
                     /locus_tag="CNE_1c00270"
                     /note="proteobacterial sortase system OmpA family protein;
                     Region: pdsO; TIGR03789"
                     /db_xref="CDD:234354"
     misc_feature    32483..32848
                     /locus_tag="CNE_1c00270"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(32492..32497,32657..32662,32669..32671,32681..32686,
                     32693..32695,32819..32821,32831..32833)
                     /locus_tag="CNE_1c00270"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            33795..35300
                     /locus_tag="CNE_1c00280"
                     /db_xref="GeneID:10916419"
     CDS             33795..35300
                     /locus_tag="CNE_1c00280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683878.1"
                     /db_xref="GI:339324185"
                     /db_xref="GeneID:10916419"
                     /translation="MSHWINENLAALNSALALAVLLIVYLGNKFRIDFALMNLWYSLP
                     LIGKIARLSRDTTRFAKDKSWTLSERTLCDDYKQFIHFTTEDEFNKRLTYLSKAHDLG
                     RSPTPGWMMGLLCVLVLAEGLGFSYMLGTWMAGEGGSENARQLLMWAIVFVLCVIFVF
                     VMHSAGHQLYRSNLIAKADSEWRGEGQPGKFASHNIKLNDPQDKDDAEPEYKQSVNRV
                     GTSRSYFMVGVAVVIIVFVSIVSTVMRVKHLETERTAQTALVAEGPGAGNPFDKLGQA
                     LPAELAQEQQKADDQAKADGHAAYADEGLAAFLMLAFIFAITQLVGIAGGYKWGFAGK
                     ESKAAYRGTRGFSTYDDYLAFFTPLMQVAQSKLQTLQQKMSERRANDGLRLEHAFDDY
                     LMEARESRTRVAAARNVSQADIAPAVESLPATDTASVLARIDAMTAAGRKADAVALLQ
                     SLPDSVRNDVTAQLAERKAAQEAARLAAEQARKAEEEQDKEAERARLEALL"
     gene            35302..36198
                     /locus_tag="CNE_1c00290"
                     /db_xref="GeneID:10916420"
     CDS             35302..36198
                     /locus_tag="CNE_1c00290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683879.1"
                     /db_xref="GI:339324186"
                     /db_xref="GeneID:10916420"
                     /translation="MASTPAGRPVSDWRAAGFGKRCAAWLAVATTMLCGPAFAAPEIP
                     SCYVANQLGSPTAAQRALFLMIDQTTALDDKLVSELGRHLQGLLRPGTTFRVYSFSAY
                     AQGRYLQQRAAGTLEAPLVDQSLRDATAVKTLKNFDACLKSQYAYGTKLVAESVREAL
                     QGSSEALARSDVLASIAAVSQAVRDTAAQQKTVLIVSDMLENSSISSFYSQERMRQID
                     AVQELRKVEKANVRADFGGASVYVMGAGIVPEPKGARSAAASYRSPQSIEALRTFWDG
                     FFERSNARLVGFGAPALLTPIR"
     gene            complement(36314..37621)
                     /gene="ttuB1"
                     /locus_tag="CNE_1c00300"
                     /db_xref="GeneID:10916421"
     CDS             complement(36314..37621)
                     /gene="ttuB1"
                     /locus_tag="CNE_1c00300"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate transporter TtuB"
                     /protein_id="YP_004683880.1"
                     /db_xref="GI:339324187"
                     /db_xref="GeneID:10916421"
                     /translation="MQTVPASGAPPLAAPTDRPLTALLFRKLMPLLVLSYVISFLDRT
                     NIALAKTHIAVDLNISAAAYGLGAGLFFLSYALLEIPSNLIMHRVGARFWITRIMVTW
                     GLLSAAMSFVQGETSFYIMRVLLGAAEAGLFPGVMLYLTYWFGREDRARAVGYFLLGV
                     CIANIVSGPLGGALLGMDGLWGFKGWQWMFVLEGLPAVFLAAVVWKKLPDGPDSAPWL
                     TPAQALEVRSRLAAEAADASAGKGGHSFLGAMRDPQVWLAIFIYFCHQISIYTVIFFL
                     PGIIGTYGKLTPVEIGLLNSLPWIAAAIGAAWLPRHANTPRRGRRLLCLGLVVMAGGL
                     LIAAFAGPVMALVGFSLTALMFFVVQSIVFLFPSSRLKGVALAGGLALINTCGLVGGF
                     IGPSVMGIIEQATGSTRNGLVIMAGLLLIACAAAPFLRQGQER"
     misc_feature    complement(36359..37552)
                     /gene="ttuB1"
                     /locus_tag="CNE_1c00300"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(36332..37531)
                     /gene="ttuB1"
                     /locus_tag="CNE_1c00300"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(36449..36451,36458..36463,36470..36475,
                     36482..36487,36518..36520,36527..36532,36542..36544,
                     36551..36556,36563..36565,36704..36706,36716..36718,
                     36725..36727,36737..36739,36749..36751,36791..36793,
                     36800..36805,36812..36817,36824..36826,37130..37132,
                     37148..37153,37160..37165,37199..37201,37208..37213,
                     37220..37225,37232..37237,37373..37378,37382..37387,
                     37397..37399,37406..37411,37418..37420,37469..37474,
                     37478..37486,37493..37495))
                     /gene="ttuB1"
                     /locus_tag="CNE_1c00300"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(37745..38677)
                     /locus_tag="CNE_1c00310"
                     /db_xref="GeneID:10916422"
     CDS             complement(37745..38677)
                     /locus_tag="CNE_1c00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683881.1"
                     /db_xref="GI:339324188"
                     /db_xref="GeneID:10916422"
                     /translation="MAKRAKAIITCAPTGAIHTPSMSPHLPVTADEIATAAIDAARAG
                     AAILHLHARDPKDGRPSQDPELFRPFLARISAETDAVINITTGGSPHMTVEERMLPAT
                     TFKPELASLNMGSMNFGLFPMLDRFKEFQHHWEREHLENSRNLIFKNTYQDIENILRI
                     GNANGTRFEFECYDISHLYNLRHFLDRGLVSGPVFIQTVFGILGGIGPDPEDLMHMHR
                     TARRLFGDQFRWSILGAGRSQIPLATIGAAMGANVRVGLEDSLWIGPGQLAASSAEQV
                     TRIRTVLEALNIDVATPDEARDILDLKGAAGTAF"
     misc_feature    complement(37772..38662)
                     /locus_tag="CNE_1c00310"
                     /note="Prokaryotic protein of unknown function (DUF849);
                     Region: DUF849; pfam05853"
                     /db_xref="CDD:253423"
     gene            complement(38752..39534)
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /db_xref="GeneID:10916423"
     CDS             complement(38752..39534)
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /EC_number="1.1.1.53"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004683882.1"
                     /db_xref="GI:339324189"
                     /db_xref="GeneID:10916423"
                     /translation="MWKDESLAGKRVLVTAGADGIGLEITRAFVEAGARAAVCDVAGD
                     SLERVCAELPGVVAVRADVSKEADVEALFQAVDCAFGGLDVLVNNAGVAGPTGGVESL
                     SLADWERTLAVNITGQFLCARAAVPRLRQGRSPSIVNLSSAAGHLGMPGRSAYSASKW
                     AVVGFTKSLALELGVDGIRVNTVLPGAVDGPRIRAVIAAKAEALGKPLEEVTRDYTSQ
                     AALHRMVTMRDIANMVRFLCSDQAANVHGQEMVVDGLTQALS"
     misc_feature    complement(38758..39519)
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK12829"
                     /db_xref="CDD:183778"
     misc_feature    complement(38776..39501)
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(38962..38967,38971..38982,39058..39060,
                     39070..39072,39109..39117,39196..39198,39262..39270,
                     39346..39354,39409..39417,39472..39483,39487..39489))
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(39058..39060,39070..39072,39109..39111,
                     39193..39195))
                     /gene="fabG1"
                     /locus_tag="CNE_1c00320"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            39631..40413
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /db_xref="GeneID:10916424"
     CDS             39631..40413
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-typetranscriptional regulator McbR"
                     /protein_id="YP_004683883.1"
                     /db_xref="GI:339324190"
                     /db_xref="GeneID:10916424"
                     /translation="MLRGMTLNDLVTPLVRQTLSRDVYTQLRDLLISGQMMPGEQISL
                     RNIAAALNVSVMPVREAVHRLVAEQALELTPNRALRVPRMSVSQFEEITKIRIQLEGL
                     ATATAAERITDEELKQVQALHRRFADEMSKRSPDGADVIAANQAFHFAVYAAARMPIL
                     LQMIESQWLRIGPILNHDLRSGSRRVEERVAVKHHDNLIEALRRHDSAAACAALRGDI
                     ESAAAYIVSAGVLVNTDRTEDAAVTLVPVKRAAKAGRAGVKG"
     misc_feature    39664..40314
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    order(39682..39684,39688..39690,39760..39765,39787..39801,
                     39805..39810,39817..39819,39847..39852,39856..39867)
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    39685..39873
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    39901..40290
                     /gene="mcbR"
                     /locus_tag="CNE_1c00330"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            40428..40541
                     /locus_tag="CNE_1c00340"
                     /db_xref="GeneID:10916425"
     CDS             40428..40541
                     /locus_tag="CNE_1c00340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683884.1"
                     /db_xref="GI:339324191"
                     /db_xref="GeneID:10916425"
                     /translation="MKKVTAFNEWADIDADIKRAIRLTGMGGPVSFYVQGR"
     gene            complement(40642..40866)
                     /locus_tag="CNE_1c00350"
                     /db_xref="GeneID:10916426"
     CDS             complement(40642..40866)
                     /locus_tag="CNE_1c00350"
                     /codon_start=1
                     /transl_table=11
                     /product="lambda repressor-like DNA-binding domain
                     containing protein"
                     /protein_id="YP_004683885.1"
                     /db_xref="GI:339324192"
                     /db_xref="GeneID:10916426"
                     /translation="MLFAANMRRIRKDKGFTQEKVAEAADLHVNYISSVERGERNISI
                     CNIEKIAVALGVAMTALVDEAGPSKGYQSS"
     misc_feature    complement(<40675..40860)
                     /locus_tag="CNE_1c00350"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(40684..40857)
                     /locus_tag="CNE_1c00350"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40756..40758,40831..40833,40843..40845))
                     /locus_tag="CNE_1c00350"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40759..40761,40834..40836))
                     /locus_tag="CNE_1c00350"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40753..40758,40768..40770,40777..40779,
                     40810..40815))
                     /locus_tag="CNE_1c00350"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            41150..41500
                     /locus_tag="CNE_1c00360"
                     /db_xref="GeneID:10916427"
     CDS             41150..41500
                     /locus_tag="CNE_1c00360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683886.1"
                     /db_xref="GI:339324193"
                     /db_xref="GeneID:10916427"
                     /translation="MIQPLITAEQREQLLANGHAYATGKARDPLPVVRLFTPDAHATW
                     LLAALDPADGDTAYGLCDVGIGMPELGHVKLSDLASIVGPLKRPILRDRYFRPTRSLG
                     EYARLAQSSGSIVD"
     misc_feature    41162..41497
                     /locus_tag="CNE_1c00360"
                     /note="Protein of unknown function (DUF2958); Region:
                     DUF2958; pfam11171"
                     /db_xref="CDD:151613"
     gene            41671..43059
                     /gene="gabP"
                     /locus_tag="CNE_1c00370"
                     /db_xref="GeneID:10916428"
     CDS             41671..43059
                     /gene="gabP"
                     /locus_tag="CNE_1c00370"
                     /codon_start=1
                     /transl_table=11
                     /product="GABA permease GabP"
                     /protein_id="YP_004683887.1"
                     /db_xref="GI:339324194"
                     /db_xref="GeneID:10916428"
                     /translation="MNPSGKGLSHGLKARHVTMVSIAGVIGAGLFVGSGRAIAEAGPA
                     ALLAYAMSGLLVVLVMRMLGEMAVAQPDTGSFSTYADGAIGHWAGFTIGWLYWWFWVL
                     VIPIEATAAAAILSAWLPAVPQWTFALAITLALTGTNLFSVRNYGEFEFWFALIKVVA
                     IVAFIAVGGLAVLGLLPGAQVSGVARLVDYGGFMPNDAHAVIAVVLTTMFAFMGAEIV
                     TIAAAEAEHPARQIVRATRSVVWRISLFYLGSIFIVVALVPWNDPLLVTHGAYQRALE
                     ILGVPHAKAIVDVIVLTAVMSCLNSALYTASRMLFSLSTRGDAPSGLSRTAACGTPRA
                     AVLVSTAFAFVCVLANYLMPERVFAFLLATSGAVALLVYLVIAVSQLRMRAVLERRAA
                     ELPLRMWGYPWLTWSVIVVILGVLAAMVWHPAHRMEILATATLLAGVLAGAWLNSRNR
                     SADGQALAMDDL"
     misc_feature    41680..43020
                     /gene="gabP"
                     /locus_tag="CNE_1c00370"
                     /note="gamma-aminobutyrate permease; Region: GABAperm;
                     TIGR01773"
                     /db_xref="CDD:233567"
     gene            43227..44615
                     /gene="proP1"
                     /locus_tag="CNE_1c00380"
                     /db_xref="GeneID:10916429"
     CDS             43227..44615
                     /gene="proP1"
                     /locus_tag="CNE_1c00380"
                     /codon_start=1
                     /transl_table=11
                     /product="proline/betaine transporter ProP"
                     /protein_id="YP_004683888.1"
                     /db_xref="GI:339324195"
                     /db_xref="GeneID:10916429"
                     /translation="MQRDLNMNPQQEPHVNPLSVPGGVLPAPARTLAARDYKTLGLAA
                     LGGTLEFYDFVIYVFFVTVLGALFFPPNMPDWLRQLQAFGIFAAGYLARPLGGIVIAH
                     FGDRLGRKRMFTLSILLMAAPTLMIGLLPTYASIGVAAPLLLLAMRVLQGAAIGGEMP
                     GAWVFVGEHVPSRHYGLGIGTLTSGITGGILLGSLVAVAINRHYTPEQVSDFAWRIPF
                     LLGGVFGLVSVYLRRFLHETPVFRELADRSNLARELPIRTVLREHRSASLFVALLTWV
                     LSTSIVVVVLYTPAYLQKIHHIPAALALETNAFATLTLTIGCVIVGWACDRIGTRAVM
                     LIGWGGLLMTAYLFYGSLPGTPGTLFWHYGLLGLFVGTIATVPIAGVRAFPAPVRFTG
                     LSFAYNMSYAVFGGLTPMILTLWLQHDTMAPAHYVAVLAAVGSLLAFWPLARRGHAMR
                     NGVASTAGHVSR"
     misc_feature    43344..44555
                     /gene="proP1"
                     /locus_tag="CNE_1c00380"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    43362..44528
                     /gene="proP1"
                     /locus_tag="CNE_1c00380"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    order(43386..43388,43395..43403,43407..43412,43482..43484,
                     43491..43496,43503..43505,43515..43520,43524..43529,
                     43689..43694,43701..43706,43713..43718,43725..43727,
                     43761..43766,43773..43778,43794..43796,44058..44060,
                     44067..44072,44079..44084,44091..44093,44133..44135,
                     44145..44147,44157..44159,44166..44168,44178..44180,
                     44325..44327,44334..44339,44346..44348,44358..44363,
                     44370..44372,44403..44408,44415..44420,44427..44432,
                     44439..44441)
                     /gene="proP1"
                     /locus_tag="CNE_1c00380"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            44631..45323
                     /locus_tag="CNE_1c00390"
                     /db_xref="GeneID:10916430"
     CDS             44631..45323
                     /locus_tag="CNE_1c00390"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_004683889.1"
                     /db_xref="GI:339324196"
                     /db_xref="GeneID:10916430"
                     /translation="MNTTENTPPVRLLTPAELAVCIKVFRDARQWTQEQLAVIAGLNV
                     RTVQRVEQGWPADADTCRALASAFDFLDIDALNKPFAIPPEDELKAAQEQFDLEHVTF
                     AAIPLTTGKQLAELAQTSTMDMSELAFEMGGEADKRFAALMEYFRNYRDALDAYTEAE
                     KREAADTMQANIDVLKTLGVSLCYAERQVLLKGSSDPDRPMPANVLYVIGFPLGKEPK
                     LFATPTSVDIRL"
     misc_feature    44694..45011
                     /locus_tag="CNE_1c00390"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    44694..44858
                     /locus_tag="CNE_1c00390"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(44697..44699,44709..44711,44784..44786)
                     /locus_tag="CNE_1c00390"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(44706..44708,44781..44783)
                     /locus_tag="CNE_1c00390"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(44727..44732,44763..44765,44772..44774,44784..44789)
                     /locus_tag="CNE_1c00390"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(45325..45540)
                     /gene="hss"
                     /locus_tag="CNE_1c00400"
                     /db_xref="GeneID:10916431"
     CDS             complement(45325..45540)
                     /gene="hss"
                     /locus_tag="CNE_1c00400"
                     /EC_number="2.5.1.44"
                     /codon_start=1
                     /transl_table=11
                     /product="homospermidine synthase Hss"
                     /protein_id="YP_004683890.1"
                     /db_xref="GI:339324197"
                     /db_xref="GeneID:10916431"
                     /translation="MIEQIVIVGLGCIGQAVLPLLERTWPRPAIAVVDRMLDGGRWKL
                     AARHKLDAIESTITVDKTPGFMQQRPL"
     misc_feature    complement(<45439..45528)
                     /gene="hss"
                     /locus_tag="CNE_1c00400"
                     /note="Homospermidine synthase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG5310"
                     /db_xref="CDD:227626"
     gene            complement(45726..46670)
                     /gene="speB"
                     /locus_tag="CNE_1c00410"
                     /db_xref="GeneID:10916432"
     CDS             complement(45726..46670)
                     /gene="speB"
                     /locus_tag="CNE_1c00410"
                     /EC_number="3.5.3.11"
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase SpeB"
                     /protein_id="YP_004683891.1"
                     /db_xref="GI:339324198"
                     /db_xref="GeneID:10916432"
                     /translation="MAGTQNLWQGRVDDGERGDTTRLFRIVQTLETADVTRLGGATVL
                     LGFRCDAGVLRNQGRPGAAHGPDAIRQALANVPAHGLPALYDAGNVSCDDGDLESAQL
                     ALAGTVRDVLARGGLPLVLGGGHEVAWGTWQGLRAHLDVQDDGGRVLIINIDAHFDLR
                     TSRPASSGTPFDQIANACAERGQPFDYVCLGVSRLSNTPALFGRADALGVCYVEDVDM
                     QERHLASRLAELAARIDATDHVYLTIDLDALPAAVMPGVSAPAAYGVPLPVVEEVAML
                     ARRSGKLRVADLAEYNPQYDRDHQGARVAARLAWRLLG"
     misc_feature    complement(45735..46544)
                     /gene="speB"
                     /locus_tag="CNE_1c00410"
                     /note="Formimidoylglutamase or HutE; Region:
                     Formimidoylglutamase; cd09988"
                     /db_xref="CDD:212514"
     misc_feature    complement(order(45801..45803,45930..45932,45936..45938,
                     46167..46172,46197..46205,46209..46211,46296..46298))
                     /gene="speB"
                     /locus_tag="CNE_1c00410"
                     /note="putative active site [active]"
                     /db_xref="CDD:212514"
     misc_feature    complement(order(45930..45932,45936..45938,46197..46199,
                     46203..46205,46209..46211,46296..46298))
                     /gene="speB"
                     /locus_tag="CNE_1c00410"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:212514"
     gene            complement(46673..47434)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /db_xref="GeneID:10916433"
     CDS             complement(46673..47434)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /EC_number="3.6.3.21"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004683892.1"
                     /db_xref="GI:339324199"
                     /db_xref="GeneID:10916433"
                     /translation="MSDSAIIRIRNLGKSFGGHTVLRGIDFDVEPSQVVVVIGPSGSG
                     KSTFLRCCNGLEQPEAGTIDIVGKRLVTDGQLIGEHELNQLRTEVGMVFQSFNLFPHL
                     SVLHNVTVGPRMLRGASREEAERKAMGLLEKVGLAHKAHAMPASLSGGQKQRVAIARA
                     LAMEPRVMLFDEPTSALDPELVGEVLQVMKVLAAEGMTMVVVTHEMGFAREVADVVVV
                     MDGGGIIEAGPPSVIFSAPTQERTRGFLQAVLTRA"
     misc_feature    complement(46685..47422)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(46763..47416)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(47297..47320)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(46823..46825,46919..46924,47153..47155,
                     47294..47302,47306..47311))
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(47153..47164)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(46967..46996)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(46919..46936)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(46901..46912)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(46817..46837)
                     /gene="hisP"
                     /locus_tag="CNE_1c00420"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(47431..48099)
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /db_xref="GeneID:10916434"
     CDS             complement(47431..48099)
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004683893.1"
                     /db_xref="GI:339324200"
                     /db_xref="GeneID:10916434"
                     /translation="MELDFSPVFAGWHDILHGAVITVEVTACALVLGCVMGLLVGIGR
                     LDPNRRVIYSICTAYVTFIRGTPLLVQLFLLFFGLPQFNILLPAFVCGVIGLGIYSGA
                     YVSEIVRGAIQSVDKGQMEAARSIGMSSGQAMRAVILPQAIVRMIPPLGNEFIALIKN
                     SALVSLLTIADLMHEGQKIISVSYRSLEVYLAIALVYLILTSAAGLILRRAEQRLRMG
                     GMVQ"
     misc_feature    complement(47443..48099)
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(47482..48045)
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(47482..47487,47494..47499,47506..47511,
                     47515..47520,47527..47532,47560..47565,47602..47607,
                     47614..47625,47644..47646,47653..47658,47698..47700,
                     47749..47751,47758..47763,47773..47775,47779..47784,
                     47791..47793,47797..47799,47803..47808,47881..47883,
                     47887..47892,47899..47901,47902..47919,47923..47934,
                     47965..47967,47980..47985,47992..47997))
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(47608..47625,47881..47901,47902..47916))
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(47530..47532,47560..47562,47569..47571,
                     47605..47607,47821..47823,47881..47883))
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(47677..47679,47689..47694,47710..47748))
                     /gene="hisM"
                     /locus_tag="CNE_1c00430"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(48118..48873)
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /db_xref="GeneID:10916435"
     CDS             complement(48118..48873)
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004683894.1"
                     /db_xref="GI:339324201"
                     /db_xref="GeneID:10916435"
                     /translation="MNLRRKCLMAGLATLTALTLGTAAHAQDNAVLRVATDATFPPME
                     FIENGKRTGFDVELVEAMAKTMGKRVEWTDIDFKGLIPGLVSRRFDMAVSGIYITPER
                     SKVVDFTEPYYTGGLVALVKSGNTTVHAPADLNGKKVSVQVGTKSVSFLRDTYPQVQR
                     VEVEKNQEMFNLVEIGRADAAVTGKPAAMQYVKTRGGLRMVEQPLTTEEYGMAVRKDT
                     PELTRALNAALAKVKADGTYAKLTQKWFGTAAK"
     misc_feature    complement(48136..48780)
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(48136..48780)
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(48322..48324,48436..48438,48568..48570,
                     48643..48645,48754..48756))
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(48343..48345,48361..48363,48373..48375))
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(48241..48249,48250..48252))
                     /gene="hisJ"
                     /locus_tag="CNE_1c00440"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(48954..49748)
                     /locus_tag="CNE_1c00450"
                     /db_xref="GeneID:10916436"
     CDS             complement(48954..49748)
                     /locus_tag="CNE_1c00450"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004683895.1"
                     /db_xref="GI:339324202"
                     /db_xref="GeneID:10916436"
                     /translation="MLNAVDNPTAVKPATPTPAKPGQPAGGADRVLFVLAALAQHGAP
                     ITVRELVAKTSLPKSTLYRQLMMLKRWGFVLESDGEYAPGPISLQLALGFDMASHLAR
                     EALPDMQLLAQQSDESVGLVVAVKDHAVCLEMVESRQSLRCSFEKGRGVPLRAGASAK
                     SLLAFMRDEARERLVRAQCEPGEAERLLAELTAIRETGYAVSEGEVDPGVWGVSAPLF
                     SRRSKADALGSITLMVPATRRQGRETALIDMTVAAAMRISARLQSY"
     misc_feature    complement(48963..49673)
                     /locus_tag="CNE_1c00450"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(49413..49664)
                     /locus_tag="CNE_1c00450"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(48957..49307)
                     /locus_tag="CNE_1c00450"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(49883..50542)
                     /locus_tag="CNE_1c00460"
                     /db_xref="GeneID:10916437"
     CDS             complement(49883..50542)
                     /locus_tag="CNE_1c00460"
                     /EC_number="2.1.1.100"
                     /note="ICMTase"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase"
                     /protein_id="YP_004683896.1"
                     /db_xref="GI:339324203"
                     /db_xref="GeneID:10916437"
                     /translation="MRPTPGMAIATLAGTLAYLAIAIAGWGGIAPFFAHPARVALTLV
                     LFALSVAALFSGGNISSGMREDRGNRWVLAVFGVLGLLAAYLPPFTDRIGFWTLDGDT
                     MRWIGVALFAGGGVLRLWPVFVLGRRFSGLVAIQPGHTLVTTGIYSVIRHPSYLGFLV
                     SSLGWVLAFRSGVGVLLTLLMVPVLLARIRAEEALLRDQFGDEYASYCDRTWRMLPGI
                     Y"
     misc_feature    complement(49886..50458)
                     /locus_tag="CNE_1c00460"
                     /note="Putative protein-S-isoprenylcysteine
                     methyltransferase [Posttranslational modification, protein
                     turnover, chaperones]; Region: STE14; COG2020"
                     /db_xref="CDD:224931"
     gene            50688..51011
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /db_xref="GeneID:10916438"
     CDS             50688..51011
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide pyrophosphatase MazG"
                     /protein_id="YP_004683897.1"
                     /db_xref="GI:339324204"
                     /db_xref="GeneID:10916438"
                     /translation="MPLIDIKNLQQAAQDFGKARNWGKYHSPKNLAMALSVEVSELVE
                     IFQWQTDAESRAIMSTDERDHVEQELADITIYLAQLVTALGVDLDAAIRAKMEMNARK
                     YPLPE"
     misc_feature    50715..50984
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in mouse RS21-C6 protein
                     and its homologs; Region: NTP-PPase_RS21-C6_like; cd11537"
                     /db_xref="CDD:212144"
     misc_feature    order(50721..50726,50733..50735,50742..50747,50751..50753,
                     50769..50774,50781..50786,50790..50795,50802..50804,
                     50811..50816,50823..50828,50883..50891,50895..50903,
                     50907..50912,50916..50918,50925..50930,50934..50939,
                     50943..50945,50949..50954,50958..50966,50970..50975,
                     50979..50984)
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212144"
     misc_feature    order(50724..50726,50799..50801,50808..50810,50892..50894,
                     50901..50903,50913..50915)
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212144"
     misc_feature    order(50760..50762,50772..50777,50781..50789,50793..50798,
                     50805..50810,50814..50816,50823..50828,50913..50915)
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212144"
     misc_feature    order(50799..50801,50808..50810,50892..50894,50901..50903)
                     /gene="mazG"
                     /locus_tag="CNE_1c00470"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212144"
     gene            complement(51034..51891)
                     /locus_tag="CNE_1c00480"
                     /db_xref="GeneID:10916439"
     CDS             complement(51034..51891)
                     /locus_tag="CNE_1c00480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683898.1"
                     /db_xref="GI:339324205"
                     /db_xref="GeneID:10916439"
                     /translation="MTRLSGRLAACIAFGLLLAASAQASDIACKTTLRPSRCNDPLAA
                     GTSCLQSVPHAADLICDHAMLQREHERIHADQQRLLRAGAIHGRDIAAWRERRDACTS
                     VTCLDRVFASWRRHPGKKPPPQAAAPQPTPPAARAREVSRNKQAAVTVDASRPAVAPP
                     QATQSAAEQLPAPPSAEPLAEPGIQAPPVLIQRASGPTPQQASIRPTLAPQPRGWTSL
                     GTLAWLGMCSAGVACWSRRTRGEWLPGVTRLRERTRDAPPIVLVVSGLLALNGVLLLC
                     VLAGSRPLS"
     misc_feature    complement(<51223..>51447)
                     /locus_tag="CNE_1c00480"
                     /note="Chromatin assembly factor complex 1 subunit p60,
                     C-terminal; Region: CAF-1_p60_C; pfam15512"
                     /db_xref="CDD:259643"
     gene            complement(52117..52620)
                     /locus_tag="CNE_1c00490"
                     /db_xref="GeneID:10916440"
     CDS             complement(52117..52620)
                     /locus_tag="CNE_1c00490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683899.1"
                     /db_xref="GI:339324206"
                     /db_xref="GeneID:10916440"
                     /translation="MPDTAMALLFNAIVIGTGATLVMDAWVILRKRLLGVPALDYGLV
                     GRWLAWLPRGRLCHHPIAASPPVHRERGIGWIAHYLTGIVFAAILLGLWGLDWARHPT
                     LAPALIVGIGSVAAPFLLMQPAMGAGIAASRTPRPNVARAHSLVTHAVFGLGLYAAGW
                     VVSLVAT"
     misc_feature    complement(52135..52584)
                     /locus_tag="CNE_1c00490"
                     /note="Protein of unknown function (DUF2938); Region:
                     DUF2938; pfam11158"
                     /db_xref="CDD:256325"
     gene            complement(52613..53503)
                     /gene="phcB1"
                     /locus_tag="CNE_1c00500"
                     /db_xref="GeneID:10916441"
     CDS             complement(52613..53503)
                     /gene="phcB1"
                     /locus_tag="CNE_1c00500"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine (SAM)-dependent
                     methyltransferase PhcB"
                     /protein_id="YP_004683900.1"
                     /db_xref="GI:339324207"
                     /db_xref="GeneID:10916441"
                     /translation="MGEQQQTSSNGGDQPALWNGPSGHAWVAEQAVLDDMFRPLEGLL
                     VDAVGKTSAQHVLDVGCGTGSTTIALARKLGTQGRCTGIDISEPMLAAARARAQHDGS
                     TASFIRADAQDYAFAPASFDSIVSRLGVMFFSDPVRAFANLRQAATPDATLHCIAWRS
                     AAENPFMTTAERAAAPLLSNLPPRQPGAPGQFAFGDRQRVQAILEEGGWTGIDVQPVD
                     LACTLPEPALVDYLSRLGPVGLALREADASTRASVIETVRAAFETYVHGATVRYTAAC
                     WMITARASASSQRAGETAHA"
     misc_feature    complement(<53009..53356)
                     /gene="phcB1"
                     /locus_tag="CNE_1c00500"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    complement(53027..53338)
                     /gene="phcB1"
                     /locus_tag="CNE_1c00500"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(53123..53125,53171..53179,53249..53254,
                     53309..53329))
                     /gene="phcB1"
                     /locus_tag="CNE_1c00500"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            53578..54012
                     /locus_tag="CNE_1c00510"
                     /db_xref="GeneID:10916442"
     CDS             53578..54012
                     /locus_tag="CNE_1c00510"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxR family transcriptional regulator"
                     /protein_id="YP_004683901.1"
                     /db_xref="GI:339324208"
                     /db_xref="GeneID:10916442"
                     /translation="MTSLDIAEVARQAGVPASTLRYYEEKGLIASIGRRGMRRVFDAG
                     VLERLALIALGRAAGFSLDDIAQMFSPQGQPKIDRQVLAAKADELDRTIRKLTAMRDG
                     LRHASVCPAPSHMECPTFQRILRAAASGAIGGRKHAHGLPTD"
     misc_feature    53587..53946
                     /locus_tag="CNE_1c00510"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg6; cd04781"
                     /db_xref="CDD:133408"
     misc_feature    53587..53931
                     /locus_tag="CNE_1c00510"
                     /note="Cu(I)-responsive transcriptional regulator; Region:
                     CueR; TIGR02044"
                     /db_xref="CDD:131099"
     misc_feature    order(53590..53598,53638..53640,53686..53694)
                     /locus_tag="CNE_1c00510"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133408"
     misc_feature    order(53728..53730,53737..53739,53749..53754,53779..53781,
                     53821..53823,53833..53835,53851..53853,53863..53865,
                     53872..53877)
                     /locus_tag="CNE_1c00510"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133408"
     misc_feature    order(53902..53904,53926..53928)
                     /locus_tag="CNE_1c00510"
                     /note="putative metal binding residues [ion binding];
                     other site"
                     /db_xref="CDD:133408"
     gene            complement(54110..54499)
                     /gene="tar"
                     /locus_tag="CNE_1c00520"
                     /db_xref="GeneID:10916443"
     CDS             complement(54110..54499)
                     /gene="tar"
                     /locus_tag="CNE_1c00520"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein Tar"
                     /protein_id="YP_004683902.1"
                     /db_xref="GI:339324209"
                     /db_xref="GeneID:10916443"
                     /translation="MRGHHRQPVCQLEVRALAQRSAQAATEIKTLIESTVGSVSSGSG
                     QVRRAGDTMSEIVSNVSRVTGIISEITHAAMEQTRGIQEVNMAVSQLDQMVQQNAALV
                     EQSTAAAAALQTQAGSLAGAVGQFRLG"
     misc_feature    complement(54185..>54463)
                     /gene="tar"
                     /locus_tag="CNE_1c00520"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(54185..54190,54197..54199,54206..54211,
                     54218..54220,54227..54232,54236..54241,54248..54253,
                     54257..54262,54269..54271,54278..54283,54290..54292,
                     54299..54304,54311..54316,54320..54325,54332..54334,
                     54341..54346,54353..54355,54362..54367,54404..54409,
                     54416..54421,54425..54430,54437..54442,54449..54451,
                     54458..54463))
                     /gene="tar"
                     /locus_tag="CNE_1c00520"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     gene            55009..56217
                     /locus_tag="CNE_1c00530"
                     /db_xref="GeneID:10916444"
     CDS             55009..56217
                     /locus_tag="CNE_1c00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683903.1"
                     /db_xref="GI:339324210"
                     /db_xref="GeneID:10916444"
                     /translation="MSVLSLTSAPLRVLALSGALALAACGGGGGGGDDGGGQGTLKVS
                     MTDAPACGFNNVFVTVNKVRVHSSASAEASAGGWVDIDVVPARKIDLLSLTNGVLTVL
                     GQTALPAGNYQQVRLVLDANRGGGAGALANSVVPVGGTEQALDTPSAVQSGIKINRPF
                     TVAKGTLTDLVLDFDACKSVVTRGNGTFGLKPVVTAIPTIVSGEVNGVVSGAPGARVY
                     AERNGVVVKATVADANGNFKLSPIEQSSTAGPVDVVVVPGSANGKAAGIVRGVPVVVG
                     TPTAISTAAAPMSLPASTYRRASGTVTPASAEATLRALQLVSGGNFEIAATAAASDTG
                     AYSMFATEPALPVAAPVIGTYQAALPIPLQADGAAAGKYSVQATSATGTVQTKPTDVN
                     VADAVVNFSF"
     misc_feature    55126..55584
                     /locus_tag="CNE_1c00530"
                     /note="Domain of unknown function (DUF4382); Region:
                     DUF4382; pfam14321"
                     /db_xref="CDD:258495"
     gene            56359..57264
                     /locus_tag="CNE_1c00540"
                     /db_xref="GeneID:10916445"
     CDS             56359..57264
                     /locus_tag="CNE_1c00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683904.1"
                     /db_xref="GI:339324211"
                     /db_xref="GeneID:10916445"
                     /translation="MAARTAAKAASKPAATSEATSRARSRKAATSAEPVRVGIGGWNF
                     APWRDNFYPAGLAQARELAYASRHLSAIEINSTYHGTQKRTSFAKWRDETPDDFVFAV
                     KASRFATNRRVLAESGESIERFIDSGIAELGRKLGPVVWQFAPTKQFDAEDFEAFLQL
                     LPDSVEGVKLRHVLEVRHDSFQAPDYLKLARKYKAATVFTDSPKFPSMADLTADFVYA
                     RLMASSEKLKAGYAPRDLDAWAERVCTWAQGHQPADLPTVEDRKPAARKREVFVFFIN
                     GAKERAPAAAQALLERLDWTPPADD"
     misc_feature    56509..57237
                     /locus_tag="CNE_1c00540"
                     /note="Protein of unknown function DUF72; Region: DUF72;
                     pfam01904"
                     /db_xref="CDD:250955"
     gene            57298..58707
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /db_xref="GeneID:10916446"
     CDS             57298..58707
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /EC_number="3.6.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-independent RNA helicase DbpA"
                     /protein_id="YP_004683905.1"
                     /db_xref="GI:339324212"
                     /db_xref="GeneID:10916446"
                     /translation="MNSTPAQPQAGTAFSTLPLSPTMLATLAQLGYDEMTPIQAASLP
                     ITLAGQDLVAQAKTGSGKTAAFGLALLHRLDPRRFDVQAMVLCPTRELADQVTQEIRR
                     LARAEENIKVLTLCGGSPMRPQVDSLIHGAHIVVGTPGRILDHIDRGSLDLSGINTLV
                     LDEADRMLDMGFFDDIAYVASRCPKDRQTLLFSATYPPGIDKLSHRFLRNPQSVKLEA
                     THDNSTIRQRFYEVEEGERLNAVGRLLDHFRPVSTLAFCNTKARCRELVELLRAQGYQ
                     ALALHGELEQRERDQVLVQFANRSCSVLVATDVAARGLDIAQLEAVINVEITPDPEVH
                     VHRIGRTGRADQEGWAFSLVSMDEMGRVGNLEQHHGGEFEWHPLADLRPASNERLLPP
                     MVTLQMLGGRKEKIRPGDILGALTGDAGFTKEQIGKINVLEMSTYIAVERSIGREAVK
                     RLNAGKVKGKKVKVRMLTE"
     misc_feature    57331..58659
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="ATP-dependent RNA helicase DbpA; Provisional;
                     Region: PRK11776"
                     /db_xref="CDD:236977"
     misc_feature    57337..57942
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    57472..57486
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    57781..57792
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    57874..57882
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    57970..58356
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(58069..58080,58138..58143,58216..58224)
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(58240..58242,58303..58305,58315..58317,58324..58326)
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    58480..58659
                     /gene="dbpA"
                     /locus_tag="CNE_1c00550"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:266524"
     gene            complement(58740..59855)
                     /locus_tag="CNE_1c00560"
                     /db_xref="GeneID:10916447"
     CDS             complement(58740..59855)
                     /locus_tag="CNE_1c00560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683906.1"
                     /db_xref="GI:339324213"
                     /db_xref="GeneID:10916447"
                     /translation="MAATEPTLAITRLFSRKDALNESRLEAAQEPASAAPGEVLLRLD
                     RFALTTNNITYAAFGEAMQYWDFFPTGQPQWGHMPVWGFADVVASGVDGIAAGERFYG
                     YFPIASHIRMQPERVTARGFYDAAEHRAKLTSAYNQYTRVQNDAAYAPELEHYQMLYR
                     PLFITSFMLADFLQDNHFFGAQRLVVSSASSKTAYGTAFCLRDFDGITLTGLTSARNR
                     AFVEDLGCYDSTVTYDELASVPVDEPTLYVDFSGDESLRARVHAHFGDSLVYDCFAGS
                     AQNTGFLRDLHLPGPRPEFYFAPVQIRKRNADWGPQEVNRRFNAAQRRFIDQARDPAN
                     RWLALVEERGFEAAQARIARLAAGSGAPQEGYVVVVG"
     misc_feature    complement(58770..59720)
                     /locus_tag="CNE_1c00560"
                     /note="Protein of unknown function (DUF2855); Region:
                     DUF2855; pfam11017"
                     /db_xref="CDD:256250"
     gene            59921..60634
                     /locus_tag="CNE_1c00570"
                     /db_xref="GeneID:10916448"
     CDS             59921..60634
                     /locus_tag="CNE_1c00570"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004683907.1"
                     /db_xref="GI:339324214"
                     /db_xref="GeneID:10916448"
                     /translation="MPRIYRRANAAGFGNEAPAAGDLKRPATPRSKPLKRPSQQRAHF
                     TVNAIYDAFVRIWRRDGWDGVTTRAVALEAGFSVGALYEYFPSKEALASGYVRHMVET
                     MLARIDTEVTQRKNADWRTRVRRLVAIACGADDEATGIVFDADIIGLEPRIAEPKHHR
                     RVFEEFCEAWRRALCACPDLPTAPDAAKVQALVLAVWGARRYRLLLQGAALQPAQWVA
                     EMQALCLAALDEKATDAQP"
     misc_feature    60023..60580
                     /locus_tag="CNE_1c00570"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    60065..60196
                     /locus_tag="CNE_1c00570"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            60789..61229
                     /gene="guaB1"
                     /locus_tag="CNE_1c00580"
                     /db_xref="GeneID:10916449"
     CDS             60789..61229
                     /gene="guaB1"
                     /locus_tag="CNE_1c00580"
                     /EC_number="1.1.1.205"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="YP_004683908.1"
                     /db_xref="GI:339324215"
                     /db_xref="GeneID:10916449"
                     /translation="MKTARQVLESKPSQAIYSVPPTATVYAALQLMAEKGIGALLVIE
                     HGAIQGIVSERDYARKVILMQRTSRETLVRDIMTNAVIYVGASQTTDECMALMTRHRL
                     RHLPVMEGEELIGMLSIGDLVKDIISEQQFIIEQLEHYITGGGR"
     misc_feature    60828..61160
                     /gene="guaB1"
                     /locus_tag="CNE_1c00580"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair_10; cd04623"
                     /db_xref="CDD:239995"
     misc_feature    60834..61157
                     /gene="guaB1"
                     /locus_tag="CNE_1c00580"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     gene            complement(61280..62320)
                     /locus_tag="CNE_1c00590"
                     /db_xref="GeneID:10916450"
     CDS             complement(61280..62320)
                     /locus_tag="CNE_1c00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683909.1"
                     /db_xref="GI:339324216"
                     /db_xref="GeneID:10916450"
                     /translation="MTETPRQATGQAPDAAGPELGQWHPVLAIEQARGDGPFPARLFG
                     RALVLWRNADGWHAWDDRCPHRGAAFTLGAVRDGLLHCGYHGWRFASGGRCTRYPAHP
                     ELVPAPRACATTHAVREGYGLLWVRLGGDGTEAVPELPPFPEYDDAECRHVVCGPYDV
                     ATSAPRLVENFLDMAHFGYVHDGYLGDPAHTEVPPYEVEAIGDARKPDALRTIGCRAW
                     QPRAHASAAGGAMVEYEYRVVAPYAAILTKVPDLGDNHRGAIALFIGPRDEESSRVWF
                     VMSLVTEDDDASLREFQDTIFLQDKQIVESQQPRRLPLRTGVEVPQPADKLAGAYRRY
                     LAAHGVKFGTLG"
     misc_feature    complement(61292..62263)
                     /locus_tag="CNE_1c00590"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    complement(61913..62257)
                     /locus_tag="CNE_1c00590"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(order(62054..62056,62060..62062,62066..62071,
                     62075..62077,62123..62128,62132..62134))
                     /locus_tag="CNE_1c00590"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    complement(order(62060..62062,62066..62068,62075..62077,
                     62123..62128,62132..62134))
                     /locus_tag="CNE_1c00590"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     misc_feature    complement(61322..61855)
                     /locus_tag="CNE_1c00590"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(61409..61411,61418..61426,61433..61438,
                     61454..61465,61487..61489,61493..61495,61499..61501,
                     61505..61507,61523..61525,61529..61531,61535..61540,
                     61589..61591,61595..61597,61601..61603,61607..61609,
                     61613..61615,61670..61672,61676..61678,61682..61684,
                     61688..61690,61730..61732,61805..61810,61814..61822,
                     61841..61843,61847..61849,61853..61855))
                     /locus_tag="CNE_1c00590"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            63187..64134
                     /locus_tag="CNE_1c00600"
                     /db_xref="GeneID:10916451"
     CDS             63187..64134
                     /locus_tag="CNE_1c00600"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS DHA2 family"
                     /protein_id="YP_004683910.1"
                     /db_xref="GI:339324217"
                     /db_xref="GeneID:10916451"
                     /translation="MAGVRAWTGPGALLLAVAIVAFLLAMSWGGDVYDWLSPELGALL
                     LAAVAAVVLLTWQERRAADPMLPPRLFANRAYVMGVAASALAALDIFLCIFALPLHFQ
                     LVRGADASTSGLLVMPFLLATVAGNFIVAWLAPRVGRMRGILTGGYIAAALGLIVLAL
                     VTPAMPLAVVLAAMTLAGVGLGMTMVSTLISVQNVLERRDTGAGTGALLVLRSLGSAI
                     GGALAGTLLTLEFRHALAASGVTQALDLGALRHGSEAFAQLSPSVRAVLAGGVESGFH
                     LIFAAGAAAAVLALLIVRRMPDLELRGSVTEHAATLAMD"
     misc_feature    <63379..63870
                     /locus_tag="CNE_1c00600"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     gene            64215..64859
                     /gene="gpwA"
                     /locus_tag="CNE_1c00610"
                     /db_xref="GeneID:10916452"
     CDS             64215..64859
                     /gene="gpwA"
                     /locus_tag="CNE_1c00610"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="YP_004683911.1"
                     /db_xref="GI:339324218"
                     /db_xref="GeneID:10916452"
                     /translation="MTRRFPSSATLRQLRPAALAGALALAAAGAALLPHPARAADKPA
                     AAPAPQATGACPASLNFKFPRLQDEAPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEA
                     LYSKYRDRGLVVLGFPSNDFSQEPGSEKQIADFCYNTYGVKFPMLGKSHVRGSEANPM
                     YALLAKETGTAPKWNFYKYLIGRNGQVVGSYNSKTTPDDKKFVAKIEELLASPR"
     misc_feature    64389..64811
                     /gene="gpwA"
                     /locus_tag="CNE_1c00610"
                     /note="Glutathione (GSH) peroxidase family; tetrameric
                     selenoenzymes that catalyze the reduction of a variety of
                     hydroperoxides including lipid peroxidases, using GSH as a
                     specific electron donor substrate. GSH peroxidase contains
                     one selenocysteine residue per...; Region: GSH_Peroxidase;
                     cd00340"
                     /db_xref="CDD:238207"
     misc_feature    order(64485..64487,64584..64586,64734..64736)
                     /gene="gpwA"
                     /locus_tag="CNE_1c00610"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238207"
     misc_feature    order(64581..64583,64590..64592,64596..64598,64605..64607,
                     64614..64616,64626..64628)
                     /gene="gpwA"
                     /locus_tag="CNE_1c00610"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238207"
     gene            65005..65790
                     /locus_tag="CNE_1c00620"
                     /db_xref="GeneID:10916453"
     CDS             65005..65790
                     /locus_tag="CNE_1c00620"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase-like protein"
                     /protein_id="YP_004683912.1"
                     /db_xref="GI:339324219"
                     /db_xref="GeneID:10916453"
                     /translation="MGITLYDADGHTCLMFTDLVEEAHGEAVQTNQFLVVDHGHGALI
                     DPGGQMTYSELYLTISRYFPPKQLDYVLASHADPDIVASVGRWLTGSDCRILISSVWA
                     RFLPHFCQAGKTAGRIVTIPDAGMHIPLGHSSLVAVPAHFLHSEGNFQFYDPISKILF
                     SGDLGAAMTGAKAAGTTVTDFDAHTRLMLPFHQRYMSGSRACRLWAAMARSMDIEWIV
                     PQHGPSFRGKHMVARFIDWIDALACGLDLLTQDHYRVPAPAMR"
     misc_feature    65014..>65775
                     /locus_tag="CNE_1c00620"
                     /note="Uncharacterized flavoproteins [Energy production
                     and conversion]; Region: FpaA; COG0426"
                     /db_xref="CDD:223503"
     misc_feature    65095..65667
                     /locus_tag="CNE_1c00620"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(65791..66417)
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /db_xref="GeneID:10916454"
     CDS             complement(65791..66417)
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004683913.1"
                     /db_xref="GI:339324220"
                     /db_xref="GeneID:10916454"
                     /translation="MKLYYTPGVCSMAVHIALREAGLPVTLAKVDLLHHKLAVPENGT
                     DDYYTINPRGYVPLLQLDDGSRHTEAASLLQYIADLVPERALLPAAGTRERLEATGWI
                     TLVSTELHKVFSPWLWHKETAQSTVEACKAKLQLRFAELDKHLQGRQYLTGDTFTVAD
                     AYCFTILGWARMLMMPLTAYPTLQDYLSRIAARPAVQEAMRAEGLVRD"
     misc_feature    complement(65803..66417)
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="glutathionine S-transferase; Provisional; Region:
                     PRK10542"
                     /db_xref="CDD:182533"
     misc_feature    complement(66172..66417)
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="GST_N family, Class Beta subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Beta; cd03057"
                     /db_xref="CDD:239355"
     misc_feature    complement(order(66181..66183,66193..66195,66358..66363,
                     66373..66375,66379..66381,66394..66399))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239355"
     misc_feature    complement(order(66208..66213,66250..66255,66388..66390))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239355"
     misc_feature    complement(order(66181..66183,66190..66192,66205..66207,
                     66211..66216,66253..66255))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239355"
     misc_feature    complement(65818..66141)
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="C-terminal, alpha helical domain of Class Beta
                     Glutathione S-transferases; Region: GST_C_Beta; cd03188"
                     /db_xref="CDD:198297"
     misc_feature    complement(order(66019..66021,66031..66033,66058..66060,
                     66085..66087,66097..66099,66109..66111,66118..66120,
                     66127..66132,66139..66141))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198297"
     misc_feature    complement(order(65821..65823,65833..65835,65839..65841,
                     65911..65913,65923..65925,65944..65946,66088..66090,
                     66133..66135))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198297"
     misc_feature    complement(order(65902..65904,65911..65913,65920..65922,
                     66067..66069,66073..66078,66085..66090,66100..66102))
                     /gene="gstB"
                     /locus_tag="CNE_1c00630"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198297"
     gene            complement(66573..67310)
                     /gene="hyuE1"
                     /locus_tag="CNE_1c00640"
                     /db_xref="GeneID:10916455"
     CDS             complement(66573..67310)
                     /gene="hyuE1"
                     /locus_tag="CNE_1c00640"
                     /EC_number="5.1.99.5"
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoin racemase HyuE"
                     /protein_id="YP_004683914.1"
                     /db_xref="GI:339324221"
                     /db_xref="GeneID:10916455"
                     /translation="MKLLIVNPNISESVTALIEAEARRTAAATTTLQMATAAFGVAYI
                     ETRFEALVGGYATACAAAEHAGQFDGLVVAAFGDPGLAGLKELFDVPVVGMTEAALAS
                     ACLLGQRFSIIAISHRIQAWYRECVAANGLSSRLASVRSLQEPLRDIGSVQEDHAARL
                     EQLALQAIEQDGADVIIVAGAPLAGLARSLQGRIPVPVVDGVSSAVRHCESLVALRAG
                     SATQGSFARPPRKPNAGLPPALAKLLD"
     misc_feature    complement(66627..67310)
                     /gene="hyuE1"
                     /locus_tag="CNE_1c00640"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            complement(67342..68763)
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /db_xref="GeneID:10916456"
     CDS             complement(67342..68763)
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /EC_number="3.5.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-hydantoinase HyuA"
                     /protein_id="YP_004683915.1"
                     /db_xref="GI:339324222"
                     /db_xref="GeneID:10916456"
                     /translation="MSAHDSLDLVIRRADVVTASDRFRCDIGVRNGQIVALGHALPQA
                     AREIDADGLLALPGGVDGHCHLDQPMPDGLRMADDFFTGTRAAVCGGTTTVIPFAAQE
                     KGASLKAAVADYHRRAEGRAVIDYAFHLIVADPTPAVLADELPTLIRKGYSSFKVYMT
                     YDDLKLSDREMLSVLDVAKQNGALVMVHAENADCISWLTDKLVGEGRIAPRFHGLARP
                     AAVEREATHRAITFAELVDVPILIVHVSGKEAIEQIRWAQGRGLQILAETCPQYLYLT
                     ADDMALPGDDGYEGAKCVCSPPPRDPENQAAVWRALTNGVFSVFSSDHAPFRYDDPQG
                     KQPGGERPSFEHIPNGVPGIETRLPLLFDGVARGKLSLHQFVELTSWRPARLYGLYPR
                     KGTIAIGADADIVLWDPNKRVQIRNSALHHAVDYTPYEGIEVTGWPVHCFSRGEMLVR
                     DGQYQEPQAGRGQFLPAGAPMLG"
     misc_feature    complement(67354..68742)
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /note="dihydropyrimidinase; Provisional; Region: PRK13404"
                     /db_xref="CDD:184033"
     misc_feature    complement(67402..68739)
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /note="D-hydantoinases (D-HYD) also called
                     dihydropyrimidases (DHPase) and related proteins; DHPases
                     are a family of enzymes that catalyze the reversible
                     hydrolytic ring opening of the amide bond in five- or
                     six-membered cyclic diamides, like dihydropyrimidine...;
                     Region: D-HYD; cd01314"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(67579..67581,67594..67596,67609..67611,
                     67978..67983,67987..67992,68071..68073,68080..68082,
                     68092..68094,68104..68106,68173..68175,68182..68184,
                     68191..68193,68254..68256,68653..68658,68695..68697,
                     68701..68706))
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(67795..67797,68032..68034,68200..68202,
                     68296..68298,68569..68571,68575..68577))
                     /gene="hyuA1"
                     /locus_tag="CNE_1c00650"
                     /note="active site"
                     /db_xref="CDD:238639"
     gene            complement(68768..69505)
                     /locus_tag="CNE_1c00660"
                     /db_xref="GeneID:10916457"
     CDS             complement(68768..69505)
                     /locus_tag="CNE_1c00660"
                     /EC_number="5.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="maleate cis-trans isomerase"
                     /protein_id="YP_004683916.1"
                     /db_xref="GI:339324223"
                     /db_xref="GeneID:10916457"
                     /translation="MTEMTKQIRLGMLTPSSNTALEPITSAMVSGLPNVSAHFSRFTV
                     TEISLRDQALGQFNLDKILAAASLLADARVDVIAWNGTSSGWLGFDKDEALCKQITEA
                     TGIPATTSVLALNEILEKTGARNFGLATPYLDDVQQRIIANYERSGFNCVAESHLDLH
                     VNYSFAEVEEDTIREMVRGLAQHQPQAITTFCTNLRAAHLAEELEAETGIPLYDTIST
                     VVWKSLRLCGVDTRELRGWGRLFREVE"
     misc_feature    complement(68777..69481)
                     /locus_tag="CNE_1c00660"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            complement(69567..70763)
                     /gene="ampC"
                     /locus_tag="CNE_1c00670"
                     /db_xref="GeneID:10916458"
     CDS             complement(69567..70763)
                     /gene="ampC"
                     /locus_tag="CNE_1c00670"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase AmpC"
                     /protein_id="YP_004683917.1"
                     /db_xref="GI:339324224"
                     /db_xref="GeneID:10916458"
                     /translation="MNRFPRMLAAALLVLGAAQAHAAPAAPSAPAGDGLPTAQPEAVG
                     VDSAKLVALSEWIRRDKLDVRSLLVIKDGKLVFERYGDGLSRDYNHELYSVTKFISAL
                     LVGTLVGDGKLSAEDTPAQRLAAARPDLAPALADKQAIQLRHLMSMSSGLSYKLVEGT
                     DTLYYGVPDRLRVAATAAVRTKAGAEFDYIDVNPVLVGATVTQAAGQPEDQYAKARLF
                     GPLGMSHYRWDGADGKGAVSGGWGLRLRSIDMAKLGMLMLNEGRWNGQQIVPASWVAR
                     MTTPAGPAKDYGFYCWVNNIVQSEREFSAMGYKGQFITVLPKQNAVIVMNSIMSTQGG
                     LRDAAYLDLYRRMVNDYVLPALQAGKSVKPDAARQAALRKELELARSSQGVPGTALAF
                     NDKPEQ"
     misc_feature    complement(69711..70655)
                     /gene="ampC"
                     /locus_tag="CNE_1c00670"
                     /note="Beta-lactamase class C and other penicillin binding
                     proteins [Defense mechanisms]; Region: AmpC; COG1680"
                     /db_xref="CDD:224594"
     gene            complement(70868..72166)
                     /gene="gudP"
                     /locus_tag="CNE_1c00680"
                     /db_xref="GeneID:10916459"
     CDS             complement(70868..72166)
                     /gene="gudP"
                     /locus_tag="CNE_1c00680"
                     /codon_start=1
                     /transl_table=11
                     /product="glucarate transporter GudP"
                     /protein_id="YP_004683918.1"
                     /db_xref="GI:339324225"
                     /db_xref="GeneID:10916459"
                     /translation="METTSRATVITEAKTSVRWKIFLMMLFLVAINYIDRASLSVAMP
                     LIAKEFDLSPAMQGLILSSFFWTYAFMQIPGGMLADKYKPRIVIACATVFWGFFQAIA
                     AVCTNATSLLITRLGLGASEAPIYPAGGKLNAIWMTQNERGRGATLLDGGAPLGAALG
                     SLIIAGLISELGSWRMSFVVAGVGTVLAGFVAWWYIRNSPREHSGVNELEARHIEEAQ
                     AREHSAEPANLSGRSLDFFKYRSVWCMAISWMCFNAVFYGLLTWMPTYLSKARGFDLK
                     TMGGASFIIFMSGFVGELVGGWIADKWKEAGGRPNVVMRTLFGIAAVVATVSIFSVAY
                     VTDAVAVVALLSSTLFFLRWCGLFWSVPSMLATRNKIGFLGGLMNLGGNIAGISVPII
                     VGLIVQATGSYFLALMFFAAAGVGLLFASTAIDYETKIPV"
     misc_feature    complement(70907..72103)
                     /gene="gudP"
                     /locus_tag="CNE_1c00680"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(70928..72085)
                     /gene="gudP"
                     /locus_tag="CNE_1c00680"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(71009..71011,71018..71023,71030..71035,
                     71042..71047,71087..71089,71096..71101,71111..71113,
                     71120..71125,71132..71134,71288..71290,71300..71302,
                     71309..71311,71321..71323,71333..71335,71375..71377,
                     71384..71389,71396..71401,71408..71410,71696..71698,
                     71714..71719,71726..71731,71765..71767,71774..71779,
                     71786..71791,71798..71803,71939..71944,71948..71953,
                     71963..71965,71972..71977,71984..71986,72035..72040,
                     72044..72052,72059..72061))
                     /gene="gudP"
                     /locus_tag="CNE_1c00680"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            72208..73083
                     /locus_tag="CNE_1c00690"
                     /db_xref="GeneID:10916460"
     CDS             72208..73083
                     /locus_tag="CNE_1c00690"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004683919.1"
                     /db_xref="GI:339324226"
                     /db_xref="GeneID:10916460"
                     /translation="MAFCATGRSIGYVICNYNACKSLILRYCACTILVCGSLVVVHFP
                     ILVTSVTQTLSQTTRLRTLGMSAEIAARLRTMIEEGELPPGARIDERAFCETFDVSKT
                     PLREALKVLVSEGLVLHRQYIGYRVAPLDLEELRATFETLHGLEALAGELAAQRLGVA
                     AMAKLERRHLAMIDAHAAGRRTDYFRINQEIHQLIIDGAANPVLAGVYAALMSKVHRA
                     RGAANADTIRWQESHEEHEAIMAALREPGRPRLAQVLRAHSENTAKEVLSVVAQTLAE
                     AGATGASGAALKKSA"
     misc_feature    72379..72999
                     /locus_tag="CNE_1c00690"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    72409..72591
                     /locus_tag="CNE_1c00690"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(72472..72474,72475..72480,72502..72516,72520..72525,
                     72532..72534,72562..72567,72571..72582)
                     /locus_tag="CNE_1c00690"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    72622..72981
                     /locus_tag="CNE_1c00690"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            73109..73957
                     /locus_tag="CNE_1c00700"
                     /db_xref="GeneID:10916461"
     CDS             73109..73957
                     /locus_tag="CNE_1c00700"
                     /EC_number="4.3.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate lyase"
                     /protein_id="YP_004683920.1"
                     /db_xref="GI:339324227"
                     /db_xref="GeneID:10916461"
                     /translation="MKLVRVGNPGAERPGMIDAQGRVRDLSGVVADIGAAQLAPAALA
                     QLAQVDPASLPVIEGARYGVPWSGVGKIVAIGLNYADHAAEAGMPLPAEPIVFLKANS
                     SLNGPDDAVMLPFGSEKTDWEVELGVVIGSTARNVSREAALNHVAGYCVVNDVSEREF
                     QIERGGTWDKGKGCDTFCPAGPWLVTRDEVPDPQALGLWLEVNGERVQKGSTATMVFD
                     VATVVSYVSRFMTLLPGDLIATGTPPGVGMGFKPPRFLKAGDTMRLGVDGLGEQTQQV
                     VPYGER"
     misc_feature    73136..73948
                     /locus_tag="CNE_1c00700"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    73319..73939
                     /locus_tag="CNE_1c00700"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            74227..75474
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /db_xref="GeneID:10916462"
     CDS             74227..75474
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /EC_number="3.5.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="hippurate hydrolase HipO"
                     /protein_id="YP_004683921.1"
                     /db_xref="GI:339324228"
                     /db_xref="GeneID:10916462"
                     /translation="MSEHAPEIESYLGTTLTASPASPLKHRYCALADTLDSRAELEVI
                     RRNIHQHPELAFDEVRTSGLVASLLEAWGYTVTRGVGGTGVVGTLRCGDSGHSVGIRA
                     DMDALPIHERTALPYASVNAGRMHACGHDGHTAILLGAAKQLARTRNFDGTVHLIFQP
                     AEEIGAGGGAERMLADGLFERFPCDAIFGLHNHPGVEQGSFLFRSGPFMAACDTVTIT
                     IRGKGGHAARPHQSVDPILVAGSLVMALQSVVARYVDPNETAVVTIGTLHAGHAPNVI
                     PDNARMEISVRSFNPEVRASVENRIRQLATSHAEGYGAVAEVDYVRGYPVLVNSERET
                     EFARQVAEELVGADKVVDQAARIAGSEDFAYFLQQRPGCFVRLGNGANQPLLHNAGYD
                     FNDDNLTVGAAYWTRLVERYLKR"
     misc_feature    74338..75471
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /note="Metal-dependent
                     amidase/aminoacylase/carboxypeptidase [General function
                     prediction only]; Region: AbgB; COG1473"
                     /db_xref="CDD:224390"
     misc_feature    74341..75459
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /note="M20 Peptidase Aminoacylase 1 subfamily; Region:
                     M20_Acy1_like1; cd05666"
                     /db_xref="CDD:193542"
     misc_feature    order(74608..74610,74614..74616,74713..74715,74797..74799,
                     75385..75387)
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193542"
     misc_feature    order(74866..74868,74932..74937,74947..74949,74956..74958,
                     74965..74967,75016..75036,75046..75051,75055..75057,
                     75073..75081)
                     /gene="hipO1"
                     /locus_tag="CNE_1c00710"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193542"
     gene            complement(75492..76364)
                     /gene="fsr"
                     /locus_tag="CNE_1c00720"
                     /db_xref="GeneID:10916463"
     CDS             complement(75492..76364)
                     /gene="fsr"
                     /locus_tag="CNE_1c00720"
                     /codon_start=1
                     /transl_table=11
                     /product="fosmidomycin resistance protein Fsr"
                     /protein_id="YP_004683922.1"
                     /db_xref="GI:339324229"
                     /db_xref="GeneID:10916463"
                     /translation="MPRAPRPLSASGAARRRDQHAPPAPTPETLALADTYAEPPPYVR
                     FDRSPLPVTAMAADYLPGHVTNPHQHPHAQLIHAVHGVMVVATAEGQWIVPPTRGMWM
                     PGGTTHWIRMVGRVQMRTAYIRPDAAPDLPQRCTVLGISALLRELILAAIDIPLPYAP
                     DTRDARLMRLLLDEVMLVPSLPLHLPRPADGSLRQICDAITGAPDTALTLADWGSRLE
                     VDPKTIQRRFARETGMTFGQWRQQARLLAALEKLAAGSKVVDVALDLGYDSPSAFATM
                     FRRQFGVPPSAFFR"
     misc_feature    complement(75852..76187)
                     /gene="fsr"
                     /locus_tag="CNE_1c00720"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(75501..75851)
                     /gene="fsr"
                     /locus_tag="CNE_1c00720"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(75495..>75596)
                     /gene="fsr"
                     /locus_tag="CNE_1c00720"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            76363..77727
                     /locus_tag="CNE_1c00730"
                     /db_xref="GeneID:10916465"
     CDS             76363..77727
                     /locus_tag="CNE_1c00730"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004683923.1"
                     /db_xref="GI:339324230"
                     /db_xref="GeneID:10916465"
                     /translation="MSFSPRLRTYSRRTGAGAPASIGAKFHPGRRPRWPLSVCREPPM
                     STTIDSAPAGATPSATSPQAERTGFRVLSAISFAHFLNDMIQSLILAIYPMLKGGFNL
                     SFTQIGLLTMTYQVTASLLQPVVGLYTDKHPKPHSLAIAMAFTLAGLLLLSVAPTYGV
                     LLVAAALVGTGSSIFHPESSRVARMASGGQHGLAQSIFQVGGNGGSAMGPLLAALIVH
                     QQASLAWFSLAALVGMVVLWRIGGWYARQLAQGARKRKAAGAVASPVPTRVVVRAMVV
                     LMVLVFSKYFYMASLTSYYTFYLMERFGLARQDAQLHLFMFLAAVAAGTILGGPIGDR
                     IGRKRVIWASILGVAPFTLMLPHVGLFWTTVLTFIIGFILASAFSAILVFAQELIPGK
                     VGMVSGLFFGFAFGMGGIGAAVLGGMADTHGIRAVYEYCAYLPLLGLLTVFLPDLRER
                     PQRA"
     misc_feature    76576..77694
                     /locus_tag="CNE_1c00730"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    76585..77532
                     /locus_tag="CNE_1c00730"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(76618..76620,76627..76635,76639..76644,76693..76695,
                     76702..76707,76714..76716,76726..76731,76735..76740,
                     76876..76881,76888..76893,76900..76905,76909..76911,
                     76945..76950,76957..76962,76978..76980,77215..77217,
                     77224..77229,77236..77241,77248..77250,77290..77292,
                     77302..77304,77314..77316,77323..77325,77335..77337,
                     77473..77475,77482..77487,77494..77496,77506..77511,
                     77518..77520,77548..77553,77560..77565,77572..77577,
                     77584..77586)
                     /locus_tag="CNE_1c00730"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(77731..78282)
                     /gene="pecS"
                     /locus_tag="CNE_1c00740"
                     /db_xref="GeneID:10916464"
     CDS             complement(77731..78282)
                     /gene="pecS"
                     /locus_tag="CNE_1c00740"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-typetranscriptional regulator PecS"
                     /protein_id="YP_004683924.1"
                     /db_xref="GI:339324231"
                     /db_xref="GeneID:10916464"
                     /translation="MTTRRKPEDTPDHVDGILAQWARERPDLDASPMGVIGRLGRLNR
                     HTSRAIEAALGETGLQPWEFDVLATLRRAGPPYALSPGALIGSLMITSGTMTNRLDHL
                     ERAGLVRRQPNPEDRRGLLVELTEAGRERVDRALELHVANEHRLLADLTAAERAQLAA
                     LLRRWLRMFEPPLGGGGEGNEPA"
     misc_feature    complement(77782..78159)
                     /gene="pecS"
                     /locus_tag="CNE_1c00740"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(77818..78129)
                     /gene="pecS"
                     /locus_tag="CNE_1c00740"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            78389..79303
                     /gene="pecM"
                     /locus_tag="CNE_1c00750"
                     /db_xref="GeneID:10916466"
     CDS             78389..79303
                     /gene="pecM"
                     /locus_tag="CNE_1c00750"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PecM"
                     /protein_id="YP_004683925.1"
                     /db_xref="GI:339324232"
                     /db_xref="GeneID:10916466"
                     /translation="MKTTASSIRTAPGGVTVRDILLTGLAPGIWGSTYLVTSQWLPPG
                     QPLLSGVIRALPAGLAMLAFGRQLPRGSWWWRAAVLGVLNIGFFQAMLFIAAYRLPGG
                     VAATVGAIQPLIVVVLAWAWLGARPRSAAWMAGVGGLLGVALLVLGPAARLDAIGVAA
                     AAAGAVSMAVGTVLTRHWRPPVSPLVLTAWQLCAGGLFLLPFALVLEPLPGHFTLANW
                     LGYAWLSIVGAGFSYALWFRGVGRMPSSAVAALGLLSPVSATVLGFLVLGQALTAMQA
                     AGALLVLGSVWLGQRAATPVAVARTQPA"
     misc_feature    78473..78787
                     /gene="pecM"
                     /locus_tag="CNE_1c00750"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    78476..79246
                     /gene="pecM"
                     /locus_tag="CNE_1c00750"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    78899..79252
                     /gene="pecM"
                     /locus_tag="CNE_1c00750"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            79349..79648
                     /locus_tag="CNE_1c00760"
                     /db_xref="GeneID:10916467"
     CDS             79349..79648
                     /locus_tag="CNE_1c00760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683926.1"
                     /db_xref="GI:339324233"
                     /db_xref="GeneID:10916467"
                     /translation="MAGMKSAVPPSPPSIQAASAPSATPACERCLALAADPRRREPPS
                     CLALRGTVPLVSQSAAGVPFSMLSFTCRDCGTVWRLYDRANELFVSWVPERPLVR"
     gene            79754..80737
                     /gene="bugT1"
                     /locus_tag="CNE_1c00770"
                     /db_xref="GeneID:10916468"
     CDS             79754..80737
                     /gene="bugT1"
                     /locus_tag="CNE_1c00770"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004683927.1"
                     /db_xref="GI:339324234"
                     /db_xref="GeneID:10916468"
                     /translation="MAFPFRSSLLAALCVTSGTAALPAAAADAYPSRPIRLIVAYPTG
                     GISDTVARALGERLSAQMGTSVVVENKAGAGGSIGIDAVAKAAPDGYTLGFAATSPLT
                     LNPHVGRVNYDPQKDVAPVMSVMYSPVLVVATSGFSGKSFADVVGQASAKPGSVRWAT
                     SGLGTVGHVVLEQIKQKSKADITLIPYKGAGQQMNDALGGQFEVMSTNASPVLTQHMQ
                     AGRLRALAVGAPRRLESLPSVPTLAELGYPKANLTSTFGIFAPGKTPAAIISRLNAEL
                     NKALAEPEVHERLLKGGEVPTGGTPAQFAKAIREESAENARIVKEAGIKAD"
     misc_feature    79775..80725
                     /gene="bugT1"
                     /locus_tag="CNE_1c00770"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            complement(80770..81504)
                     /locus_tag="CNE_1c00780"
                     /db_xref="GeneID:10916469"
     CDS             complement(80770..81504)
                     /locus_tag="CNE_1c00780"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpR family response regulator"
                     /protein_id="YP_004683928.1"
                     /db_xref="GI:339324235"
                     /db_xref="GeneID:10916469"
                     /translation="MLCPSIGAFRCARAGATLVNIAALQADPTLAVSIEQTLRLNGHQ
                     CARYLSGRTMIGALRGRSFDLLMLDCDAPGIPALEVLAWVRRTLGNEMPVILTGTSNE
                     EAFVAACFAQGADSYVPKPLRTAELAARVLALLRRARPTRDECDLEHGVFRFATAERR
                     VWVQGKPVLLAPKEFDLAVLLFRNLGSLVLRQTMADQVWRYHMDPASRTVDSHLSRVR
                     TKLALWPHNGVRLSSVYGLGSRLDAA"
     misc_feature    complement(80776..81426)
                     /locus_tag="CNE_1c00780"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(81100..81426)
                     /locus_tag="CNE_1c00780"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(81142..81147,81154..81156,81211..81213,
                     81274..81276,81298..81300))
                     /locus_tag="CNE_1c00780"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(81298..81300)
                     /locus_tag="CNE_1c00780"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(81274..81282,81286..81291))
                     /locus_tag="CNE_1c00780"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(81139..81147)
                     /locus_tag="CNE_1c00780"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(80782..81066)
                     /locus_tag="CNE_1c00780"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(80791..80793,80806..80808,80842..80847,
                     80869..80871,80878..80880,80932..80937,80992..80994))
                     /locus_tag="CNE_1c00780"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            81635..81796
                     /locus_tag="CNE_1c00790"
                     /db_xref="GeneID:10916470"
     CDS             81635..81796
                     /locus_tag="CNE_1c00790"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_004683929.1"
                     /db_xref="GI:339324236"
                     /db_xref="GeneID:10916470"
                     /translation="MSRWCSVSAARLALLCAQRVVAGHSGVLVPLQSMGEAASPAGWY
                     LWLRRRPRA"
     gene            complement(81846..82949)
                     /locus_tag="CNE_1c00800"
                     /db_xref="GeneID:10916471"
     CDS             complement(81846..82949)
                     /locus_tag="CNE_1c00800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683930.1"
                     /db_xref="GI:339324237"
                     /db_xref="GeneID:10916471"
                     /translation="MKKSAIVLAAGSLLAGSAFAQSSVTLYGIVDQSIRFTTNSDAQN
                     HSQTQLSNGAVTNSRWGLKGSESLGNNLKAIFQLENGFDPDTGKANQGGRLFGRQAYV
                     GLSGDFGAIKLGRQYTEGFNFFGDYDPLTIGNYDQNAWPFFLTQFRSDNVISYSGKFG
                     GLNVGASYGFGEKPGSFTHAQTNPPNGNAPYFGARAAYESGPWGIGGVYQEFRDTNGN
                     KQQMWGAAGKYAFGPAKVFLGYIGGKDKTGLIDAAFFTPANSANPIPAGGNYTASPRK
                     DNIGYIGATYQATPALALTGVFYGDHIKNTNGLADVSGNRYTGVLLAEYSLSKRTQVY
                     GTVDYNKVTGGAKTQLPGRDNQLGLGAGIRHIF"
     misc_feature    complement(81849..82886)
                     /locus_tag="CNE_1c00800"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(81849..81851,81855..81857,81861..81863,
                     81957..81959,81966..81971,82497..82502,82506..82508,
                     82605..82613,82638..82652,82656..82661,82695..82706,
                     82710..82712,82716..82724,82728..82730,82746..82760,
                     82848..82856,82860..82862,82878..82880,82884..82886))
                     /locus_tag="CNE_1c00800"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(82506..82508,82566..82568,82656..82658,
                     82773..82775,82863..82865))
                     /locus_tag="CNE_1c00800"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(83315..83569)
                     /gene="minE"
                     /locus_tag="CNE_1c00810"
                     /db_xref="GeneID:10916472"
     CDS             complement(83315..83569)
                     /gene="minE"
                     /locus_tag="CNE_1c00810"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     MinE"
                     /protein_id="YP_004683931.1"
                     /db_xref="GI:339324238"
                     /db_xref="GeneID:10916472"
                     /translation="MSILSFLLGEKKKSASVAKERLQIILAHERTGHSAPADYLPALQ
                     RELVAVISKYVKIGDQDLRVSLERQDNLEVLEVKIEIPQN"
     misc_feature    complement(83321..83569)
                     /gene="minE"
                     /locus_tag="CNE_1c00810"
                     /note="cell division topological specificity factor MinE;
                     Provisional; Region: PRK13989"
                     /db_xref="CDD:184442"
     gene            complement(83591..84406)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /db_xref="GeneID:10916473"
     CDS             complement(83591..84406)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="YP_004683932.1"
                     /db_xref="GI:339324239"
                     /db_xref="GeneID:10916473"
                     /translation="MAKIIVVTSGKGGVGKTTTSASFAAGLALRGHKTAVIDFDVGLR
                     NLDLIMGCERRVVYDLINVVQGEANLRQALIKDKKCENLFILPASQTRDKDALTRDGV
                     EKVINGLIEMDFEFIICDSPAGIESGALMAMYFADEALIVTNPEVSSVRDSDRILGIL
                     ASKTKRASEGGDPIKEHLLITRYNPKRVHGGEMLSLTDIQEILRIKLIGVVPESEAVL
                     HASNQGTPAIHLEGSDVADAYGDVVDRFLGKDKPMRFTDYQKPGLLSRIFGNK"
     misc_feature    complement(83600..84406)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="Septum formation inhibitor-activating ATPase [Cell
                     division and chromosome partitioning]; Region: MinD;
                     COG2894"
                     /db_xref="CDD:225447"
     misc_feature    complement(83690..84397)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="Bacterial cell division requires the formation of a
                     septum at mid-cell. The site is determined by the min
                     operon products MinC, MinD and MinE. MinC is a nonspecific
                     inhibitor of the septum protein FtsZ. MinE is the
                     supressor of MinC. MinD plays a pivotal...; Region: MinD;
                     cd02036"
                     /db_xref="CDD:238993"
     misc_feature    complement(84353..84379)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="P-loop; other site"
                     /db_xref="CDD:238993"
     misc_feature    complement(order(83771..83773,84353..84364,84368..84370))
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="ADP binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238993"
     misc_feature    complement(84287..84295)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="Switch I; other site"
                     /db_xref="CDD:238993"
     misc_feature    complement(84035..84049)
                     /gene="minD"
                     /locus_tag="CNE_1c00820"
                     /note="Switch II; other site"
                     /db_xref="CDD:238993"
     gene            complement(84473..85456)
                     /gene="minC"
                     /locus_tag="CNE_1c00830"
                     /db_xref="GeneID:10916474"
     CDS             complement(84473..85456)
                     /gene="minC"
                     /locus_tag="CNE_1c00830"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinC"
                     /protein_id="YP_004683933.1"
                     /db_xref="GI:339324240"
                     /db_xref="GeneID:10916474"
                     /translation="MRVAPRGKPRWPHLPGATVCRARAYGTHAPPAVHIDPIVTVRDR
                     YDVRMWHFHGHPAMSQKKSPRFELRSGNVDALLLALQTADMAALRDDLLSRFEATPDF
                     FSNDVIALDLRALEDDSEVALGTVIETLATLKARAIGVVARPGQREWAERFGLPLLDS
                     QARRGSGADRATDRAAEARAAAAAEQAAAEQVAREESIRAAAQATTDAAVAAAIRQTQ
                     TMLIDKPLRSGQQVYAQGDVVILDVVSYGAEVIAEGNIHIYAPLRGRALAGVKGNTGA
                     RIFSTCMEPELISIAGIYRTAEQTLPADVLGKTAQVRLADEKLILEALRLK"
     misc_feature    complement(84476..85285)
                     /gene="minC"
                     /locus_tag="CNE_1c00830"
                     /note="septum formation inhibitor; Reviewed; Region:
                     PRK01973"
                     /db_xref="CDD:234994"
     misc_feature    complement(84983..85258)
                     /gene="minC"
                     /locus_tag="CNE_1c00830"
                     /note="Septum formation inhibitor MinC, N-terminal domain;
                     Region: MinC_N; pfam05209"
                     /db_xref="CDD:253088"
     misc_feature    complement(84485..84802)
                     /gene="minC"
                     /locus_tag="CNE_1c00830"
                     /note="Septum formation inhibitor MinC, C-terminal domain;
                     Region: MinC_C; pfam03775"
                     /db_xref="CDD:146423"
     gene            85517..86488
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /db_xref="GeneID:10916475"
     CDS             85517..86488
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2+ and Co2+ transporter CorA"
                     /protein_id="YP_004683934.1"
                     /db_xref="GI:339324241"
                     /db_xref="GeneID:10916475"
                     /translation="MGAIVNCVAYRQGKRLSTVGMAEIRTVLDVPGTFVWLGLHEPDL
                     ALLRQAQQAFGLHDLAVEDALDAHQRPKLESYGDSVFVVLNTAQLVEDEVVVGETHLF
                     VGPNYVVSVRHGVSSTYAPVRERCEQDPHGLANGPGYVLYALMDFIVDHYMPIVTRLE
                     DTFEALEEGIFRDEFDRKAIERLYQIKRQVLRLRNAVSPVEDMCGQLIRLHEDLVPKE
                     LRAYFRDIEDHASRLVRTLDVVREMLTTAVQVNLALVTVGQNEVVKRLAGWGAILAIP
                     TVIFSLYGMNFDFMPELKVPFAYPAVIGVTAVACGGLWRRLHRAGWI"
     misc_feature    85607..86473
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    85613..86485
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="Mycobacterium tuberculosis CorA-like subfamily;
                     Region: MtCorA-like; cd12830"
                     /db_xref="CDD:213364"
     misc_feature    order(85691..85693,85700..85705,85730..85732,85736..85738,
                     85877..85879,85889..85891,85931..85933,85940..85942,
                     85964..85966,85973..85975,85985..85987,86003..86008,
                     86015..86017,86054..86059,86066..86068,86075..86080,
                     86087..86089,86099..86101,86177..86182,86186..86191,
                     86198..86203,86207..86212,86219..86224,86228..86233,
                     86237..86245,86252..86275,86279..86317,86321..86329,
                     86333..86350,86354..86377,86408..86413,86420..86425,
                     86432..86434,86465..86467,86474..86476)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213364"
     misc_feature    order(85700..85702,85952..85954,86189..86191)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213364"
     misc_feature    order(85703..85705,86189..86191)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213364"
     misc_feature    order(85889..85891,85931..85933)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="putative Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213364"
     misc_feature    order(86288..86290,86306..86308,86468..86479)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213364"
     misc_feature    order(86303..86305,86312..86314)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="hydrophobic gate; other site"
                     /db_xref="CDD:213364"
     misc_feature    order(86357..86359,86363..86368)
                     /gene="corA1"
                     /locus_tag="CNE_1c00840"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213364"
     gene            86643..87347
                     /locus_tag="CNE_1c00850"
                     /db_xref="GeneID:10916476"
     CDS             86643..87347
                     /locus_tag="CNE_1c00850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683935.1"
                     /db_xref="GI:339324242"
                     /db_xref="GeneID:10916476"
                     /translation="MSIARPPIAALLAGATATWLLCMQPAASAPQPPAPAQAQTRDAV
                     TAYEAGNFDQALRGFADAARQGNRLAQFNYAMMLLRGEGTAARPQEALVWLKKAADSQ
                     MTHAQYTWGDLYERGELVPKSLEEANRWYALAAQGGHVQAQMALATNYFTGRGVPRDY
                     GQAFTWYSRAASAGDGGAQYIVGSFYEHGEPGVVDRDLEQAKIWYARSAAHGDPGALA
                     KLRSLLEESVRGRAAR"
     misc_feature    <86793..87311
                     /locus_tag="CNE_1c00850"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    86850..86942
                     /locus_tag="CNE_1c00850"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    86958..87059
                     /locus_tag="CNE_1c00850"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    87060..87167
                     /locus_tag="CNE_1c00850"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    87174..87281
                     /locus_tag="CNE_1c00850"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            complement(87399..88229)
                     /locus_tag="CNE_1c00860"
                     /db_xref="GeneID:10916477"
     CDS             complement(87399..88229)
                     /locus_tag="CNE_1c00860"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004683936.1"
                     /db_xref="GI:339324243"
                     /db_xref="GeneID:10916477"
                     /translation="MTLIRRRHPSSPTSQASDTTPPAPEYTIDELARVAGTTVRNVRS
                     YQDRGLIDPPLRRGRVGIYTQAHLGRLKLIHHLLARGYTLANITELLKAIVEGHDLRS
                     ILGLETAINSPWTNETPRHYSYLALARLFGRAISRPALAKAISLGLLEPDGLGYLARS
                     PRALAAGAEIAQAGFALEDVLEIIAQSRGHFQAVSDHIVATVVRELDRFGVGKLPPPQ
                     DVPRLVEILWRIRPLALVMAETEMMRALEISANKYLGDRVAAIIEHLHDEEGGGGGHR
                     "
     misc_feature    complement(87492..88157)
                     /locus_tag="CNE_1c00860"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg2; cd04778"
                     /db_xref="CDD:133405"
     misc_feature    complement(<87954..88154)
                     /locus_tag="CNE_1c00860"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    complement(order(88047..88055,88101..88103,88143..88151))
                     /locus_tag="CNE_1c00860"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133405"
     misc_feature    complement(order(87843..87848,87855..87857,87867..87869,
                     87885..87887,87897..87899,87960..87962,87987..87992,
                     88002..88004,88011..88013))
                     /locus_tag="CNE_1c00860"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133405"
     gene            88328..89272
                     /locus_tag="CNE_1c00870"
                     /db_xref="GeneID:10916478"
     CDS             88328..89272
                     /locus_tag="CNE_1c00870"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004683937.1"
                     /db_xref="GI:339324244"
                     /db_xref="GeneID:10916478"
                     /translation="MHIRWLEDFVCLAQAGSLARAAELRNVTPPAFGRRMQALEVWAG
                     APLIDRSAFPVRLTAEGRQFLEAAQSALRTLDETRLALRAAHRADASTVTIATGKTLA
                     RSMVPAWLAGLREALRHDPAAAGFRTRLSTFPMHDALAMFSEGDADFLLCYSPPDLPV
                     MLDDARYQFHLAGVERLVCVSAADARGAPLHRLATGKAAAKPVPMIAYAETLTLGRMV
                     NQEIARRKLAPRLDVIAVSDFAESVHEMVRQRMGLAWLPARLIADDLHAGRLVRAIGG
                     VRSDDGGDLALDIRLYRPRAPMRPLAEAFWQAAVRAPR"
     misc_feature    88334..88513
                     /locus_tag="CNE_1c00870"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    88337..89248
                     /locus_tag="CNE_1c00870"
                     /note="cell density-dependent motility repressor;
                     Provisional; Region: PRK10082"
                     /db_xref="CDD:182228"
     misc_feature    88601..89254
                     /locus_tag="CNE_1c00870"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(88646..88651,88655..88660,88667..88669,88688..88690,
                     88694..88696,88706..88723,89027..89044,89060..89065,
                     89069..89074)
                     /locus_tag="CNE_1c00870"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            89395..90363
                     /locus_tag="CNE_1c00880"
                     /db_xref="GeneID:10916479"
     CDS             89395..90363
                     /locus_tag="CNE_1c00880"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004683938.1"
                     /db_xref="GI:339324245"
                     /db_xref="GeneID:10916479"
                     /translation="MKTILRAAAAALCLAASAGAVASAWPAKPITLVVGYTAGGSVDL
                     VARTIAPELGKRLGQSVVIENLGGAGGTIGAAKVVKAEADGYTLLMGSGSEVSIARLT
                     NPAVRYDGEKDLAPVTFVGTQPMVLVGKPGLAARNAAELIALAKAQPGKLAYASSGVG
                     TPLNLAGELIKQQGKVNITHVPYKGASAMATDLLGGQIDLAVMVLSSALPHIQAGRVQ
                     AYGVTNAKRSPVAPNVPALAETPALKGVDMGVWFGLMGPAKLPQAVVERLNTEMQAVL
                     AMPDVKKKLAEAGVEVAPANPAQFGSFIKRETGRYRTIVQTAGIHE"
     misc_feature    89527..90354
                     /locus_tag="CNE_1c00880"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            90474..91448
                     /locus_tag="CNE_1c00890"
                     /db_xref="GeneID:10916480"
     CDS             90474..91448
                     /locus_tag="CNE_1c00890"
                     /codon_start=1
                     /transl_table=11
                     /product="succinylglutamate desuccinylase"
                     /protein_id="YP_004683939.1"
                     /db_xref="GI:339324246"
                     /db_xref="GeneID:10916480"
                     /translation="MTQPTAPIDAYPVDVAFPDIRAYAAGNTRIPYLFTFDSGQPGPH
                     VMVNALTHGNEVCGAIAVKALLDHGLRPRRGRLTLAFANVDAYHRFDAARPDASRFVD
                     QDFNRVWTARVLDDASLDSSELRRARAMRPVIDTVDLLLDLHSMHEKSRPLIVSGPLD
                     KGIALARALGAPADVIVDEGHPEGRRMRDYDGFGDAASARNALLIECGQHWEPAAVTV
                     AQDSTARFLLHAGVIDASDLPAGWLQPLPATQRVVRVTEPVVATSMDFRFAGPYTGLE
                     TFTEAGTVIGWRDGEPVVTPYPDCVLVMPSLRQLRPGVTVVRLGRLER"
     misc_feature    90600..91430
                     /locus_tag="CNE_1c00890"
                     /note="Peptidase M14 Succinylglutamate desuccinylase
                     (ASTE)/aspartoacylase (ASPA)-like; uncharacterized
                     subgroup; Region: M14_ASTE_ASPA_like_7; cd06910"
                     /db_xref="CDD:199877"
     misc_feature    order(90627..90629,90636..90638,90768..90770,90789..90794,
                     90903..90908,90933..90935,91041..91043,91053..91055,
                     91089..91091,91389..91391)
                     /locus_tag="CNE_1c00890"
                     /note="putative active site [active]"
                     /db_xref="CDD:199877"
     misc_feature    order(90627..90629,90636..90638,90903..90905)
                     /locus_tag="CNE_1c00890"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:199877"
     gene            complement(91540..92082)
                     /locus_tag="CNE_1c00900"
                     /db_xref="GeneID:10916481"
     CDS             complement(91540..92082)
                     /locus_tag="CNE_1c00900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683940.1"
                     /db_xref="GI:339324247"
                     /db_xref="GeneID:10916481"
                     /translation="MYKTLLAAGLGLLITACSTYQAVTPVDRPDRTDPLVAFQVPAGG
                     GPLGNYGANGTLLCVVVNPVTGNDFVESFLSSLRRRNFEVKVLQAQTSIAACPVVALY
                     TARSAWYWTAYLNSADITVFRNGDRVGKAIYNANRSAGGLNLSNFVQPSSKLDELVEQ
                     LFPGMLPPPPPPAGTAAPAA"
     gene            complement(92222..92425)
                     /locus_tag="CNE_1c00910"
                     /db_xref="GeneID:10916482"
     CDS             complement(92222..92425)
                     /locus_tag="CNE_1c00910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683941.1"
                     /db_xref="GI:339324248"
                     /db_xref="GeneID:10916482"
                     /translation="MQSVLSVLAILIMVATIVGVVSPAWLSQTLFGGRPVTRLQVVVI
                     GVCLAGLCLVLVGRLAQGGGAGG"
     gene            complement(92457..93026)
                     /locus_tag="CNE_1c00920"
                     /db_xref="GeneID:10916483"
     CDS             complement(92457..93026)
                     /locus_tag="CNE_1c00920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683942.1"
                     /db_xref="GI:339324249"
                     /db_xref="GeneID:10916483"
                     /translation="MLNRTQQILIAIVAVAVLGMLWFAGNDRRDDVGGAAPEAQAEAS
                     AVPASVVRGVPRDGTLDPISIDPERPADRLPQLQADTLLNDYRGNPKEADTRYLGQYL
                     IVEGVASGIRREGNQVFVDIRTNDPGVNVRALLLQRQICGPAGRVCEVEARATMVRRG
                     QKVALECNGAGLADGAPLLRDCLLRGGAN"
     misc_feature    complement(92478..93026)
                     /locus_tag="CNE_1c00920"
                     /note="tRNA_anti-like; Region: tRNA_anti-like; pfam12869"
                     /db_xref="CDD:257362"
     gene            complement(93068..94312)
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /db_xref="GeneID:10916484"
     CDS             complement(93068..94312)
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /EC_number="2.4.1.173"
                     /codon_start=1
                     /transl_table=11
                     /product="sterol 3-beta-glucosyltransferase Agt"
                     /protein_id="YP_004683943.1"
                     /db_xref="GI:339324250"
                     /db_xref="GeneID:10916484"
                     /translation="MRLTLITFGTQGDCRPMVALGLGLRAAGHDVLMLGERSAATLAA
                     EHGLAFAPMAGDIQQTLAPGGALHKLMTEGGNVAEATRAFARIAEDNTEAWMAQLAEA
                     ARAADGIVFSGLTAYVALSVGEQLGKPVIGAGMFPISPTRAFPSALLPPFRMPGWANR
                     ASHHVINFVLWRMFRTATNAARSRLFGASARKAMWADFPTLYAISPQLVPRPHDWHDD
                     WLVSGAWTMPPQPDWQPDAPLRDFLAAGEAPLYIGFGSMAGFDRDKVVTALVQAVDGR
                     RALFYPGWSGIDVAALPSSFHVVGATPHDWLLPRVSAAIHHGGAGTTHAAVAAGAPSI
                     VLPFAGDQFFWAGRLAALGVAPRYVAGHKIDAPRLASMIAFAEQSATRERAATLGRAM
                     AAERGVDHAVAAIERFCGRQGA"
     misc_feature    complement(93071..94312)
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="Glycosyl transferases, related to
                     UDP-glucuronosyltransferase [Carbohydrate transport and
                     metabolism / Signal transduction mechanisms]; Region:
                     COG1819"
                     /db_xref="CDD:224732"
     misc_feature    complement(93089..94312)
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="This family includes the Gtfs, a group of
                     homologous glycosyltransferases involved in the final
                     stages of the biosynthesis of antibiotics vancomycin and
                     related chloroeremomycin. Gtfs transfer sugar moieties
                     from an activated NDP-sugar donor to the...; Region:
                     GT1_Gtf_like; cd03784"
                     /db_xref="CDD:99960"
     misc_feature    complement(order(93095..93097,93104..93109,93989..93991,
                     94232..94234,94310..94312))
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99960"
     misc_feature    complement(order(93338..93340,93347..93352,93356..93358,
                     93362..93364,93545..93547,93716..93718,93788..93790,
                     93800..93805,93812..93814,94268..94270,94274..94279))
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="active site"
                     /db_xref="CDD:99960"
     misc_feature    complement(order(93347..93352,93356..93358,93362..93364,
                     93545..93547,94277..94279))
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="TDP-binding site; other site"
                     /db_xref="CDD:99960"
     misc_feature    complement(94274..94276)
                     /gene="agt"
                     /locus_tag="CNE_1c00930"
                     /note="acceptor substrate-binding pocket; other site"
                     /db_xref="CDD:99960"
     gene            complement(94420..95847)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /db_xref="GeneID:10916485"
     CDS             complement(94420..95847)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /EC_number="3.6.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase MnmE"
                     /protein_id="YP_004683944.1"
                     /db_xref="GI:339324251"
                     /db_xref="GeneID:10916485"
                     /translation="MTAPQVPIAAIATAPGRGGIGVVRVSGPNVGPVMRAVCGQALKP
                     RHATYLPFLDGHGKVIDHGLALYFPAPNSYTGEEVLELQGHGGPVVMQMLLTRCLQAG
                     DGIGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAARSMEGEFSNAI
                     RQLVDKVIHLRMLVEATLDFPEEEIDFLEQSDARGQLATIRTELGGVLAQARQGALLR
                     EGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDRVRETIQIDGIPLHIIDTA
                     GLREHAADEVERIGIERTWDAIRRADIVLHLVDATDYLRHGLSETDDAIDDQLSGQLP
                     PGSPIVRIVNKIDKAPAVGDVVFGGNRPHVVAANGPNPTEIWISARTGAGIELLRREL
                     LRLVGWQSGNEGNFLARERHLTALRNAQSHLDIAAEQAEHQAQALDLFAEELRLAQDC
                     LNSITGEFTSDDLLGTIFTRFCIGK"
     misc_feature    complement(94423..95829)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="tRNA modification GTPase TrmE; Reviewed; Region:
                     trmE; PRK05291"
                     /db_xref="CDD:235392"
     misc_feature    complement(95476..95829)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="GTP-binding protein TrmE N-terminus; Region:
                     TrmE_N; pfam10396"
                     /db_xref="CDD:204472"
     misc_feature    complement(94693..95196)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="trmE is a tRNA modification GTPase; Region: trmE;
                     cd04164"
                     /db_xref="CDD:206727"
     misc_feature    complement(95146..95169)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="G1 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(94708..94716,94807..94809,94813..94818,
                     95143..95154,95158..95160))
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206727"
     misc_feature    complement(95074..95124)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(95083..95085)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="G2 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(94948..94992,94996..95001,95005..95031))
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(95017..95028)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="G3 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(94807..94818)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="G4 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(94708..94716)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="G5 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(94432..94653)
                     /gene="mnmE"
                     /locus_tag="CNE_1c00940"
                     /note="Catalytic cysteine-containing C-terminus of GTPase,
                     MnmE; Region: GTPase_Cys_C; pfam12631"
                     /db_xref="CDD:257176"
     gene            complement(95920..96906)
                     /locus_tag="CNE_1c00950"
                     /db_xref="GeneID:10916486"
     CDS             complement(95920..96906)
                     /locus_tag="CNE_1c00950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683945.1"
                     /db_xref="GI:339324252"
                     /db_xref="GeneID:10916486"
                     /translation="MSGHCITGMCALQREGTGLSTIHAPFTPRRSGPACCRLHWKHPR
                     PACAPERMQPAMIADAHPPTLHRKTRPAAAFAALTQASLARMEASLAQLLHRDEAEDL
                     HALRVAVRHARAVLWALGPSLPRQERDRWKHDLRMLARATSDVRDWDVFLAETIAPAR
                     KLEPDDTVLSAIADTARERRDTARQTMLSALAGYRDWPLPALHRDLAHLDHLAARARS
                     DGGRLGPLARKRVRRGRKRLRALAKAARRGNPRAVHELRIAGKRLRYVIEAFAPVLPS
                     RYSKDLHRKLVKRQAKLGRFVDGIVARRLLADCLQAQAMPDEAPPQPLPGAS"
     misc_feature    complement(95983..96660)
                     /locus_tag="CNE_1c00950"
                     /note="CHAD domain; Region: CHAD; pfam05235"
                     /db_xref="CDD:253109"
     gene            96916..97353
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /db_xref="GeneID:10916487"
     CDS             96916..97353
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylacetic acid degradation protein PaaI"
                     /protein_id="YP_004683946.1"
                     /db_xref="GI:339324253"
                     /db_xref="GeneID:10916487"
                     /translation="MTTEQERLLLRDTIEAGFRQTAFVNDVGISLADCGPGWCESTLA
                     ITPRHLQHGGIVHAGVQATMADHTAGAAASTILEAGQHVVTAEFKINLLRAVRSERLR
                     CRADVLKSGRAIIVVEADVFADVHGESVLVSRLNATMSVLDLA"
     misc_feature    96997..97338
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    97051..>97287
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    order(97081..97083,97168..97170,97189..97200)
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(97084..97086,97090..97092,97099..97101,97171..97185,
                     97189..97191)
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(97087..97089,97111..97116,97123..97128,97168..97170)
                     /gene="paaI1"
                     /locus_tag="CNE_1c00960"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            97385..97771
                     /locus_tag="CNE_1c00970"
                     /db_xref="GeneID:10916488"
     CDS             97385..97771
                     /locus_tag="CNE_1c00970"
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase"
                     /protein_id="YP_004683947.1"
                     /db_xref="GI:339324254"
                     /db_xref="GeneID:10916488"
                     /translation="MIDHTGVSVSDYGKSRAFYQAALGAIGYVLDKEFSASVTGSTDV
                     AGFGPPGQPDFWIHRGTPNQPPLHVAFRVDSRETVDAFYRAALAAGGRDNGAPGIRAH
                     YHSDYYGAFVLDPDGHNIEAVCHKPA"
     misc_feature    97388..97756
                     /locus_tag="CNE_1c00970"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_19; cd07262"
                     /db_xref="CDD:176683"
     gene            complement(97776..98546)
                     /gene="tam"
                     /locus_tag="CNE_1c00980"
                     /db_xref="GeneID:10916489"
     CDS             complement(97776..98546)
                     /gene="tam"
                     /locus_tag="CNE_1c00980"
                     /EC_number="2.1.1.144"
                     /codon_start=1
                     /transl_table=11
                     /product="trans-aconitate 2-methyltransferase Tam"
                     /protein_id="YP_004683948.1"
                     /db_xref="GI:339324255"
                     /db_xref="GeneID:10916489"
                     /translation="MSWSAHQYVAFEDERTRPVRDLVAAIPNQTARSAVDIGCGPGNS
                     TEVLLARYAGASVTGLDSSQDMVDAARKRLPDVQFRVADIGAWDEAGPYDVILANAVL
                     QWLPDHASLFPALVSRLAPGGTLAVQMPDNLEEPAHRLMRQVAADGPWAEKLAGASKA
                     RAERAPAQWYYELLRPLCQRVDVWLTTYHHPLAGGPAAVVEWFKGSGLRPFLQPLDEA
                     ERAAYLARYEAEIAKAYPALPDGSVLLPFPRLFIVATR"
     misc_feature    complement(97779..98546)
                     /gene="tam"
                     /locus_tag="CNE_1c00980"
                     /note="Trans-aconitate methyltransferase [General function
                     prediction only]; Region: Tam; COG4106"
                     /db_xref="CDD:226591"
     misc_feature    complement(98163..98444)
                     /gene="tam"
                     /locus_tag="CNE_1c00980"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(98250..98252,98295..98303,98361..98366,
                     98418..98438))
                     /gene="tam"
                     /locus_tag="CNE_1c00980"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(98631..100088)
                     /gene="gatB"
                     /locus_tag="CNE_1c00990"
                     /db_xref="GeneID:10916490"
     CDS             complement(98631..100088)
                     /gene="gatB"
                     /locus_tag="CNE_1c00990"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="YP_004683949.1"
                     /db_xref="GI:339324256"
                     /db_xref="GeneID:10916490"
                     /translation="MQWEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLAL
                     PGVLPVLNKGAVERAIQFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
                     GTISIQVEGKKGEFYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVT
                     EPDMRSAAEAVAYAKTLHSLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRREI
                     KNLNSFRFLQQAIEYEVQWQIAEIEDGRKIQQATVLFDPDTGETRAMRTKEDAHDYRY
                     FPDPDLMPLEIDAGWVDRVRGELPELPAAMQARFVSQYGLSAYDATTLTATKAFAAYY
                     EAVVADAGAANAKPAANWLMGDVASQLNREGIAIDAAPVTPAQLAKLLTRIADGTVSN
                     NTAKKDVFPAMWAGEHGGDADAIIAAKGLKQMSDSGELEKIIDDVLAANAKSVEEFRA
                     GKEKAFNALVGQAMKATKGKANPAQVNELLKKKLG"
     misc_feature    complement(98637..100088)
                     /gene="gatB"
                     /locus_tag="CNE_1c00990"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit B;
                     Validated; Region: gatB; PRK05477"
                     /db_xref="CDD:235489"
     misc_feature    complement(99204..100079)
                     /gene="gatB"
                     /locus_tag="CNE_1c00990"
                     /note="GatB/GatE catalytic domain; Region: GatB_N;
                     pfam02934"
                     /db_xref="CDD:251629"
     misc_feature    complement(98637..99092)
                     /gene="gatB"
                     /locus_tag="CNE_1c00990"
                     /note="GatB domain; Region: GatB_Yqey; smart00845"
                     /db_xref="CDD:197913"
     gene            complement(100179..101270)
                     /locus_tag="CNE_1c01000"
                     /db_xref="GeneID:10916491"
     CDS             complement(100179..101270)
                     /locus_tag="CNE_1c01000"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="YP_004683950.1"
                     /db_xref="GI:339324257"
                     /db_xref="GeneID:10916491"
                     /translation="MTHAPATPQRSLCAARPAVAVLRAVVALGLGAWLAGASAHTPDL
                     PAPALAQPAPLTPAGVLAPNAVSRAAPGSAATASVPAQRVELRGDAATPALTAYWFLP
                     REGTSQRALPVVVALHGCGGLLSARPSRASAAGAAGTDKADVSGMLQQRYREYAHWLT
                     ERGYAVLMPDSFSARGRPHGICSDPIDTRGIDDRTRRADALAALRWVAQQPAVDTARI
                     VLLGWSNGAQAVLATVDASRPWPAGTPQVERAVAFYPGCKRAVQQHNYRLRAPMLLMI
                     GGADDWTPATRCAMLQSAVLARQPGARFRLEIYPGAYHGFDGTSELHMRGDVPAGMRK
                     TQGVTVGGDAVARVAALAQLDSWLASPDP"
     misc_feature    complement(100194..101033)
                     /locus_tag="CNE_1c01000"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     misc_feature    complement(100323..100799)
                     /locus_tag="CNE_1c01000"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(101288..101773)
                     /locus_tag="CNE_1c01010"
                     /db_xref="GeneID:10916492"
     CDS             complement(101288..101773)
                     /locus_tag="CNE_1c01010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683951.1"
                     /db_xref="GI:339324258"
                     /db_xref="GeneID:10916492"
                     /translation="MNMTARSSLTLRLMAAAALAAAVAGCIPLPGGLGRPAPPAPIAS
                     RDIDLAGDCRRTEEDGFREDAQLRVSNNSVQQLSWKLWVGKRGSCSFNLADFRQVQKK
                     PHIELRANDGSGCKLMVWQDPRRVTLAHANCQQRCTPGIYEEAWPVMFEPGSGACART
                     R"
     gene            complement(101770..103275)
                     /gene="gatA1"
                     /locus_tag="CNE_1c01020"
                     /db_xref="GeneID:10916493"
     CDS             complement(101770..103275)
                     /gene="gatA1"
                     /locus_tag="CNE_1c01020"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="YP_004683952.1"
                     /db_xref="GI:339324259"
                     /db_xref="GeneID:10916493"
                     /translation="MPFSADSVTSLRQLADALAARSVSAEELAREYLARIEQAAALNA
                     FIHVDAERTLAQARAADERRARGEAAPLTGVPIAHKDVFVTRGWRATAGSKMLGNYES
                     PFDATVVERMGAAGMVTLGKTNMDEFAMGSSNENSHFGPVRNPWDTSRVPGGSSGGSA
                     AAVAAGLAPAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQAGPMA
                     HSAEDCALLLNAMAGFDPRDSTSITPAQGGVDEDYTRLLGQPLAGATAERPLAGLRIG
                     LPKEYFGKGLSADVEQAVRAALAEYEKLGATLVEVTLPKTELSIPVYYVIAPAEASSN
                     LSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGAEVKRRIMVGTYVLSHGYYDAYYLQA
                     QKIRRIIADDFQRAFAQCDVIMGPVAPTVAWKLGEKTSDPVQMYLADIFTLSTSLAGL
                     PGMSVPCGFGEAGMPVGLQLIGNYFDEARLLQTAHAFQQATDWHLRRPGKA"
     misc_feature    complement(101812..103224)
                     /gene="gatA1"
                     /locus_tag="CNE_1c01020"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit A;
                     Reviewed; Region: gatA; PRK00012"
                     /db_xref="CDD:234572"
     gene            complement(103367..103726)
                     /gene="gatC1"
                     /locus_tag="CNE_1c01030"
                     /db_xref="GeneID:10916494"
     CDS             complement(103367..103726)
                     /gene="gatC1"
                     /locus_tag="CNE_1c01030"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     C"
                     /protein_id="YP_004683953.1"
                     /db_xref="GI:339324260"
                     /db_xref="GeneID:10916494"
                     /translation="MSQPPAQPAPPASEHPNHHAMALALSDVKRIAHLARIETSDDEA
                     AQTLAQLNNFFSLVEQMQAVDTTGIEPLAHPLSAVRDMVQRLREDVVTESDRRADYQR
                     PAPATEDGLYLVPKVIE"
     misc_feature    complement(103370..103666)
                     /gene="gatC1"
                     /locus_tag="CNE_1c01030"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit C;
                     Reviewed; Region: gatC; PRK00034"
                     /db_xref="CDD:178810"
     gene            104269..105312
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /db_xref="GeneID:10916495"
     CDS             104269..105312
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /codon_start=1
                     /transl_table=11
                     /product="Rod shape-determining protein MreB"
                     /protein_id="YP_004683954.1"
                     /db_xref="GI:339324261"
                     /db_xref="GeneID:10916495"
                     /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRDKGIVLDEPSVVAIRQE
                     GGPNAKKTITAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHDS
                     KLLRPSPRIIICVPCGSTQVERRAIRESALGAGASQVYLIEEPMSAAIGAGLPVSEPS
                     GSMVVDIGGGTTEVGIISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEA
                     IKKEIGSAFPGSEVREMEVKGRNLSEGIPRAFTVSSNEILEALTDPLNQIVSAVKIAL
                     EQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMAL
                     ERMDKLGSIFSYE"
     misc_feature    104284..105306
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="rod shape-determining protein MreB; Provisional;
                     Region: PRK13927"
                     /db_xref="CDD:237562"
     misc_feature    104305..105282
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="MreB and similar proteins; Region: MreB_like;
                     cd10225"
                     /db_xref="CDD:212668"
     misc_feature    order(104314..104316,104320..104331,104506..104508,
                     104698..104700,104764..104766,104770..104781,
                     104842..104847,104917..104919,104926..104931,
                     105154..105162,105166..105171,105235..105237,
                     105244..105246)
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212668"
     misc_feature    order(104314..104316,104764..104766)
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(104392..104394,104455..104457,104479..104481,
                     104743..104745,104749..104751,104809..104811,
                     104905..104907,104911..104913,104980..104982,
                     105004..105006,105013..105015,105103..105105,
                     105112..105114,105208..105210,105280..105282)
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="putative protofilament interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(104725..104730,104752..104754,105130..105138,
                     105211..105213,105217..105219,105226..105228)
                     /gene="mreB"
                     /locus_tag="CNE_1c01040"
                     /note="RodZ interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212668"
     gene            105509..106474
                     /gene="mreC"
                     /locus_tag="CNE_1c01050"
                     /db_xref="GeneID:10916496"
     CDS             105509..106474
                     /gene="mreC"
                     /locus_tag="CNE_1c01050"
                     /codon_start=1
                     /transl_table=11
                     /product="Rod shape-determining protein MreC"
                     /protein_id="YP_004683955.1"
                     /db_xref="GI:339324262"
                     /db_xref="GeneID:10916496"
                     /translation="MDYSPPPLFKQGTSAVARLVLYVTIALALLVVDARFDALSVGRQ
                     VAATVLMPVERLVLTPRDALRTMFDYAQSSAMLATENRELRQNAVQQAQAAVRQAQLE
                     SENNQLRKLLGLAQQSATPVTAAEILYDARDPYSQRIVIDKGSQHGLRAGYPVIDERG
                     VVGQVTRVSPFQSEVTLLTDKDQAIPVQVVRNGLRSVAFGGARAGQLDLRFMAAAADL
                     QQGDLLVTSGLDGTYPPGLPVAKIIHIERKADTAFSRVYCEPVAGVRAHRQLLVVRYD
                     AAIPARETVEAKPEAPVRGAKSAAARAAADSAAAAKAAPAKEAPR"
     misc_feature    105524..106336
                     /gene="mreC"
                     /locus_tag="CNE_1c01050"
                     /note="rod shape-determining protein MreC; Provisional;
                     Region: PRK13922"
                     /db_xref="CDD:237560"
     gene            106471..106983
                     /gene="mreD"
                     /locus_tag="CNE_1c01060"
                     /db_xref="GeneID:10916497"
     CDS             106471..106983
                     /gene="mreD"
                     /locus_tag="CNE_1c01060"
                     /codon_start=1
                     /transl_table=11
                     /product="Rod shape-determining protein MreD"
                     /protein_id="YP_004683956.1"
                     /db_xref="GI:339324263"
                     /db_xref="GeneID:10916497"
                     /translation="MTNPQYLLRPVNPAFIAFSFVLAFLFNLMPWGTTLWVPDMVALV
                     LVFWNIHQPRKVGMGVAFLLGLLMDVHDARLLGEHALAYTLLAYFAITIHRRVLWFTV
                     YTQALHVLPLLFIVHAVPVLIRLAMGAPLPGWPLLLAPAIEALLWPLATSLLLAPQRR
                     SSDVDETRPI"
     misc_feature    106489..106974
                     /gene="mreD"
                     /locus_tag="CNE_1c01060"
                     /note="Cell shape-determining protein [Cell envelope
                     biogenesis, outer membrane]; Region: MreD; COG2891"
                     /db_xref="CDD:225444"
     gene            107037..109340
                     /gene="mrdA"
                     /locus_tag="CNE_1c01070"
                     /db_xref="GeneID:10916498"
     CDS             107037..109340
                     /gene="mrdA"
                     /locus_tag="CNE_1c01070"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein MrdA"
                     /protein_id="YP_004683957.1"
                     /db_xref="GI:339324264"
                     /db_xref="GeneID:10916498"
                     /translation="MTEIRNVELEIGRFRIRVAAAALFTVICFGLLFTRFLWLQWYKH
                     DQYSAKAEDNRISVAPIEPNRGIIMDRNGLVLARNYSAYTLEITPSKLTDTLDNTIES
                     LSGLVDIQPRDRRRFKRLMEESRSFESLPIRSQLTDEEVARFSAQRFRFPGVDVRARL
                     FRQYPLGESASHVIGYLGRISQRDQERIEAMDEANDAEGAKYDPRKDADNYKGTNYIG
                     KIGLEQSYESELHGLTGFEEVEVSAGGRPIRTLSTSPATPGNNLILSLDIRLQQLAEA
                     LYGDRRGALVAIEPATGDILAFVSKPTYDPNLFVEGIDTNTWNELNNSPDKPLLNRPL
                     RGTYPPGSTYKPFMALAALTTGKRTAAWGMHDPGFFTLGNHTFRDDKPGGHGWVDMHS
                     SIVQSCDTYYYALARDMGVNGIHDFMKPLGFGQITGIDIEGESRGILPSTDWKRRAYR
                     KPEQQKWYDGETISLGIGQGYNSFTILQLAQATSVIVNNGSVMKPHLVKAVEDAVTRK
                     RTLTVPKESYRIPLKQADIDVIKRAMVAVTHSGTAARVFAGAAYESAGKTGTAQTYSL
                     GKGEKYNHHALDERKRDHSLYTAFAPADNPRIAIALIVENAGFGAAVAAPIARKVMDY
                     YLTGKWPAELEAIAPPEAERMAGRPPVATPSVFTTGQTASIASATVMSGGSAPASGAA
                     ASAVAAASGAHAAASDAIAAALDPAAIAPASAVQTLDERMLQALGHSKPKVPPASVPV
                     VPAKAPAPKPRVKPVAAKAASGADATR"
     misc_feature    107085..108920
                     /gene="mrdA"
                     /locus_tag="CNE_1c01070"
                     /note="penicillin-binding protein 2; Region: pbp2_mrdA;
                     TIGR03423"
                     /db_xref="CDD:234204"
     misc_feature    107217..107792
                     /gene="mrdA"
                     /locus_tag="CNE_1c01070"
                     /note="Penicillin-binding Protein dimerization domain;
                     Region: PBP_dimer; pfam03717"
                     /db_xref="CDD:252119"
     misc_feature    107883..108905
                     /gene="mrdA"
                     /locus_tag="CNE_1c01070"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     gene            109352..110494
                     /gene="mrdB"
                     /locus_tag="CNE_1c01080"
                     /db_xref="GeneID:10916499"
     CDS             109352..110494
                     /gene="mrdB"
                     /locus_tag="CNE_1c01080"
                     /codon_start=1
                     /transl_table=11
                     /product="Rod shape-determining protein rodA"
                     /protein_id="YP_004683958.1"
                     /db_xref="GI:339324265"
                     /db_xref="GeneID:10916499"
                     /translation="MDRRRVLSLIKTALTGFDKPLSLIVFLLFATGIVALYSAAIDMP
                     GRVEDQLRNILLSYVVMMVIAYLPTQTLMRVAVPIYTVGVALLIAVAMFGLIRKGARR
                     WLYVGMVIQPSEIMKISMPLMLAWYFQKREGVVKWFDFVVALVLLLIPVGLIAKQPDL
                     GTALLVMAAGVYVIYFAGLSWKLILPLLGLLVVAVTLLITFQNDMCAPGVNWPVLHDY
                     QQHRICTLLDPTSDPLGKGFHTIQSIIAIGSGGVEGKGWLKGTQTHLEFIPEKHTDFI
                     FAVYSEEFGLIGNAVLLVLYLLLIFRGLFIAANAPTLFSRLLAGSITLIFFTYAFVNM
                     GMVSGILPVVGVPLPLMSYGGTALVTLGAGIGILMSISRQKRLIQT"
     misc_feature    109403..110479
                     /gene="mrdB"
                     /locus_tag="CNE_1c01080"
                     /note="rod shape-determining protein RodA; Region:
                     rodA_shape; TIGR02210"
                     /db_xref="CDD:233780"
     gene            110553..111239
                     /locus_tag="CNE_1c01090"
                     /db_xref="GeneID:10916500"
     CDS             110553..111239
                     /locus_tag="CNE_1c01090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683959.1"
                     /db_xref="GI:339324266"
                     /db_xref="GeneID:10916500"
                     /translation="MNAQDVAAYLQSHPEFFEEHAELLAAVQLTSPHSHRAVSLQERQ
                     MEILREKNKGLELRLADLVRHGHDNDRTQQRMHAWQLRLLAEADSHALPYAVQDGLQQ
                     VFDVPAVALRLWDVAEQYVHMEVAQGASEDLRIFAEGLRAPYCGSNGGFEAAGLLERD
                     DITSLAMVTLRVPVRAGDAEAGADVRGAAFGLLVLGSPDPRRFHEGMGTAYLSQIGEV
                     AGAALHRLRD"
     misc_feature    110553..111236
                     /locus_tag="CNE_1c01090"
                     /note="Protein of unknown function, DUF484; Region:
                     DUF484; cl17449"
                     /db_xref="CDD:248003"
     gene            111265..112344
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /db_xref="GeneID:10916501"
     CDS             111265..112344
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="YP_004683960.1"
                     /db_xref="GI:339324267"
                     /db_xref="GeneID:10916501"
                     /translation="MTARRPPRSVVADVAPASDTPPPAPEPLVTRYLDWLRGSRKLAE
                     HTLTSYSRDLRVLQGHAARYAPGVALLALQTHHIRNFAARLHGAGLVGTSIARTLSAW
                     RGFFQWAARHGHGVTVNPVDGVRAPRSGHALPKALSVEHAVALVAHPAGTDAQALRDH
                     AVYELFYSSGLRLSELVQLDLRYADADGYRSSGWLDLAGAEVTVTGKGSRQRSVPVGS
                     KAVEALRAWLAVRDTLLRPGALPEDAHALFLGPRGRRLSMRTVQLRLKQQALRAGVPA
                     DVHPHMLRHSFATHVLQSSGDLRAVQEMLGHASISTTQVYTALDFQHLAKVYDKAHPR
                     AGRARARPAADAAADPADADEASED"
     misc_feature    111328..112254
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    111349..112248
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(111778..111783,111883..111885,112099..112107,
                     112210..112212)
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(111778..111780,111883..111885,112105..112107,
                     112114..112116,112183..112185,112210..112212)
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(111778..111780,112105..112107,112114..112116,
                     112183..112185,112210..112212)
                     /gene="xerC"
                     /locus_tag="CNE_1c01100"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(112346..113302)
                     /locus_tag="CNE_1c01110"
                     /db_xref="GeneID:10916502"
     CDS             complement(112346..113302)
                     /locus_tag="CNE_1c01110"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004683961.1"
                     /db_xref="GI:339324268"
                     /db_xref="GeneID:10916502"
                     /translation="MAWKSAWEKDLPRGWHRELPRLPALTALRAFEAAARHESFSRAA
                     TELFVTHGAVSHQIRALEEELGMPLFERHGKRVALTPSGRLYAERVRDALLQIADATR
                     ALQAGNRDKRLTISTMPSFAARWLTPRIGSFIERHPELDVELLSSNTLVNFAHEEVDI
                     ALRMGSGDYPGLYVERLLDDVFFPVCSPGFNGGRLPERPQDMAGLPLLRGEGDPWKPW
                     FEAAGLDWPEPRKGLLLEDSSLLLQAASEGQGIALIRSSLAYNDLLAGRVVRLFDVSI
                     ACPWLLYFVCAPGSLNLPKVQAFRGWLLPEIERFREVLAQWE"
     misc_feature    complement(112367..113248)
                     /locus_tag="CNE_1c01110"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    complement(113051..113230)
                     /locus_tag="CNE_1c01110"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(112394..112969)
                     /locus_tag="CNE_1c01110"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(112865..112885,112889..112942,
                     112946..112969))
                     /locus_tag="CNE_1c01110"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(112529..112531,112589..112597,
                     112940..112942,112946..112951))
                     /locus_tag="CNE_1c01110"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            113551..113919
                     /locus_tag="CNE_1c01120"
                     /db_xref="GeneID:10916503"
     CDS             113551..113919
                     /locus_tag="CNE_1c01120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683962.1"
                     /db_xref="GI:339324269"
                     /db_xref="GeneID:10916503"
                     /translation="MKTVLTTTVFTLNPGEVTTLSVHAAQRLHVEEARGTDVWLTREK
                     DSEDYWLRCGGSLLLRSGDEVVLSVDPRALHPVRLALIAEARRPALALADVPHLVYRS
                     LRRLVRGTEWTPNQDQVTAS"
     misc_feature    113590..113769
                     /locus_tag="CNE_1c01120"
                     /note="Protein of unknown function (DUF2917); Region:
                     DUF2917; pfam11142"
                     /db_xref="CDD:151586"
     gene            114091..114846
                     /gene="lipB"
                     /locus_tag="CNE_1c01130"
                     /db_xref="GeneID:10916504"
     CDS             114091..114846
                     /gene="lipB"
                     /locus_tag="CNE_1c01130"
                     /EC_number="2.3.1.181"
                     /codon_start=1
                     /transl_table=11
                     /product="octanoyltransferase LipB"
                     /protein_id="YP_004683963.1"
                     /db_xref="GI:339324270"
                     /db_xref="GeneID:10916504"
                     /translation="MHPIQVIERGREDYQPCFDAMRAFTAARTPETPDQVWLVEHPPV
                     YTLGQAGDPAHLLAPDDQIPVVQIDRGGQITYHGPGQVVAYLLLDLRRRRLMVRELVH
                     SIEQAVLDTLAAYNLAAERKPGAPGIYLSDGPHQGAKIAALGLKIRNGCSYHGVSLNV
                     QMDLSPFLRINPCGYAGLETVDMASAGATFAAADANGDPLPVTAAQQPEIAQRLAAAL
                     CEVLAAHEARALAAEGTAAPAEAKQPGETALAS"
     misc_feature    114091..114834
                     /gene="lipB"
                     /locus_tag="CNE_1c01130"
                     /note="lipoate-protein ligase B; Provisional; Region:
                     PRK14343"
                     /db_xref="CDD:237682"
     gene            114887..115882
                     /gene="lipA1"
                     /locus_tag="CNE_1c01140"
                     /db_xref="GeneID:10916505"
     CDS             114887..115882
                     /gene="lipA1"
                     /locus_tag="CNE_1c01140"
                     /EC_number="2.8.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase LipA"
                     /protein_id="YP_004683964.1"
                     /db_xref="GI:339324271"
                     /db_xref="GeneID:10916505"
                     /translation="MSDALIATSSEAPQSPAEQYDPTRKQKSADKTARIPIKIVPAEK
                     LKKPDWIRVKAATGSSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGD
                     KCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYV
                     DCISQTRELSPITRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPG
                     ADYAHSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYL
                     APSNHHLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA"
     misc_feature    115007..115879
                     /gene="lipA1"
                     /locus_tag="CNE_1c01140"
                     /note="lipoyl synthase; Provisional; Region: PRK05481"
                     /db_xref="CDD:235493"
     misc_feature    115196..115789
                     /gene="lipA1"
                     /locus_tag="CNE_1c01140"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(115196..115198,115202..115204,115208..115210,
                     115214..115219,115229..115231,115322..115324,
                     115328..115333,115412..115420,115496..115498,
                     115619..115621,115706..115711)
                     /gene="lipA1"
                     /locus_tag="CNE_1c01140"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            116124..116771
                     /locus_tag="CNE_1c01150"
                     /db_xref="GeneID:10916506"
     CDS             116124..116771
                     /locus_tag="CNE_1c01150"
                     /EC_number="3.5.1.54"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase subunit 1"
                     /protein_id="YP_004683965.1"
                     /db_xref="GI:339324272"
                     /db_xref="GeneID:10916506"
                     /translation="MNCTVHRLAEQALLYSVAPPASLGVQRRIWAMAARAADWRGVVD
                     VVPGMNNLTVIFDGSADVDALERNLKLAWASGEARNATGKLVEIPVRYGGEHGPDLGD
                     VAAHTGLTPQEVVRRHAAGEYVVYFLGFQPGFAYMGGLAPELATPRRREPRVAVPAGS
                     VGIGGEQTGIYPAVLPGGWQLIGRTDAELFVADRDPPSLFAPGDTVRFVAEEVIA"
     misc_feature    116136..116762
                     /locus_tag="CNE_1c01150"
                     /note="Allophanate hydrolase subunit 1 [Amino acid
                     transport and metabolism]; Region: DUR1; COG2049"
                     /db_xref="CDD:224960"
     gene            116768..117787
                     /locus_tag="CNE_1c01160"
                     /db_xref="GeneID:10916507"
     CDS             116768..117787
                     /locus_tag="CNE_1c01160"
                     /EC_number="3.5.1.54"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase subunit 2"
                     /protein_id="YP_004683966.1"
                     /db_xref="GI:339324273"
                     /db_xref="GeneID:10916507"
                     /translation="MIEIIRPGALASVQDLGRTGFRRFGVGRCGAMDMLAVEVGNRLL
                     GNAPGCAAIEFTLGRAALRFHADMRVALAGAECGANLDGVPVWSWHAFDVHKGETLTL
                     PSTRGGTRVYLCVAGGIDVEPVMGSRSTDLKSGFGGLGGRALQEGDRLPAGRPGLVAE
                     TDWIGVQAPAWALPASIEGKATPVRMLPGPEYEDFDAASQAALWQADWTVTPNSNRMG
                     LRLNGPALARRAERSADLLSHGVVPGVMQVPPGGQPIALMADAQTTGGYPKIGVVIGA
                     DLWRLAQVPLGAPVRFVQVTLAQAEAAQAELERYLRQIDQALRWQGDGMPIGARRRAH
                     TRVAA"
     misc_feature    116771..117730
                     /locus_tag="CNE_1c01160"
                     /note="Allophanate hydrolase subunit 2 [Amino acid
                     transport and metabolism]; Region: DUR1; COG1984"
                     /db_xref="CDD:224895"
     gene            117843..118583
                     /gene="lamB1"
                     /locus_tag="CNE_1c01170"
                     /db_xref="GeneID:10916508"
     CDS             117843..118583
                     /gene="lamB1"
                     /locus_tag="CNE_1c01170"
                     /codon_start=1
                     /transl_table=11
                     /product="lactam utilization protein LamB"
                     /protein_id="YP_004683967.1"
                     /db_xref="GI:339324274"
                     /db_xref="GeneID:10916508"
                     /translation="MHIDLNADLGEGCDNDEALLALISSANIACGWHAGDAATMVRTV
                     KWALERGVAIGAHPSYPDRENFGRTEMQRDPEHVYADVLYQIGALDAIVRAQGGELHH
                     VKPHGALYNQAVRDPALARAIVRAVRDVDADLVFFGLAGSQMIDIAKEAGLRVKQEVF
                     ADRGYNPDGTLVKRGTPGALHEDEEVALNQTLTMVREKRVRAIDGSWVPIQAETVCLH
                     GDGAHALAFARRIRERLGAEGIAVRAGD"
     misc_feature    117849..118568
                     /gene="lamB1"
                     /locus_tag="CNE_1c01170"
                     /note="Escherichia coli putative lactam utilization
                     protein YbgL and similar proteins; Region:
                     LamB_YcsF_YbgL_like; cd10800"
                     /db_xref="CDD:212111"
     misc_feature    order(117864..117866,118011..118013,118044..118046,
                     118152..118154,118158..118163,118173..118175,
                     118320..118322,118329..118331,118353..118355,
                     118362..118364,118494..118496)
                     /gene="lamB1"
                     /locus_tag="CNE_1c01170"
                     /note="putative active site [active]"
                     /db_xref="CDD:212111"
     gene            118684..119412
                     /locus_tag="CNE_1c01180"
                     /db_xref="GeneID:10916509"
     CDS             118684..119412
                     /locus_tag="CNE_1c01180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683968.1"
                     /db_xref="GI:339324275"
                     /db_xref="GeneID:10916509"
                     /translation="MEQAVNLWPLVGVGVIIIGFVLRFNPMLVVVLAALATGLAAPMP
                     LMQIFSAIGTAFVKARNLPLIILLPLAVIGLLERHGLREHAQAWIARIASATVGRLLI
                     VYLGVRELTAAIGLTSLGGHPQMVRPLLAPMAEGAAENRFGHLPEPVRQRILAFCAAT
                     DNVGLFFGEDIFVAFGAIALMHTFLLSSNIDVEPLRIAVWGIPTAICAFLIHAVRLKR
                     LDRWLERELGGKAAAAAVPAKSAE"
     misc_feature    118696..119370
                     /locus_tag="CNE_1c01180"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3819"
                     /db_xref="CDD:226340"
     gene            119423..120373
                     /locus_tag="CNE_1c01190"
                     /db_xref="GeneID:10916510"
     CDS             119423..120373
                     /locus_tag="CNE_1c01190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683969.1"
                     /db_xref="GI:339324276"
                     /db_xref="GeneID:10916510"
                     /translation="MIISIEYLYWLAGLVLAITALMTFADREHPRRLSTGLFWLLYAI
                     VFLIGDRLPPAAVGIGAVVMALIAGFGGVGHGKHHSLPEEERRASARRLGNKLFIPAL
                     LIPLVTVIGTMLFKNVKIAGLPLLDPKNVTFVSLGIGCLISLAVVCWLTRDTVAQGLR
                     ESRRLTESLGWALVLPQMLAMLGLVFADAGVGKAVAHLSTAYINMDYKLVAVAVYCVG
                     MALFTVIMGNGFAAFPVMTGGVGVPILVGMFGGNPAVMAAIGMFSGYCGTLMTPMAAN
                     FNIVPAALLELDDKNAVIRAQVPTALAILVANIALLYFLM"
     misc_feature    119435..120370
                     /locus_tag="CNE_1c01190"
                     /note="Protein of unknown function (DUF979); Region:
                     DUF979; pfam06166"
                     /db_xref="CDD:191464"
     gene            120389..121039
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /db_xref="GeneID:10916511"
     CDS             120389..121039
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /EC_number="3.4.19.3"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrrolidone-carboxylate peptidase Pcp"
                     /protein_id="YP_004683970.1"
                     /db_xref="GI:339324277"
                     /db_xref="GeneID:10916511"
                     /translation="MRTVLLTGFEPFENEPINPSWEAVRALDGERVGDAVIVARQLPC
                     VFGAAIDTIGELVDVLRPALVIAVGQAGGRAEMSVERVAINVDDARIADNAGAQPIDT
                     AIVAGGPAAYFATLPIKAMVRDMRAAGVPASVSQTAGTFVCNHVFYGLMHRLAQQPDG
                     DVRGGFIHIPYLPEQAARHPGQPSLAQETLVKGLRAAVATALSTRADVREQGGQLH"
     misc_feature    120392..120979
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="Pyroglutamyl peptidase (PGP) type I, also known as
                     pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes
                     responsible for cleaving pyroglutamate (pGlu) from the
                     N-terminal end of specialized proteins. The N-terminal
                     pGlu protects these proteins from...; Region:
                     Peptidase_C15; cd00501"
                     /db_xref="CDD:238279"
     misc_feature    order(120413..120415,120422..120424,120518..120520,
                     120809..120817)
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238279"
     misc_feature    order(120608..120616,120764..120766,120773..120787,
                     120905..120910,120914..120916,120935..120940,
                     120944..120946)
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="AC domain interface; other site"
                     /db_xref="CDD:238279"
     misc_feature    order(120626..120628,120815..120817,120890..120892)
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238279"
     misc_feature    order(120629..120634,120644..120646,120650..120652,
                     120656..120658,120686..120691,120716..120727,
                     120743..120745,120794..120799,120806..120808)
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="AB domain interface; other site"
                     /db_xref="CDD:238279"
     misc_feature    120944..120946
                     /gene="pcp"
                     /locus_tag="CNE_1c01200"
                     /note="interchain disulfide; other site"
                     /db_xref="CDD:238279"
     gene            complement(121051..122301)
                     /locus_tag="CNE_1c01210"
                     /db_xref="GeneID:10916512"
     CDS             complement(121051..122301)
                     /locus_tag="CNE_1c01210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683971.1"
                     /db_xref="GI:339324278"
                     /db_xref="GeneID:10916512"
                     /translation="MEPAPPPPSAPPPAAQPTPEATGPQYSPLARVGLLCFTLLVVYA
                     SLYPFSGWVDNGVSPFAFLSAPKPRYITDFDLLTNVLGYFPFGALVVLSLHPRMSGGR
                     ATLVALVAGALLSACMEAFQTWLPSRISSNIDLITNALGALLGGAVVAPFTRALIDDG
                     RLTRLRHAWFEPHASFAIILLLLWPFAQVFPQEHLFGMGGIVREWLTDPESWPMQVLQ
                     MVFPQLEAWQDHIGLRPEDMQSQQLLESLVTASSWVGTGLFASIAMRRSAPMLRILAG
                     LLAAALLLKATAAELQFPSESAFVWLSEGGRFALLTSSLVLALLLYLPRWLRAVLAMV
                     ALIVLVVLTNVLPSNPYAWISEQGWRMGRFIHFNSLAQWLGWVWPFLAFCYVIWRFEQ
                     VSLRRHARKKAAARREAAAAGTQE"
     misc_feature    complement(121810..122229)
                     /locus_tag="CNE_1c01210"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5652"
                     /db_xref="CDD:227939"
     gene            complement(122321..123010)
                     /locus_tag="CNE_1c01220"
                     /db_xref="GeneID:10916513"
     CDS             complement(122321..123010)
                     /locus_tag="CNE_1c01220"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004683972.1"
                     /db_xref="GI:339324279"
                     /db_xref="GeneID:10916513"
                     /translation="MPPLTRYRQPRDTAVNPATEMPRFLRSARSRLQAALLLAAAGLA
                     LSGCALTRGNNPTVTYDLGPPAAATPGNGNPAPARLPKLRVAQTDGPNWLDGNALFYR
                     LQYAQAQRLQAYATQRWVMSPTRLFDERLREAVAARGTLSWFGDSSVPALKVDLIEFD
                     QVFDSATTSAGVVRMRATVFQQGMLGQQTFEARRPAASADGAGGVKALAEASDAVITA
                     LLDWIGTLQLK"
     misc_feature    complement(122366..122821)
                     /locus_tag="CNE_1c01220"
                     /note="Protein of unknown function (DUF330); Region:
                     DUF330; cl01135"
                     /db_xref="CDD:260806"
     gene            complement(123021..123962)
                     /locus_tag="CNE_1c01230"
                     /db_xref="GeneID:10916514"
     CDS             complement(123021..123962)
                     /locus_tag="CNE_1c01230"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004683973.1"
                     /db_xref="GI:339324280"
                     /db_xref="GeneID:10916514"
                     /translation="MMENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAVRVPYDLITR
                     ATVNGLQPQGDVKYRGLAVGKVESIKFDPQVPGQIIVRVNVNKDTPITRTTYGTLGFQ
                     GVTGIAYVQLDDSATHDGATASPPLPTSPKAVARIAMRPGFFEELEKRGDSLLTQVET
                     MMTSLNDMFQSANRTELMAAIHAVRKTAEDYSRLSDSLGPAANRLPKVTENLNATLES
                     TRRLTQELANPNGTVMRTVDSVGRDMQGAASSVQSAAGTFSEETLPQLNGLARDARQT
                     ARTFERAAGQFNESPSSVLFGAPAPAPGPGEPGFSAP"
     misc_feature    complement(<123126..123959)
                     /locus_tag="CNE_1c01230"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: Ttg2C; COG1463"
                     /db_xref="CDD:224380"
     misc_feature    complement(123624..123824)
                     /locus_tag="CNE_1c01230"
                     /note="mce related protein; Region: MCE; pfam02470"
                     /db_xref="CDD:251316"
     gene            complement(123959..124831)
                     /locus_tag="CNE_1c01240"
                     /db_xref="GeneID:10916515"
     CDS             complement(123959..124831)
                     /locus_tag="CNE_1c01240"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004683974.1"
                     /db_xref="GI:339324281"
                     /db_xref="GeneID:10916515"
                     /translation="MSAAQANATPDGKPGRKPDRKADRTPVIEVRDLVKRFGKAVVHD
                     HVNLDVYRDEVLSIVGGSGSGKTVLLRQIVGLERPTSGSIKVFGEDPTRLRPAQLQAL
                     RNRWGLQFQRGALFSALSVIDNIALPLRELRALPDNLICQAALLKLQLVGLSARDADK
                     MPADLSGGMIKRVALARALALEPELLFLDEPTAGLDPMASDDYVRLIRELRRELGLTV
                     VMITHDLDTLVALSDRVAVLADHKVIAAAPIPEVVKVDHPFIREYFLGERAQRAMQAL
                     PPHGQPDAAPPGEA"
     misc_feature    complement(123992..124768)
                     /locus_tag="CNE_1c01240"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, ATPase component [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: Ttg2A;
                     COG1127"
                     /db_xref="CDD:224052"
     misc_feature    complement(124043..124750)
                     /locus_tag="CNE_1c01240"
                     /note="ATP-binding cassette transport system involved in
                     resistant to organic solvents; Region:
                     ABC_Org_Solvent_Resistant; cd03261"
                     /db_xref="CDD:213228"
     misc_feature    complement(124631..124654)
                     /locus_tag="CNE_1c01240"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(order(124163..124165,124262..124267,
                     124499..124501,124628..124636,124640..124645))
                     /locus_tag="CNE_1c01240"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(124499..124510)
                     /locus_tag="CNE_1c01240"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(124310..124339)
                     /locus_tag="CNE_1c01240"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(124262..124279)
                     /locus_tag="CNE_1c01240"
                     /note="Walker B; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(124244..124255)
                     /locus_tag="CNE_1c01240"
                     /note="D-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    complement(124157..124177)
                     /locus_tag="CNE_1c01240"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213228"
     gene            complement(124828..125964)
                     /locus_tag="CNE_1c01250"
                     /db_xref="GeneID:10916516"
     CDS             complement(124828..125964)
                     /locus_tag="CNE_1c01250"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004683975.1"
                     /db_xref="GI:339324282"
                     /db_xref="GeneID:10916516"
                     /translation="MPLERQTTPDFHITRGDGTVSVALRGDWTALALAGCHQARQLRA
                     QLHELAQAPDSAQWSLAGVERLDHIGGQLLWQAWNGALPQRLDASEGQRRVFERIAAV
                     HDEGWKKHMVDRFNPVTLFGASVLSFGAQLGRGVSMLGQLTFDLLRFTRMPQRGPWRE
                     ISANIYNVGYKALGITALVGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGP
                     VLAAILIAGRSGSAITAQIGVMRVTEELDAMLVMGISHGFRLIMPRVIALAIAMPLLV
                     AWTDVMALAGGILAARWQLGISATFFLRELPDAVPVANLWLGLGKGVVFGILIALTAC
                     HFGLRIKPNTQSLGEGTTASVVTAITMVILADAVFAILFKDVGL"
     misc_feature    complement(124834..125619)
                     /locus_tag="CNE_1c01250"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: Ttg2B; COG0767"
                     /db_xref="CDD:223838"
     gene            126095..127018
                     /gene="birA"
                     /locus_tag="CNE_1c01260"
                     /db_xref="GeneID:10916517"
     CDS             126095..127018
                     /gene="birA"
                     /locus_tag="CNE_1c01260"
                     /EC_number="6.3.4.15"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-(acetyl-CoA carboxylase) ligase BirA"
                     /protein_id="YP_004683976.1"
                     /db_xref="GI:339324283"
                     /db_xref="GeneID:10916517"
                     /translation="MFSTIAIDPSPLPRMSAVPPTPSDPSAPSGANWRIDAGALRGML
                     SPALSDWTLELVEETGSTNADLTAACRQAPWSDAGRLRLAYRQTAGRGRQGRPWQGQA
                     GMTFSVALPLALAPAQLIGLSLAVGLALVEALGDVEAGLGARIGLKWPNDLQIDEREL
                     AGILIEAVPAGPQRVWAVIGIGLNLVRDAQMEAALGRELAGVAEAMPGFDAQRDAPRL
                     LAALLERLAAMRTAFLAHGFGPMARRWSAADAYRDQPVRLLHEGKVIAEGMARGVDEA
                     GHLLLETPAGLERIASGELSLRPAPGQGGTA"
     misc_feature    126149..127006
                     /gene="birA"
                     /locus_tag="CNE_1c01260"
                     /note="biotin--protein ligase; Provisional; Region:
                     PRK06955"
                     /db_xref="CDD:235896"
     misc_feature    126281..126646
                     /gene="birA"
                     /locus_tag="CNE_1c01260"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    126854..126988
                     /gene="birA"
                     /locus_tag="CNE_1c01260"
                     /note="Biotin protein ligase C terminal domain; Region:
                     BPL_C; pfam02237"
                     /db_xref="CDD:251174"
     gene            127015..127857
                     /gene="coaX"
                     /locus_tag="CNE_1c01270"
                     /db_xref="GeneID:10916518"
     CDS             127015..127857
                     /gene="coaX"
                     /locus_tag="CNE_1c01270"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase CoaX"
                     /protein_id="YP_004683977.1"
                     /db_xref="GI:339324284"
                     /db_xref="GeneID:10916518"
                     /translation="MSAPHLLIDIGNTRLKWAWCEAGAALPATGALPTPWQHGGAVAH
                     ADAGALQALAADLRALRGSGPMPSVWISNVAGPVIAAAVDAALAEAFGGCAPVQWVRS
                     TAAQGNLANGYREPTQLGVDRWVGAIGAHRWLPHDTLLVVTAGTATTLDIVTAAADGS
                     ARFEGGLILPGLALMLGTLARNTAQLPALDVDDAGTVAGAHLRWADNTHDAIAAGCLA
                     AQAGAIERTWRALGERGPARRPVRCLLSGGARGALAGALAVPFEMHDNLVLLGLHAMA
                     SAGA"
     misc_feature    127021..127854
                     /gene="coaX"
                     /locus_tag="CNE_1c01270"
                     /note="pantothenate kinase; Reviewed; Region: PRK13328"
                     /db_xref="CDD:237352"
     gene            127900..128625
                     /locus_tag="CNE_1c01280"
                     /db_xref="GeneID:10916519"
     CDS             127900..128625
                     /locus_tag="CNE_1c01280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683978.1"
                     /db_xref="GI:339324285"
                     /db_xref="GeneID:10916519"
                     /translation="MTAPGQPARPRSPRIVPLLLLLANAMLLGAVLGVFGANPLAGWF
                     ETPREPQRLRQQVRGERMRVQASPLAPASAPAADAVPRSALPSATLAACIEIGGFSAQ
                     AARRATEDLAAAALRVEAFARQEQVRWWVHLPAQPTREHAERKLAELRRRNVTEYSLV
                     TAGTPEATTYTVSLGLFRERERAEQYLDSLRGHGVRTAMLTEAARPLTRQWLRVRDAD
                     DAARARLEAMRQRYGAEDVLACS"
     misc_feature    128281..128484
                     /locus_tag="CNE_1c01280"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            complement(128641..129462)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /db_xref="GeneID:10916520"
     CDS             complement(128641..129462)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /EC_number="2.7.1.-"
                     /EC_number="2.7.7.-"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein HldE"
                     /protein_id="YP_004683979.1"
                     /db_xref="GI:339324286"
                     /db_xref="GeneID:10916520"
                     /translation="MLSRSGGKPMAGARSSNKLISENKIFKARDDYPDTQCAVNPALR
                     IHLIRGVMPRSSRRGSRPGRLSIRQAVRDGVTRAHRRRRSQEGVPSRASTPAPTRGWP
                     PLSDADPMSVPAFESKLTLPDTPAALAARIATLPRPLVFTNGVFDILHRGHATYLAQA
                     RALGASLVVGVNSDASVKMLGKGDDRPLNHESDRMALLAALESVDLVAMFREQTPVEL
                     IRLVRPDIYVKGGDYDIDTLEETRLVRSWGGQAYAIPFLHDRSTTKLLTRVRQGS"
     misc_feature    complement(128644..>129129)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="ADP-heptose synthase, bifunctional sugar
                     kinase/adenylyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaE; COG2870"
                     /db_xref="CDD:225425"
     misc_feature    complement(128650..129084)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="rfaE bifunctional protein, domain II; Region:
                     rfaE_dom_II; TIGR02199"
                     /db_xref="CDD:131254"
     misc_feature    complement(order(128671..128682,129004..129015))
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    complement(order(128677..128679,129004..129006,
                     129013..129015))
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    complement(129004..129015)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    complement(128671..128682)
                     /gene="hldE"
                     /locus_tag="CNE_1c01290"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            complement(129711..130574)
                     /locus_tag="CNE_1c01300"
                     /db_xref="GeneID:10916521"
     CDS             complement(129711..130574)
                     /locus_tag="CNE_1c01300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683980.1"
                     /db_xref="GI:339324287"
                     /db_xref="GeneID:10916521"
                     /translation="MLYPELFKSLEAVRWHMDKDIPWDTFDASMLTDDQAKTIRMNAI
                     TEWSALPATEMFLRDNRHDSDFSAFMSIWFFEEQKHSLVLMEYLRRFRPDLVPTEEEL
                     HAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYRTLSQDEARHGG
                     AYLRYMKKYLAQFGDSARAAFAKIGVLMASARRTEKPLHPTNLHVNKALFPNDTVQSR
                     LPDPDWLEHWLDEQIRFDEGWEKKVIERILHNMSLLFERTFETVQDLNRYRKELNASL
                     QGTGGAQPAQA"
     misc_feature    complement(<130023..130535)
                     /locus_tag="CNE_1c01300"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cl00264"
                     /db_xref="CDD:260311"
     misc_feature    complement(order(130101..130103,130110..130112,
                     130200..130202,130335..130337,130344..130346,
                     130437..130439))
                     /locus_tag="CNE_1c01300"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            complement(130775..132040)
                     /locus_tag="CNE_1c01310"
                     /db_xref="GeneID:10916522"
     CDS             complement(130775..132040)
                     /locus_tag="CNE_1c01310"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase alpha-beta hydrolase superfamily"
                     /protein_id="YP_004683981.1"
                     /db_xref="GI:339324288"
                     /db_xref="GeneID:10916522"
                     /translation="MHRESFPAPHPALQSGPNPAATALIMMGGGARAAYQAGVLSGLA
                     RIAARHGKGHGAMPFGIIAGTSAGAINGAGLAIQAGDFQAATQSLAALWHSIHADDVY
                     RTDVLRVGISGARWLSTLALGWATQRRAPRALFDNTPLGSMLGELFEPERVQASLDSG
                     ALQAFAVTALSYSTGRHVTFYQSHHRIHPWHRSQRIAIPAQITVDHLLASASIPFLFP
                     AMPLELDGHHEWFGDGTMRQMSPLSPAIHLGASRVLAIGAASRQRSGWYDTMPAGGYP
                     SLAQVGGQALASIFLDGLNADLERLLHINRLLARMPELAGDREGWRPVQVMTIAPSEP
                     IEAIAAEHQKQLPRTVRALLAPLGGTEARGAAFASYLLFEPAFTQALMALGERDAEAQ
                     ADELAAFLFGIVPGTPPAALPAGERALSP"
     misc_feature    complement(130874..131992)
                     /locus_tag="CNE_1c01310"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    complement(131225..131971)
                     /locus_tag="CNE_1c01310"
                     /note="Patatins and Phospholipases; Region:
                     Patatin_and_cPLA2; cl11396"
                     /db_xref="CDD:264349"
     misc_feature    complement(order(131342..131344,131843..131845,
                     131945..131947,131951..131956))
                     /locus_tag="CNE_1c01310"
                     /note="active site"
                     /db_xref="CDD:132836"
     misc_feature    complement(131837..131851)
                     /locus_tag="CNE_1c01310"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132836"
     gene            complement(132078..132875)
                     /locus_tag="CNE_1c01320"
                     /db_xref="GeneID:10916523"
     CDS             complement(132078..132875)
                     /locus_tag="CNE_1c01320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683982.1"
                     /db_xref="GI:339324289"
                     /db_xref="GeneID:10916523"
                     /translation="MFGQIPDFTNGFDFMRRLWGSGSGMPAGLMPGLQAMTPPMDLDD
                     LDKRIADLKAVESWLQLNTNLLRTTIQGLEVQRATLVALQTFGNALSPDAMQSAMENV
                     ARAANTPSAAAPERAAGADAGSGAQPEPPAAEQPQAAASDTDSALPPNAALWWDLLQQ
                     QFNQIASSAAAASIAPFGMGGFGAAAGPEAAAQAAAAKPKTGEPGKAASAGTGKPAAR
                     KAPAKKAPAKKAVKAKPAKDAGNGDDNGKNGGNSGGGGHGPNGSNAA"
     gene            complement(132950..133783)
                     /locus_tag="CNE_1c01330"
                     /db_xref="GeneID:10916524"
     CDS             complement(132950..133783)
                     /locus_tag="CNE_1c01330"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004683983.1"
                     /db_xref="GI:339324290"
                     /db_xref="GeneID:10916524"
                     /translation="MTTPTADSTPLSPRYERYRALTLRRHGPILEIIMGAAQSANQKL
                     ATADANMHRELAEIWRDVSADPEVRVALIRGEGKGFSAGGDLALVEDMANDFETRTRV
                     WHEARDLVYNVINCDKPVVSAMHGPAVGAGLVAGLLADISIAARTARIVDGHTRLGVA
                     AGDHAAIVWPLLCGMAKAKYYLMLCESVSGEEAERIGLVSLAVEEDELVARAFEVANR
                     LAAGSQTAIRWTKYALNNWLRMAGPAFDTSLALEFMGFAGPDVHEGVASLRQKRPPQF
                     R"
     misc_feature    complement(132956..133732)
                     /locus_tag="CNE_1c01330"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    complement(133127..133723)
                     /locus_tag="CNE_1c01330"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(133313..133315,133322..133327,
                     133391..133399,133403..133405,133526..133540,
                     133550..133552,133646..133648,133664..133666))
                     /locus_tag="CNE_1c01330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(133391..133393,133532..133534))
                     /locus_tag="CNE_1c01330"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(133127..133132,133139..133141,
                     133184..133186,133193..133195,133226..133228,
                     133235..133240,133244..133249,133253..133258,
                     133271..133276,133280..133288,133292..133294,
                     133310..133321,133355..133366,133427..133429,
                     133451..133453))
                     /locus_tag="CNE_1c01330"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(133905..134885)
                     /gene="mhpD1"
                     /locus_tag="CNE_1c01340"
                     /db_xref="GeneID:10916525"
     CDS             complement(133905..134885)
                     /gene="mhpD1"
                     /locus_tag="CNE_1c01340"
                     /EC_number="4.2.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxopent-4-enoate hydratase"
                     /protein_id="YP_004683984.1"
                     /db_xref="GI:339324291"
                     /db_xref="GeneID:10916525"
                     /translation="MKLATLKDGSRDGQLVVVSRDLKTAHYATDIAGKLQTVLDDWPF
                     YAPQLQDLYDALNAGRARHPFPFAPKDCMAPLPRAYQWADGSAYVNHVELVRKARGAE
                     MPPEFWTDPLMYQGGSDDFVGPQDDIVCASEAFGIDFEAEVAVITGDVRMGATPEQAG
                     EAIRLVMLANDVSLRNLIPAELGKGFGFFQSKPATAFSPVAVTPDELGEAWRERKVLL
                     PMTVHWNSKKVGQPDCGTDMVFDFGQLIAHICKTRNVRAGSIVGSGTISNVDRTKGYC
                     CIAEKRMLETIDEGKPVTEFMKFGDAVKIEMFDAQGHSVFGAIDQLVAPA"
     misc_feature    complement(134079..134876)
                     /gene="mhpD1"
                     /locus_tag="CNE_1c01340"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    complement(134067..134642)
                     /gene="mhpD1"
                     /locus_tag="CNE_1c01340"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            complement(134968..135966)
                     /locus_tag="CNE_1c01350"
                     /db_xref="GeneID:10916526"
     CDS             complement(134968..135966)
                     /locus_tag="CNE_1c01350"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004683985.1"
                     /db_xref="GI:339324292"
                     /db_xref="GeneID:10916526"
                     /translation="MRPLGYFRPALAALTAATLFAALFTASAPARADDWPSQPIRWVV
                     PYPAGGGTDVVARTVAQAITPGLGKQVVIDNRPGAATIVGADAVAHAKPDGYTVLTAD
                     TATLAANPSLYKKLPYNPDKDFVYIGQLARFPLVLVANPNFPARTLKEVVEYAQKNPG
                     KVNFASPGAGSPHHLAMELFMDQTRVKMTHVPYKGAAPAVQDLLAGQVDLMFLDLASG
                     QQNVQAGKLRALGVATPKRLTVLPSVPTVAEGGVAGFEAYAWQGMVAPAGTPKAVVTR
                     LNAELVKALKTPEVQKKLEGVGVEAVYSTPEEFASYARAEGERWGKLIKAKGITVD"
     misc_feature    complement(134980..135804)
                     /locus_tag="CNE_1c01350"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            136147..136980
                     /locus_tag="CNE_1c01360"
                     /db_xref="GeneID:10916527"
     CDS             136147..136980
                     /locus_tag="CNE_1c01360"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004683986.1"
                     /db_xref="GI:339324293"
                     /db_xref="GeneID:10916527"
                     /translation="MSEIEEEDTKLRSGIQSIEVGFRLLQALAVSPRAMMLRDLAAAA
                     GMNPAKAHRYLVSFMRLGAVAQDPVSGRYDLGPFALQLGLAGLNRLDPVKKARPILSQ
                     LRDELDLTAGIAVWGNHGPTVVHWEESSHPVTVSLRLGDVMPMLNSATGRLYGAYLPR
                     KQTLPLIERELGARGNDGVPDMPRSLADYDAICAEVRAHGAARTLGGVLPGINAFSMP
                     VFDANGHLAMGLIVLGAQSIFDAEWGGTMDRRIRDIAQQLSSELGYLGAATPAGETGQ
                     S"
     misc_feature    136189..136461
                     /locus_tag="CNE_1c01360"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    136192..136938
                     /locus_tag="CNE_1c01360"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    136540..>136818
                     /locus_tag="CNE_1c01360"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            137039..138034
                     /locus_tag="CNE_1c01370"
                     /db_xref="GeneID:10916528"
     CDS             137039..138034
                     /locus_tag="CNE_1c01370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683987.1"
                     /db_xref="GI:339324294"
                     /db_xref="GeneID:10916528"
                     /translation="MIALVLLVHVLAVVGFVRMPGPLIPMDVSSTPTLEAVLLPPPRP
                     PAPPAPRPMPRPRPQPRPAEQAPEAEPQEAPAPALATSPQGATEMASGSGGEGSAAKP
                     ATPAAAPSGGPQGGVDGVRYDPPPSATMHYASFVNGVQNPDGLIRWEQDGSRYRLAVE
                     TRVLWFRFAFQSGGAMAVQGLLPERYEERRRNKTESSRFDAAAGTAVLASGTQAQFPP
                     GAQDRFSVFLQLVGLVRGNPQRYVTPGVTETFLVADTRDVEPMQVQYVGEDEIDTGRG
                     VIRAKHFVRLQRRANDRRRVELWLAQSLGWMPVRLRQTEPDGTQIDLVYRGKEGQ"
     misc_feature    137411..138010
                     /locus_tag="CNE_1c01370"
                     /note="Protein of unknown function (DUF3108); Region:
                     DUF3108; pfam11306"
                     /db_xref="CDD:256405"
     gene            138086..138928
                     /gene="catD1"
                     /locus_tag="CNE_1c01380"
                     /db_xref="GeneID:10916529"
     CDS             138086..138928
                     /gene="catD1"
                     /locus_tag="CNE_1c01380"
                     /EC_number="3.1.1.24"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="YP_004683988.1"
                     /db_xref="GI:339324295"
                     /db_xref="GeneID:10916529"
                     /translation="MTVATPPVETHRIHAEGADLHVRVDGADGPWVILAHALAADHTL
                     WDATAQHLAGRYRVVRPDMRGHGASDAPLGPYTMTRLADDVVAVMDALQIPQAHFCGI
                     SVGGMIGQTMGLRHPERLLSLALVATNSQTPMEAHPMWHNRIGQAEAHGMAGMADATL
                     GRWLTPSFHEAHRDQVSRIRDRLVGTPVRGYVGVAEAIMAFDLAGALSRIHCPTLVVA
                     GEQDQGATVAMAQSIAAAIPGARLEVVPQAAHLVHVEQPERFHAALDAFLGNAACGGQ
                     CDVP"
     misc_feature    138143..138889
                     /gene="catD1"
                     /locus_tag="CNE_1c01380"
                     /note="3-oxoadipate enol-lactonase; Region: protocat_pcaD;
                     TIGR02427"
                     /db_xref="CDD:131480"
     misc_feature    138179..138889
                     /gene="catD1"
                     /locus_tag="CNE_1c01380"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            139154..139411
                     /locus_tag="CNE_1c01390"
                     /db_xref="GeneID:10916530"
     CDS             139154..139411
                     /locus_tag="CNE_1c01390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683989.1"
                     /db_xref="GI:339324296"
                     /db_xref="GeneID:10916530"
                     /translation="MQMIYNSDNYCIVEFGADVDQAPLEFGGYEIVDKNLKREIFLGG
                     HLAESFRADVKRLIESEPSVEEVDDFLGKFDNVMMHPLVMH"
     misc_feature    139154..139408
                     /locus_tag="CNE_1c01390"
                     /note="Protein of unknown function (DUF3567); Region:
                     DUF3567; pfam12091"
                     /db_xref="CDD:152526"
     gene            complement(139484..139876)
                     /gene="pspE1"
                     /locus_tag="CNE_1c01400"
                     /db_xref="GeneID:10916531"
     CDS             complement(139484..139876)
                     /gene="pspE1"
                     /locus_tag="CNE_1c01400"
                     /EC_number="2.8.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like sulfurtransferase PspE"
                     /protein_id="YP_004683990.1"
                     /db_xref="GI:339324297"
                     /db_xref="GeneID:10916531"
                     /translation="MQHLSPADAQDLLAQSPETLFIDCRSEMEYLFVGHPKGAHNVPW
                     NDGPDWEVNPHFVQMVKKLAGQASARPVLLICRSGNRSSAAARALEGAGFSNVQFVLH
                     GFEGDLDAQRHRNTVNGWRHDGLPWEQY"
     misc_feature    complement(139511..139867)
                     /gene="pspE1"
                     /locus_tag="CNE_1c01400"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily, subgroup 1. This CD includes the putative
                     rhodanese-related sulfurtransferases of several
                     uncharacterized proteins; Region: RHOD_1; cd01522"
                     /db_xref="CDD:238780"
     misc_feature    complement(139649..139651)
                     /gene="pspE1"
                     /locus_tag="CNE_1c01400"
                     /note="active site residue [active]"
                     /db_xref="CDD:238780"
     gene            140106..141167
                     /gene="metH1"
                     /locus_tag="CNE_1c01410"
                     /db_xref="GeneID:10916532"
     CDS             140106..141167
                     /gene="metH1"
                     /locus_tag="CNE_1c01410"
                     /EC_number="2.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydrofolate--homocysteine
                     methyltransferase"
                     /protein_id="YP_004683991.1"
                     /db_xref="GI:339324298"
                     /db_xref="GeneID:10916532"
                     /translation="MSAPESTAAAPRPYTRAAELPRLLQERILILDGAMGTMIQRYKL
                     TEADYRGARFAEHKVDVKGNNELLLLTRPQVISEIHEQYLAAGADLIETNTFGATRVA
                     QEDYKMADLAYEMNVEAARLARAACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPG
                     ARNVTFEELRDSYYEQGKGLLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERLP
                     VMISGTVTDASGRILSGQTVEAFWNSLRHARPITFGLNCALGATLMRPYIAELAKVCD
                     AAVSCYPNAGLPNPMSDTGFDETPEVTSSLVEEFAASGLVNLVGGCCGTTPEHIAAIA
                     ERVADKKPRTWPGQYRDAA"
     misc_feature    140142..141119
                     /gene="metH1"
                     /locus_tag="CNE_1c01410"
                     /note="Methionine synthase I (cobalamin-dependent),
                     methyltransferase domain [Amino acid transport and
                     metabolism]; Region: MetH; COG0646"
                     /db_xref="CDD:223719"
     gene            141185..143932
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /db_xref="GeneID:10916533"
     CDS             141185..143932
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /EC_number="2.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase MetH"
                     /protein_id="YP_004683992.1"
                     /db_xref="GI:339324299"
                     /db_xref="GeneID:10916533"
                     /translation="MSDNQLPPRPMRLSGLEPFTIDDDTLFVNVGERTNVTGSKAFAR
                     MILNGQFDEALAVARQQVENGAQIIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPI
                     MIDSSKWEVIEAGLQCVQGKPVVNSISLKEGEEQFRHHAALIRRYGAASVVMAFDEKG
                     QADTFQRKTEICKRSYDILVNEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATR
                     WIKQNLPYAKVSGGVSNVSFSFRGNDTVREAIHTVFLYHAIGAGMDMGIVNAGQLGVY
                     DQLDPELRERVEDVVLNRREDSTDRLLEIADRFKGGGAKKEENLAWRGTPEQPVPVGE
                     RLAHALVHGITTFIVEDTEEVRQQVEARGGRPIEVIEGPLMDGMNIVGDLFGAGKMFL
                     PQVVKSARVMKQAVAHLLPYIEEEKRLLAEAGGDVKARGKIVIATVKGDVHDIGKNIV
                     SVVLQCNNFEVVNMGVMVPCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRD
                     DYFRVKKIPLLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAK
                     YLDDLKTDYDRIRTQHANKKATPMVTLAQARANKTPIDWSSYVPPKPKFIGRRVFRNY
                     DLAELANYIDWGPFFQTWDLAGKFPDILNDEIVGESARKVFSDGKAMLSRLIQGRWLT
                     ANGVIALLPANTVNDDDIEIYTDETRSKVALTWHNLRQQSERPVVDGVRRPNRCLADF
                     VAPKDSGIADYVGLFAVTAGLGVEKKEAQFEADHDDYSAIMLKALADRFAEGFAECLH
                     ERVRKDLWGYDAGEQLTNEQLIAESYRGIRPAPGYPACPEHTVKGPMFEFLDAPEIGM
                     GITESLAMTPAASVSGFYLAHPQSTYFTIGKIGQDQLDDMAARRHEDRATLERALAPN
                     L"
     misc_feature    141206..143839
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="Methionine synthase I, cobalamin-binding domain
                     [Amino acid transport and metabolism]; Region: MetH;
                     COG1410"
                     /db_xref="CDD:224328"
     misc_feature    141263..142033
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="MeTr subgroup of pterin binding enzymes. This
                     family includes cobalamin-dependent methyltransferases
                     such as methyltetrahydrofolate, corrinoid iron-sulfur
                     protein methyltransferase (MeTr) and methionine synthase
                     (MetH).  Cobalamin-dependent...; Region: MeTr; cd00740"
                     /db_xref="CDD:238381"
     misc_feature    order(141287..141289,141497..141499,141560..141562,
                     141566..141568,141644..141646,141761..141763,
                     141878..141880,141890..141892,141983..141985,
                     141989..141991)
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238381"
     misc_feature    142178..142825
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="B12 binding domain of methionine synthase. This
                     domain binds methylcobalamin, which it uses as an
                     intermediate methyl carrier from methyltetrahydrofolate
                     (CH3H4folate) to homocysteine (Hcy); Region:
                     methionine_synthase_B12_BD; cd02069"
                     /db_xref="CDD:239020"
     misc_feature    order(142295..142297,142307..142309,142358..142360,
                     142367..142369,142502..142522,142529..142531,
                     142640..142648,142652..142660,142751..142753,
                     142817..142819)
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    142511..142513
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    143054..143884
                     /gene="metH2"
                     /locus_tag="CNE_1c01420"
                     /note="Vitamin B12 dependent methionine synthase,
                     activation domain; Region: Met_synt_B12; pfam02965"
                     /db_xref="CDD:251646"
     gene            144196..144657
                     /locus_tag="CNE_1c01430"
                     /db_xref="GeneID:10916534"
     CDS             144196..144657
                     /locus_tag="CNE_1c01430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683993.1"
                     /db_xref="GI:339324300"
                     /db_xref="GeneID:10916534"
                     /translation="MKKLLLSLSALSIAAASSLAMAQGTGVSVGTKADVGASVTTPSP
                     AAAAQGGLNTAGSAATGAAGAAEKGLSTAGAATSKGLSAAGSAADKGLSTAGAAVDKS
                     AGTAADATGDAAADAGTKAKHGKHATKSTKKAKTDASVGVSAGADAGAKAQ"
     gene            144963..145595
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /db_xref="GeneID:10916535"
     CDS             144963..145595
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator GacA"
                     /protein_id="YP_004683994.1"
                     /db_xref="GI:339324301"
                     /db_xref="GeneID:10916535"
                     /translation="MIRVLIADDHEIVRAGLRQFLSEEPDIQVTGEAGSGDQVMAQLR
                     DAEFDVLVLDISMPDRNGIDVLKLIRQRKPELPVLILSTYPEDQYAINLIRAGASGYL
                     TKESAPDDLVKAIRTVAQGRRYVSATVADLLIGGLDKPTEQPVHQMLSEREFQIFCKL
                     SRGQSVSVIADELFLSVKTVSTYRSRILEKMGMKTNADLTYYAIKNGLVE"
     misc_feature    144966..145592
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    144975..145319
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(144984..144989,145122..145124,145146..145148,
                     145206..145208,145263..145265,145272..145277)
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    145122..145124
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(145131..145136,145140..145148)
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    145272..145280
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    145407..145577
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(145410..145418,145455..145463,145485..145490,
                     145494..145499,145503..145517,145548..145550)
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(145443..145445,145449..145451,145455..145457,
                     145548..145556,145563..145565,145572..145577)
                     /gene="gacA"
                     /locus_tag="CNE_1c01440"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            145605..146048
                     /locus_tag="CNE_1c01450"
                     /db_xref="GeneID:10916536"
     CDS             145605..146048
                     /locus_tag="CNE_1c01450"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_004683995.1"
                     /db_xref="GI:339324302"
                     /db_xref="GeneID:10916536"
                     /translation="MGGTGRGPAIHNMSEQASNTSYRALSILLIEDSAVLRGMLLEYL
                     KDFPFIENVDWADTEAMALRLLAAGKYDVVIVDLQLRQGNGINVLRAMQRNGTGAVRI
                     VYTNHAQVSIYRRQCAEAGADYFFDKSLELEQVFRVIEEHAATAP"
     misc_feature    145683..>145988
                     /locus_tag="CNE_1c01450"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    145686..146033
                     /locus_tag="CNE_1c01450"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(145695..145700,145833..145835,145857..145859,
                     145917..145919,145977..145979,145986..145991)
                     /locus_tag="CNE_1c01450"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    145833..145835
                     /locus_tag="CNE_1c01450"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(145842..145847,145851..145859)
                     /locus_tag="CNE_1c01450"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    145986..145994
                     /locus_tag="CNE_1c01450"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(146098..147501)
                     /locus_tag="CNE_1c01460"
                     /db_xref="GeneID:10916537"
     CDS             complement(146098..147501)
                     /locus_tag="CNE_1c01460"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_004683996.1"
                     /db_xref="GI:339324303"
                     /db_xref="GeneID:10916537"
                     /translation="MFKQSFLPHTLLLAGGILLTLAVLVASETGNIRLRESYTDVIRS
                     QRVQTELAALNGELVNAEAGQRGFLLTGKESYLEPYYKALPRIAELMAQIRAGYAHDP
                     EGLKQFADTSKLVNSKLNEMALTLVYGKRDLEVALDLIRTDYGKETMDNARRGLDQLQ
                     AREAGTVSHRLEGAENDVQLSRYGIGLLTAINIILMMAVGVGHAKRLSMAEAVRIQLE
                     EESVRLDRKVRARTRQLSALAAHLQRVTEDEKTRLARELHDELGAILTAIKLDLHWVR
                     RKVQEDHPVAAERLTRVMLHVDQGIQIKRRLIEDLRPTVLLNLGLRAAVCQLVEEVGG
                     RNDWETHVSVPEDLPPLRDEAAIALYRIVQESLTNASKYSEARHIDVSLACQGNLLTL
                     TVRDDGKGLPADFDPGSTAGHHGLLGMEQRVTALGGSMQIDSSVQAGVRIRIEVPLTD
                     AVLAPAEEPENQEPARA"
     misc_feature    complement(146890..147474)
                     /locus_tag="CNE_1c01460"
                     /note="CHASE3 domain; Region: CHASE3; cl05000"
                     /db_xref="CDD:262402"
     misc_feature    complement(146158..147048)
                     /locus_tag="CNE_1c01460"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(146554..146757)
                     /locus_tag="CNE_1c01460"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    complement(146164..146427)
                     /locus_tag="CNE_1c01460"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(146176..146178,146182..146187,
                     146200..146202,146206..146208,146254..146259,
                     146299..146304,146308..146310,146314..146316,
                     146320..146322,146386..146388,146395..146397,
                     146407..146409))
                     /locus_tag="CNE_1c01460"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(146395..146397)
                     /locus_tag="CNE_1c01460"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(146257..146259,146302..146304,
                     146308..146310))
                     /locus_tag="CNE_1c01460"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            147702..147953
                     /locus_tag="CNE_1c01470"
                     /db_xref="GeneID:10916538"
     CDS             147702..147953
                     /locus_tag="CNE_1c01470"
                     /codon_start=1
                     /transl_table=11
                     /product="small integral membrane protein"
                     /protein_id="YP_004683997.1"
                     /db_xref="GI:339324304"
                     /db_xref="GeneID:10916538"
                     /translation="MSLHPLAQALTWAQPVRLARSDRFGSLAMLQYALVFFVIALIAA
                     IFGFGGIAAGAVEIAKILFFIFLVVALVAAVMGLVRRGR"
     misc_feature    147786..147938
                     /locus_tag="CNE_1c01470"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13682"
                     /db_xref="CDD:184239"
     gene            148006..148434
                     /locus_tag="CNE_1c01480"
                     /db_xref="GeneID:10916539"
     CDS             148006..148434
                     /locus_tag="CNE_1c01480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683998.1"
                     /db_xref="GI:339324305"
                     /db_xref="GeneID:10916539"
                     /translation="MLTQNPKVRKELNHLSDSADSAIRHIRHAARDTRDAAAPVSAEV
                     KALIAQLEHTIEVLAREGSAESMRAGQRLRERATDMAHRLRAQTTDGMMRARERMDGA
                     VEHAQHRVAESPLKAVAIAAAVGALIGLLLANGRRHSEED"
     misc_feature    148132..148404
                     /locus_tag="CNE_1c01480"
                     /note="Bacterial protein of unknown function (DUF883);
                     Region: DUF883; cl01888"
                     /db_xref="CDD:242764"
     gene            complement(148609..148929)
                     /locus_tag="CNE_1c01490"
                     /db_xref="GeneID:10916540"
     CDS             complement(148609..148929)
                     /locus_tag="CNE_1c01490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004683999.1"
                     /db_xref="GI:339324306"
                     /db_xref="GeneID:10916540"
                     /translation="MLITFKSHAAQDLIMMKDLAMTLLGIIGKRLGERGVITVEELPT
                     AIHKLEAAVADAKTHPASSAVEADTGKDEDEEEPLHLGQRAYPFLDMLRASQREGANV
                     MWGV"
     misc_feature    complement(148618..148929)
                     /locus_tag="CNE_1c01490"
                     /note="Domain of unknown function (DUF1840); Region:
                     DUF1840; pfam08895"
                     /db_xref="CDD:255095"
     gene            149183..150979
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /db_xref="GeneID:10916541"
     CDS             149183..150979
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /EC_number="6.1.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="YP_004684000.1"
                     /db_xref="GI:339324307"
                     /db_xref="GeneID:10916541"
                     /translation="MLPVQTSNLAAAFTDAVRALAPADATLPAVTFERPKVAAHGDLA
                     CNIAMQVARALKSNPRELAQRIVDAVQADARAQGLVQAMEIAGPGFINLRLTPAAKAD
                     VLRAVLAEGDRYGARERGVHGQVLVEFVSANPTGPLHVGHGRQAALGDALANLLSWQG
                     FHVHREFYYNDAGVQIQTLALSVQARARGLKPGDASWPEAAYNGDYIADIAADFLAGK
                     TVSASDGEPVTASGNVEDIDSIRKFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYSDG
                     RVEAAVQSLIGKGKTYESEGALWLRTTDDGDDKDRVMKKSDGTYTYFVPDVAYHTTKW
                     ERGFTKVINVQGSDHHGTIARVRAGLQGLDMGIPQGYPDYVLHKMVTVMKNGEEVKIS
                     KRAGSYVTVRDLIEWSNGQDDTCETIRGCLEQGVADWPAHFTRGRDAVRFFLLSRKAD
                     TEFVFDVDLALKQSDENPVYYVQYAHARICSIFESWGGADWEARLAELAGADLSAVTG
                     PEASAQAQALGQRLAEFPDMLSVAAAELAPHAVAFYLRDLAGDFHAFYNADRVLVDDE
                     AVKRARLALLAATRQVLRNGLAVIGVSAPRRM"
     misc_feature    149204..149467
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="Arginyl tRNA synthetase N terminal dom; Region:
                     Arg_tRNA_synt_N; smart01016"
                     /db_xref="CDD:214975"
     misc_feature    149207..150976
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="arginyl-tRNA synthetase; Reviewed; Region: argS;
                     PRK01611"
                     /db_xref="CDD:234964"
     misc_feature    149555..150370
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="catalytic core domain of arginyl-tRNA synthetases;
                     Region: ArgRS_core; cd00671"
                     /db_xref="CDD:185675"
     misc_feature    order(149564..149566,149573..149575,149579..149581,
                     149597..149599,149606..149608,150146..150148,
                     150158..150160,150227..150229,150236..150238)
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="active site"
                     /db_xref="CDD:185675"
     misc_feature    149597..149608
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:185675"
     misc_feature    150353..150364
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="KMSK motif region; other site"
                     /db_xref="CDD:185675"
     misc_feature    150488..150976
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="Anticodon-binding domain of arginyl tRNA
                     synthetases; Region: Anticodon_Ia_Arg; cd07956"
                     /db_xref="CDD:153410"
     misc_feature    order(150569..150571,150575..150583,150593..150595,
                     150602..150604,150611..150616,150623..150628,
                     150635..150637,150782..150784,150809..150811,
                     150830..150832,150842..150844,150848..150850,
                     150908..150910)
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153410"
     misc_feature    order(150602..150604,150611..150616,150623..150628,
                     150635..150637,150848..150850,150857..150868,
                     150908..150910,150971..150976)
                     /gene="argS"
                     /locus_tag="CNE_1c01500"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153410"
     gene            151097..151822
                     /gene="ftsN"
                     /locus_tag="CNE_1c01510"
                     /db_xref="GeneID:10916542"
     CDS             151097..151822
                     /gene="ftsN"
                     /locus_tag="CNE_1c01510"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="YP_004684001.1"
                     /db_xref="GI:339324308"
                     /db_xref="GeneID:10916542"
                     /translation="MQQQRKRESRHVRRNQQRGGTFLGLVLGLIVGLAIAVVVALYIT
                     KSPTPFQQKSAPRPSEPGNVTSQLPPPAQRADEGPSDPNKPLWSKTPAKPVGQPPEPE
                     PKANGRSGQNGQQPPVAVARPAEKPVEKPAEKPADKPVASKPAEKPVADPIAEIAQAD
                     ANKVGYLLQVGAFRSSDDADRQKANLAMQGFEARITERDVNGVKMYRVRLGPFNRIED
                     MNKARDRLQSSGFEASVIRFTKQ"
     misc_feature    151097..>151327
                     /gene="ftsN"
                     /locus_tag="CNE_1c01510"
                     /note="Putative neutral zinc metallopeptidase; Region:
                     Zn_peptidase; cl19825"
                     /db_xref="CDD:268178"
     misc_feature    151109..151819
                     /gene="ftsN"
                     /locus_tag="CNE_1c01510"
                     /note="Cell division protein [Cell division and chromosome
                     partitioning]; Region: FtsN; COG3087"
                     /db_xref="CDD:225629"
     misc_feature    151589..151807
                     /gene="ftsN"
                     /locus_tag="CNE_1c01510"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            151989..152624
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /db_xref="GeneID:10916543"
     CDS             151989..152624
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein DsbA"
                     /protein_id="YP_004684002.1"
                     /db_xref="GI:339324309"
                     /db_xref="GeneID:10916543"
                     /translation="MKKLAALFAMFAAVGGLLMSAPSRAAPAEGKEYQVLKAAQPVAA
                     GKIEVTEFFWYGCPHCYDFEPDLEAWVKKQGSNVVFKRVPVAFRDDLLPHTKIFYALE
                     AIGKLDAMHTKVFNAIHVDRKRMTDPNEIADFMAKNGVDRKAFLDAYNSFTVTTNSQR
                     ANKIADAYKIDGVPTVVVQGKFVTSPSIAGNKQGAIQTMDYLVDQVKAKKM"
     misc_feature    152073..152612
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /note="DsbA family, DsbA subfamily; DsbA is a monomeric
                     thiol disulfide oxidoreductase protein containing a redox
                     active CXXC motif imbedded in a TRX fold. It is involved
                     in the oxidative protein folding pathway in prokaryotes,
                     and is the strongest thiol...; Region: DsbA_DsbA; cd03019"
                     /db_xref="CDD:239317"
     misc_feature    order(152157..152159,152163..152168,152508..152510)
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    152247..152255
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(152265..152291,152304..152363,152373..152399,
                     152415..152444)
                     /gene="dsbA"
                     /locus_tag="CNE_1c01520"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            152732..153538
                     /locus_tag="CNE_1c01530"
                     /db_xref="GeneID:10916544"
     CDS             152732..153538
                     /locus_tag="CNE_1c01530"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase/reductase oxidoreductase protein"
                     /protein_id="YP_004684003.1"
                     /db_xref="GI:339324310"
                     /db_xref="GeneID:10916544"
                     /translation="MRPLKVFLTGASSGLGQALAREYASQGAILGLVARREDALREFV
                     ATLPNPGAVRVYGADVRDADAMARAAQDFLGHFGCPDVVIANAGVSVGTVASEREDLD
                     AFRQVMDTNWFGVLTTFQPFLHAMQAREPGHFGRRGTLVGIASVAGVRGLPGAGAYSA
                     SKSAVIKLLESLRLEQRAHGIRVVTIAPGYIRTPMTAHNPYRMPFLTDADVFARKAVR
                     VIAAGRRFRVIPWPMGVVAALLHVMPRWLYDALAAGAPRKPRRADPPQEP"
     misc_feature    152735..153520
                     /locus_tag="CNE_1c01530"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07024"
                     /db_xref="CDD:235910"
     misc_feature    152747..153484
                     /locus_tag="CNE_1c01530"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(152759..152761,152765..152770,152774..152776,
                     152831..152839,152987..152995,153158..153166,
                     153203..153205,153215..153217,153293..153304)
                     /locus_tag="CNE_1c01530"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(153062..153064,153164..153166,153203..153205,
                     153215..153217)
                     /locus_tag="CNE_1c01530"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            153541..154374
                     /locus_tag="CNE_1c01540"
                     /db_xref="GeneID:10916545"
     CDS             153541..154374
                     /locus_tag="CNE_1c01540"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic metal ion binding protein"
                     /protein_id="YP_004684004.1"
                     /db_xref="GI:339324311"
                     /db_xref="GeneID:10916545"
                     /translation="MWRDAIGQQHAAASGVVRIASLVPSVTELLFALGLARQMVARTG
                     FCIHPEPAVRAVPKVGGTKDVNVARLRELAPTHVVVNIDENRRETVDEIRAFVPNVIV
                     THPCAPEDNLGLYQLLGGIFGCHAEAEALCTALQVQLDAICVRPWPARRVLYAIWQDP
                     WMTVSRDTYISRLLALANWQTWPDGGAALQACVGGDCSRPNASGERYPTFRWSDALVR
                     ELDLVLLSTEPYRFTEDHADALERQLGKTVLLVDGEMLSWYGSRAIDGVRYLAALAAA
                     N"
     misc_feature    153550..154371
                     /locus_tag="CNE_1c01540"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    153592..154356
                     /locus_tag="CNE_1c01540"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(153811..153816,153823..153825,153898..153900)
                     /locus_tag="CNE_1c01540"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(154391..155467)
                     /locus_tag="CNE_1c01550"
                     /db_xref="GeneID:10916546"
     CDS             complement(154391..155467)
                     /locus_tag="CNE_1c01550"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase including glyoxylase"
                     /protein_id="YP_004684005.1"
                     /db_xref="GI:339324312"
                     /db_xref="GeneID:10916546"
                     /translation="MNALEHQLQYPFGDTMPEPGSKQEVAPGVYWLRMPLPFALDHIN
                     LWLLRDRLDGRDGWTIIDCGITNDIIKGHWETIFANELEGLPVVRVLVTHSHPDHVGL
                     AHWLCKRFGVRLWMSLGDYMSARVMGSGTGAGSSAGGDAAAAHFALHGLTDADSQEKL
                     RARKTYYPSLVPDLPAQYRRMMEGDTVRIGTDAATSAWRVITGFGHSPEHVALYNAAT
                     NVLISGDMVLPRISTNVSVFDMEPEGNSLQLYLDSLGKYEPLPQDVLILPSHGRPFRN
                     LHTRIMQLREHHADRLAETLEACGGKACSAHDIVSVIFKRQFDIHQMTFAMGESLAHL
                     HCLWHRGELMRETGDDGVIRFRAA"
     misc_feature    complement(154583..155314)
                     /locus_tag="CNE_1c01550"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     gene            155676..156140
                     /locus_tag="CNE_1c01560"
                     /db_xref="GeneID:10916547"
     CDS             155676..156140
                     /locus_tag="CNE_1c01560"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004684006.1"
                     /db_xref="GI:339324313"
                     /db_xref="GeneID:10916547"
                     /translation="MSATPAAASATFTITDLAREFDITPRAIRFYEDQGLLSPEREGP
                     GGRKRVYNGRERTRLKLTLRGKRLGLTLNEIREILDLYESPRDTTPQLERFLHSLAAH
                     RRTLEQQMEDLQAQLAEIDQHERQCRALLAAQTGKPQPATEGGDAPARTTAA"
     misc_feature    155709..156101
                     /locus_tag="CNE_1c01560"
                     /note="Zn(II)-responsive transcriptional regulator;
                     Region: ZntR; TIGR02043"
                     /db_xref="CDD:131098"
     misc_feature    155709..156071
                     /locus_tag="CNE_1c01560"
                     /note="Helix-Turn-Helix DNA binding domain of the
                     regulatory protein GnyR; Region: HTH_GnyR; cd04776"
                     /db_xref="CDD:133403"
     misc_feature    order(155712..155720,155760..155762,155817..155825)
                     /locus_tag="CNE_1c01560"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133403"
     misc_feature    order(155856..155858,155865..155867,155877..155882,
                     155907..155909,155970..155972,155982..155984,
                     156000..156002,156012..156014,156021..156026)
                     /locus_tag="CNE_1c01560"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133403"
     gene            156269..156745
                     /locus_tag="CNE_1c01570"
                     /db_xref="GeneID:10916548"
     CDS             156269..156745
                     /locus_tag="CNE_1c01570"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylacetic acid degradation-like protein"
                     /protein_id="YP_004684007.1"
                     /db_xref="GI:339324314"
                     /db_xref="GeneID:10916548"
                     /translation="MTSSNASAVPAEPGSLSAARADAIATSFSRQGLMTTFGASLRRV
                     DRGEVELAMPWSDGVTQQHGFFHGGAVGALADSACGYAALTMVGEDEAGLTAEYKINL
                     LSPAQGERLVAVGRVLKPGRTLIVAQGDVYVEQDGRRKQVATMLMTLCVVKTLGHV"
     misc_feature    156374..156712
                     /locus_tag="CNE_1c01570"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    156428..>156706
                     /locus_tag="CNE_1c01570"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    order(156464..156466,156551..156553,156572..156583)
                     /locus_tag="CNE_1c01570"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(156467..156469,156473..156475,156482..156484,
                     156554..156568,156572..156574)
                     /locus_tag="CNE_1c01570"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(156470..156472,156494..156499,156506..156511,
                     156551..156553)
                     /locus_tag="CNE_1c01570"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            156810..157991
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /db_xref="GeneID:10916549"
     CDS             156810..157991
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /EC_number="1.3.99.10"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase Ivd"
                     /protein_id="YP_004684008.1"
                     /db_xref="GI:339324315"
                     /db_xref="GeneID:10916549"
                     /translation="MTELPGLKFDLGEDIEMLRNSVRDWAQAELAPRAAEIDRTDQFP
                     MDAWKKMGDLGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVN
                     QIHRNGTAAQKAKYLPKLVSGEWIGALAMSEPNAGSDVVSMKLRAELKGDRYVLNGTK
                     MWITNGPDCDVLVVYAKTEPELGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGEL
                     VFQDVEVPVENILGAENGGAKVLMSGLDYERAVLSGGPVGIMQACMDVVTPYIHDRKQ
                     FGQSIGEFQLIQGKVADMYTTLQAARSYLYTVGKNLDALGSGHVRQVRKDCAAVILYT
                     AEKATWMAGETVQILGGNGYINEYPAGRLWRDAKLYEIGAGTSEIRRMLIGRELFAET
                     M"
     misc_feature    156822..157982
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /note="isovaleryl-CoA dehydrogenase; Region: PLN02519"
                     /db_xref="CDD:215284"
     misc_feature    156837..157979
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /note="Isovaleryl-CoA dehydrogenase; Region: IVD; cd01156"
                     /db_xref="CDD:173845"
     misc_feature    order(157080..157082,157092..157094,157104..157106,
                     157221..157223,157299..157301,157362..157364,
                     157524..157526,157545..157547,157554..157556,
                     157563..157565,157914..157919,157926..157934)
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173845"
     misc_feature    order(157194..157196,157200..157205,157218..157223,
                     157293..157295,157299..157301,157935..157937,
                     157941..157943)
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173845"
     misc_feature    157551..157553
                     /gene="ivd"
                     /locus_tag="CNE_1c01580"
                     /note="catalytic base [active]"
                     /db_xref="CDD:173845"
     gene            158100..159935
                     /gene="aceK"
                     /locus_tag="CNE_1c01590"
                     /db_xref="GeneID:10916550"
     CDS             158100..159935
                     /gene="aceK"
                     /locus_tag="CNE_1c01590"
                     /EC_number="2.7.11.5"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase kinase/phosphatase
                     AceK"
                     /protein_id="YP_004684009.1"
                     /db_xref="GI:339324316"
                     /db_xref="GeneID:10916550"
                     /translation="MSHFPKLLSSQIAFDVARTMLDGFDKHYRLFREVSHQAKLKFEA
                     GDWHGLQQIQRDRIAFYNERVRESSVILEDEYDAENIEDEIWQQIKLHYIGLLTNHHQ
                     PELAETFFNSVCTRILHRSYFNNDFIFVRPAISTEYIENEESPTRPTFRAYYPGSREG
                     MAACFERIVHNFQLESPFEDLPRDIGYVVRAVSEHFGDLRIAPNFQIHTLSSLFFRNK
                     AAFIIGRILNGDHTFPLAIPILHGPSGKLMLDTVLLKKEQLLILFSFTHSYFMVDMEI
                     PSAYVTFLRDIMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFIVAPGIRGL
                     VMLVFTLPSYPYVFKVIRDFFPAPKETTRELVKSKYQLVKQHDRVGRMADTLEYSDVA
                     FPLSRFDDALVREFEQHAPSMIEYQRGKDGGEEIVVRHVYIERRMTPLNIYLTEGSDA
                     QVEHGVIEYGNAVKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNIRDV
                     PQPRNEEEEMSGEVWYTVRPHDIFPETFRTFLLGDTRVRAAFLRHHADFFDPAMWQSH
                     KDRLLAGHVHDFFAYHSSERFIHRYGEAGSVQAAVPDPGPARRAA"
     misc_feature    158121..159875
                     /gene="aceK"
                     /locus_tag="CNE_1c01590"
                     /note="bifunctional isocitrate dehydrogenase
                     kinase/phosphatase protein; Validated; Region: aceK;
                     PRK02946"
                     /db_xref="CDD:235089"
     gene            159932..160603
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /db_xref="GeneID:10916551"
     CDS             159932..160603
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-carbonic anhydrase Can"
                     /protein_id="YP_004684010.1"
                     /db_xref="GI:339324317"
                     /db_xref="GeneID:10916551"
                     /translation="MTDAIAQLFRNNREWVDRVNAEDPTFFMRLANQQAPEYLWIGCS
                     DSRVPANQILGLAPGEVFVHRNIANVIAHSDLNALAVIQFAVEVLKVRHITVVGHYGC
                     GGVKVALKRERIGLADNWLRHVRDVADKHEAYLGTLLREDDAHTRLCELNVIEQVNNV
                     CQTTVLQDAWTRGQAVTVHGWVYGVSDGLLRDLGMAASSNEELHEQLAAAYRQYGDPP
                     QASIR"
     misc_feature    159965..160510
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeA; cd00883"
                     /db_xref="CDD:238448"
     misc_feature    order(160031..160033,160037..160039,160058..160060,
                     160064..160072,160106..160108,160115..160117,
                     160181..160183,160196..160198,160226..160228,
                     160235..160237,160478..160480)
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238448"
     misc_feature    order(160058..160060,160064..160066,160226..160228,
                     160235..160237)
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238448"
     misc_feature    order(160061..160072,160076..160078,160082..160087,
                     160091..160093,160106..160114,160118..160120,
                     160124..160126,160166..160171,160178..160183,
                     160289..160291,160478..160480,160484..160489,
                     160493..160495,160499..160501)
                     /gene="can"
                     /locus_tag="CNE_1c01600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238448"
     gene            160654..161832
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /db_xref="GeneID:10916552"
     CDS             160654..161832
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase ThlA"
                     /protein_id="YP_004684011.1"
                     /db_xref="GI:339324318"
                     /db_xref="GeneID:10916552"
                     /translation="MEEIVIVSAARTPMAAFQGEFASVTAPQLGAVAIRAAVERAGLK
                     PEQVEEVVFGCVLPAGQGQAPARQAALGAGLPLGVGCTTVNKMCGSGMRAAMTVYDGL
                     IAGSFDIAIAGGMESMTNAPYLVPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGT
                     FGEDCAAKYGFTREQQDEFAMESVRRAQQATENGDFRWEIAPVTVSGKGGDTVIDTDE
                     GPRRIKLDKIPSLKPAFAKDGTITAASSSSINDGASALVMMRASTAKKLGLQPIARML
                     GHTTHAQAPGWFTTAPVEAIAKLYRKLDWTTDSVDLFEINEAFAVVPMAAMHDLKIAR
                     DKVNIHGGACALGHPIGASGARIMTTLIGALRKTGGKRGVASLCIGGGEATAVGIEIL
                     "
     misc_feature    160654..161829
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06954"
                     /db_xref="CDD:180775"
     misc_feature    160666..161823
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(160720..160722,160801..160803,160843..160845,
                     160852..160854,160864..160866,160897..160908,
                     160930..160932,160951..160956,160963..160965,
                     161008..161010,161485..161487,161491..161493,
                     161497..161499,161557..161559,161794..161799)
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(160915..160917,161695..161697,161785..161787)
                     /gene="thlA"
                     /locus_tag="CNE_1c01610"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            161926..162606
                     /locus_tag="CNE_1c01620"
                     /db_xref="GeneID:10916553"
     CDS             161926..162606
                     /locus_tag="CNE_1c01620"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_004684012.1"
                     /db_xref="GI:339324319"
                     /db_xref="GeneID:10916553"
                     /translation="MPTVLILGASRGIGLEFVRQYRADGWRVIAAARTPEGVGALQAL
                     GAEAHQVDLSDAGAVAGLGWKLDGEALDVAIYNAGVLGPRTEGAQPVTPQEFDQVMHV
                     NVLGPMMALPLLLPYVEAGQSGHGGVLAVLSSRMGSITAMEHSTSWLYRVSKAGANAA
                     LRAVSLDARHATCVALHPGWVKTDMGGQEADLTVQQSVKGMRQVLAGVKRRDNGTFHN
                     YDGTPIPW"
     misc_feature    161926..162546
                     /locus_tag="CNE_1c01620"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    161935..162603
                     /locus_tag="CNE_1c01620"
                     /note="carbonyl reductase sniffer-like, classical (c)
                     SDRs; Region: carb_red_sniffer_like_SDR_c; cd05325"
                     /db_xref="CDD:187586"
     misc_feature    order(161947..161949,161953..161964,162022..162024,
                     162079..162084,162154..162165,162229..162231,
                     162319..162327,162373..162375,162385..162387,
                     162454..162468,162472..162474,162478..162483)
                     /locus_tag="CNE_1c01620"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187586"
     misc_feature    order(162082..162084,162100..162102,162211..162213,
                     162226..162228,162235..162243,162250..162252,
                     162259..162264,162331..162351,162367..162369,
                     162376..162381,162388..162393,162400..162405,
                     162409..162414,162421..162426,162598..162603)
                     /locus_tag="CNE_1c01620"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187586"
     misc_feature    order(162232..162234,162325..162327,162373..162375,
                     162385..162387)
                     /locus_tag="CNE_1c01620"
                     /note="active site"
                     /db_xref="CDD:187586"
     gene            162637..163767
                     /gene="bcd1"
                     /locus_tag="CNE_1c01630"
                     /db_xref="GeneID:10916554"
     CDS             162637..163767
                     /gene="bcd1"
                     /locus_tag="CNE_1c01630"
                     /EC_number="1.3.8.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004684013.1"
                     /db_xref="GI:339324320"
                     /db_xref="GeneID:10916554"
                     /translation="MLLTPEQEMIRDAVRQFAQEVIAPQAAQWDRDKTFPKDVHRELA
                     ALGAYGVAVPEEYGGAGLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMSFASE
                     AQKQQWLVPLARGEMLGAFCLTEPHVGSDASALRTSAVRDGDHYVLNGVKQFITSGQN
                     ADVAIVLAVTDKAAGKRGISAFIVPTSTPGYVVARLEDKLGQHSSDTAQILFEDCRVP
                     AANLLGDEGGGYKMALSGLEGGRIGIASQSIGMARAAFEAALAYAKERESFGQPLFQH
                     QAVQFRLAEMATRIDVARQMVWHAAALRDAGRPCLKEAAMAKLFASEMAERVCSDAIQ
                     VFGGYGYVSDFPVERIYRDVRVCQIYEGTSDIQKILIARALA"
     misc_feature    162637..163761
                     /gene="bcd1"
                     /locus_tag="CNE_1c01630"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    162649..163764
                     /gene="bcd1"
                     /locus_tag="CNE_1c01630"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(162907..162909,162997..162999,163003..163005,
                     163096..163098,163102..163104,163711..163719,
                     163723..163725,163729..163731)
                     /gene="bcd1"
                     /locus_tag="CNE_1c01630"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            163786..164511
                     /locus_tag="CNE_1c01640"
                     /db_xref="GeneID:10916555"
     CDS             163786..164511
                     /locus_tag="CNE_1c01640"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxychromene-2-carboxylate isomerase"
                     /protein_id="YP_004684014.1"
                     /db_xref="GI:339324321"
                     /db_xref="GeneID:10916555"
                     /translation="MHAAKAARFPDSRPGNHNKKGPDMTAAIDFYFDFSSPYGYFAST
                     RIDDLAQKYGRIVAWHPILLGVVFKTTGASPLPQLPLKGDYSWRDFERTARFHGIEYK
                     RPTHFPLPTTHAARAMLWLQNHHGDDIATAFAKSVYRALFVDDINIAEPAEIMKLAEP
                     LGVDVQALDAGATSYQIKDQLKAEIDVAMAKGVFGSPFVIIDGEPFWGFDRFDQVEAH
                     LKSRRQTELRAVPSLDTKEKKPA"
     misc_feature    163867..164445
                     /locus_tag="CNE_1c01640"
                     /note="DsbA family, 2-hydroxychromene-2-carboxylate (HCCA)
                     isomerase subfamily; HCCA isomerase is a glutathione (GSH)
                     dependent enzyme involved in the naphthalene catabolic
                     pathway. It converts HCCA, a hemiketal formed
                     spontaneously after ring cleavage of 1; Region:
                     DsbA_HCCA_Iso; cd03022"
                     /db_xref="CDD:239320"
     misc_feature    163891..163893
                     /locus_tag="CNE_1c01640"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:239320"
     gene            164508..165194
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /db_xref="GeneID:10916556"
     CDS             164508..165194
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /EC_number="3.1.3.18"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="YP_004684015.1"
                     /db_xref="GI:339324322"
                     /db_xref="GeneID:10916556"
                     /translation="MTAATRGHSGRFDCVIFDCDGVLVDSEPIVNRVLNQMLNELGIE
                     ISLEDSTRLFLGRAVREELDMIARMRGAPLPENWLSTWLARRNAVLEAEVVAVAHVRE
                     AIGKIAATGMPVCVASGADRIKVKLQLTRTGLVELFQQDEREHIFSATEVARSKPAPD
                     VYLLAARTMGVEPARCAVVEDSPTGVTAGVAAGMTVFGYAERNDAALLREAGAGTIFT
                     DMRDLPELVG"
     misc_feature    164538..165191
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /note="Predicted phosphatase/phosphohexomutase [General
                     function prediction only]; Region: COG0637"
                     /db_xref="CDD:223710"
     misc_feature    164547..165101
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(164559..164567,164859..164864)
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    164559..164576
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    164859..164861
                     /gene="gph1"
                     /locus_tag="CNE_1c01650"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            165191..165628
                     /locus_tag="CNE_1c01660"
                     /db_xref="GeneID:10916557"
     CDS             165191..165628
                     /locus_tag="CNE_1c01660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684016.1"
                     /db_xref="GI:339324323"
                     /db_xref="GeneID:10916557"
                     /translation="MTAKAAGRLPKAGPVPCPCGSADYAACCGRFHRGEALPPNAEAL
                     MRSRYSAYVLNDMEWLRQTWHASTCPADLLPDTATRWLGLTVKAHAQQDDTHAEVEFV
                     ARYKVGGRAKRLHERSRFVCEARAPGEAPRWLYVDGDMIGEAP"
     misc_feature    165203..165616
                     /locus_tag="CNE_1c01660"
                     /note="hypothetical protein; Provisional; Region:
                     PRK01842"
                     /db_xref="CDD:234985"
     misc_feature    165236..165607
                     /locus_tag="CNE_1c01660"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3012"
                     /db_xref="CDD:225557"
     gene            165625..166302
                     /locus_tag="CNE_1c01670"
                     /db_xref="GeneID:10916558"
     CDS             165625..166302
                     /locus_tag="CNE_1c01670"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004684017.1"
                     /db_xref="GI:339324324"
                     /db_xref="GeneID:10916558"
                     /translation="MSIEKRNEPEYLLYCFAQSGNAYKVALLLETVGVQRGQQLWQPR
                     FVDFFNGETRTPEYRAINVMGEVPVLEFGGQRLSQSGAILETLATRLDAYGPRDEAER
                     AEVLRWLLFDNHKFTSYTATYRFMRNFARSPDPAVLEFFRARCEGAWNVLNAHLAGRA
                     FLLGERASIADFSLAGYVFFDDEIGVHWRKEYPHIHAWAERIRALPGWKHPYDLMPGH
                     PLPKHAG"
     misc_feature    165655..166248
                     /locus_tag="CNE_1c01670"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    165655..165888
                     /locus_tag="CNE_1c01670"
                     /note="GST_N family, unknown subfamily 4; composed of
                     uncharacterized bacterial proteins with similarity to
                     GSTs. GSTs are cytosolic dimeric proteins involved in
                     cellular detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of...; Region:
                     GST_N_4; cd03056"
                     /db_xref="CDD:239354"
     misc_feature    order(165685..165687,165691..165696,165700..165705,
                     165712..165717,165865..165867,165874..165879)
                     /locus_tag="CNE_1c01670"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239354"
     misc_feature    order(165685..165687,165820..165828,165859..165864)
                     /locus_tag="CNE_1c01670"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239354"
     misc_feature    order(165820..165822,165856..165861,165865..165870,
                     165877..165879)
                     /locus_tag="CNE_1c01670"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239354"
     misc_feature    165925..166245
                     /locus_tag="CNE_1c01670"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    order(165940..165942,165961..165963,166129..166131,
                     166138..166143,166150..166152,166162..166164)
                     /locus_tag="CNE_1c01670"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    order(165940..165945,165952..165957,165964..165966,
                     166075..166077)
                     /locus_tag="CNE_1c01670"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    order(165961..165963,165973..165978,166153..166155,
                     166162..166164)
                     /locus_tag="CNE_1c01670"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            166356..167963
                     /locus_tag="CNE_1c01680"
                     /db_xref="GeneID:10916559"
     CDS             166356..167963
                     /locus_tag="CNE_1c01680"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyltransferase"
                     /protein_id="YP_004684018.1"
                     /db_xref="GI:339324325"
                     /db_xref="GeneID:10916559"
                     /translation="MPTLETKLNARSESFKANAESMQALVADLKARIAKLAEGGGEDA
                     RNKHLSRGKLLPRERVQQLLDPGTPFLELSQLAAYDMYDNAAPGAGIITGIGRVAGQE
                     CVIVCNDATVKGGTYYPMTVKKHVRAQEIAEENNLPCIYLVDSGGANLPNQDDVFPDR
                     DHFGRIFYNQANLSKQGIPQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPL
                     VKAATGEEVSAEDLGGADVHTRLSGVADYFAQNDHHALSLARNIVQHLNRRKPDQIRL
                     HEPVEPLYPVEELYGVIPTDTRKPYDVREVIARLVDGSEFDEFKARYGTTLVCGFARI
                     WGYPVGIVANNGILFSESALKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIAR
                     NGAKMVTAVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQA
                     ASVLATVRRDGIEGKGGKWSAQEEEAFKQPIRDQYEHQGHPYYASARLWDDGVIDPAQ
                     TRTVLGLGLSASLNAPIDEMKFGVFRM"
     misc_feature    166365..167960
                     /locus_tag="CNE_1c01680"
                     /note="3-methylcrotonyl-CoA carboxylase, beta chain;
                     Region: PLN02820"
                     /db_xref="CDD:178415"
     misc_feature    <166524..167036
                     /locus_tag="CNE_1c01680"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    <167247..>167717
                     /locus_tag="CNE_1c01680"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            168006..168899
                     /locus_tag="CNE_1c01690"
                     /db_xref="GeneID:10916560"
     CDS             168006..168899
                     /locus_tag="CNE_1c01690"
                     /EC_number="3.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="YP_004684019.1"
                     /db_xref="GI:339324326"
                     /db_xref="GeneID:10916560"
                     /translation="MRSVARLLCSLALVTAFAMLAPLCGHAQTANGNGKAARMRFQEQ
                     VVMLPKAAIPSRIDLEATVFKPAGDGPFPLVVINHGKAPGRPAMQGRARFPAQSVEFL
                     RRGYAVVLPMRQGFARSGGAYVGGSCDIEANGMMQADDVVATLDFMATQPYVDMERIV
                     VIGQSHGGLTTMAFSTIGYPGVLGVINFAGGLRNLNCPDWEERLVDAFASYGGLARYP
                     SLWVYGDNDSYWPVPLPGRMFNAFKARATGPAAQSRLLDVGEFGNDSHRVFSAREGIP
                     VWLPEVGNFFRSLGLPFDAGT"
     misc_feature    168225..168755
                     /locus_tag="CNE_1c01690"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     misc_feature    168315..>168524
                     /locus_tag="CNE_1c01690"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            168937..169725
                     /locus_tag="CNE_1c01700"
                     /db_xref="GeneID:10916561"
     CDS             168937..169725
                     /locus_tag="CNE_1c01700"
                     /EC_number="4.2.1.116"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxypropionyl-coenzyme A dehydratase"
                     /protein_id="YP_004684020.1"
                     /db_xref="GI:339324327"
                     /db_xref="GeneID:10916561"
                     /translation="MEFTALTVNIASHVATVTLNRPDVRNAFNETVIAELTGAFRALG
                     DMDEVRAIVLAGNGPAFCAGADLNWMKKMAGYSDDQNRADALTLAQMLHTIWSCPRPV
                     IARIQGDTYAGGMGLVAACDIAVAAEHAHFCLSEARLGLLPATISPYVIRALGEQAAR
                     RYFITAERFDAAEALRLGFVHTVVPAEALDAKVTELATALVANSPNAVRESKRLVQDV
                     AGRAIDNDLLADTADRIAKIRASEEGREGVKSFLEKRSPSWRPA"
     misc_feature    168937..169722
                     /locus_tag="CNE_1c01700"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK05995"
                     /db_xref="CDD:235664"
     misc_feature    168952..169536
                     /locus_tag="CNE_1c01700"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(169009..169011,169015..169017,169111..169113,
                     169123..169137,169261..169263,169267..169275,
                     169339..169344,169351..169353)
                     /locus_tag="CNE_1c01700"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(169129..169131,169273..169275)
                     /locus_tag="CNE_1c01700"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(169213..169215,169237..169239,169300..169311,
                     169345..169356,169369..169371,169375..169383,
                     169387..169392,169405..169410,169414..169419,
                     169423..169428,169435..169437,169468..169470,
                     169477..169479,169522..169524,169531..169536)
                     /locus_tag="CNE_1c01700"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    <169510..169704
                     /locus_tag="CNE_1c01700"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            169901..171403
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /db_xref="GeneID:10916562"
     CDS             169901..171403
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /EC_number="2.6.1.62"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="YP_004684021.1"
                     /db_xref="GI:339324328"
                     /db_xref="GeneID:10916562"
                     /translation="MTLPNLSATVALPGLAGSGARADGQQRRATLDHLSLSPGSDAQA
                     LGQRSRNAVWHPCTRLRPDDDAVPLAIVRGVGPWLHDADGRRYFDATSSWWVNLFGHA
                     NPRINAALASQLETLEHVMLAGCTHAPAVELAERLSALTGGALGNVFYASDGASAVEI
                     ALKMSFHYWRNTGLPAKREFVCLRHGYHGETVGALAVTDVEVFRDAYDPLIRRAHVVM
                     SPDARQAAPGESAADVAARALAELETLLRERAGQIAALIVEPLVQGAAGMAMYDPSYL
                     DGARALCDRYRIHLIADEIAVGCGRTGTFFAWEQSRAAEAPLPAHLWPDFLCLSKGIS
                     GGYLPLSLVLSRPEIQRAFVADELARSFLHSHSYTGNPLACRAALATLDLFAQDDVLA
                     RNRERAHWLADGMAALAADARLRHVRQRGLIWAADVRDDVAGADFAARFHHAAREREL
                     LVRPIGNTLYVMPPYVFDAAQARWLGEQLLATLDDVTTDMSTSGEVRHAA"
     misc_feature    170039..171367
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    170039..171358
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(170357..170365,170459..170464,170468..170470,
                     170675..170677,170777..170779,170783..170788,
                     170891..170893)
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(170360..170365,170459..170464,170675..170677,
                     170777..170779,170786..170788,170891..170893)
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    170891..170893
                     /gene="bioA"
                     /locus_tag="CNE_1c01710"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            171393..172607
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /db_xref="GeneID:10916563"
     CDS             171393..172607
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /EC_number="2.3.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_004684022.1"
                     /db_xref="GI:339324329"
                     /db_xref="GeneID:10916563"
                     /translation="MLLEQLRQAAEQRHALALTRRRRVAHTACAPHQAVGEDGSEPES
                     LLTFCSNDYMGLANHPDVIAALVEGAQRYGAGSGASHLVSGHSLAHTQLEAELARWLA
                     PHIPHARTLYFCTGYMANMAVLTALGTAGATLFCESLNHASLIDGARLARADVQRYPH
                     CDTAVLEALLAASTSERKLIVTDSVFSMDGNVAPLRKLLELAERHDAWIIVDDAHGFG
                     VLGEQGHGVLEALGLSSERLIYVGTLGKAAGVAGAFVAAHEAIIEHLVNTARPYIYTT
                     AAPPAVAHALLASLAILEGEEGRQRREQLTRCIAMLREGLAQLAAIAGWTLGDSETAI
                     QPLIVGDNGAALALSATLEADGIRVGAIRPPTVPEGTARLRITLSASHTEDDVRRLLD
                     ALSAAVAQWEAA"
     misc_feature    171483..172574
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    171519..172583
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    order(171543..171545,171735..171743,171813..171815,
                     171939..171941,171951..171956,172026..172028,
                     172032..172037,172119..172121,172128..172130,
                     172515..172517)
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    order(171735..171743,171813..171815,171939..171941,
                     171951..171953,172026..172028,172032..172037,
                     172119..172121,172128..172130)
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    172128..172130
                     /gene="bioF"
                     /locus_tag="CNE_1c01720"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            172604..173341
                     /gene="bioD"
                     /locus_tag="CNE_1c01730"
                     /db_xref="GeneID:10916564"
     CDS             172604..173341
                     /gene="bioD"
                     /locus_tag="CNE_1c01730"
                     /EC_number="6.3.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthetase BioD"
                     /protein_id="YP_004684023.1"
                     /db_xref="GI:339324330"
                     /db_xref="GeneID:10916564"
                     /translation="MSTRAPFACFVTGTDTGIGKTHASATLLHALHAAGYRTAGMKPV
                     ASGSEWRDGHWHNDDVAQLRAASSVAVPLGQTCPFLLRTPCSPHLAAAHEGVRITRAP
                     VRTAFDALRRQADAVVVEGVGGFNVPLDAGAVRWNTADLAVMLAVPVVMVVGIRLGCL
                     NHAVLTAEAIRARGLPLAGWIANRVDPDMLLADENIATLHASLDAPCLGELPWQLAPA
                     AAAGRLDLAPLFAAATQYQAEAAGLAA"
     misc_feature    172631..173290
                     /gene="bioD"
                     /locus_tag="CNE_1c01730"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     misc_feature    172631..173242
                     /gene="bioD"
                     /locus_tag="CNE_1c01730"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     gene            173361..174392
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /db_xref="GeneID:10916565"
     CDS             173361..174392
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /EC_number="2.8.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="YP_004684024.1"
                     /db_xref="GI:339324331"
                     /db_xref="GeneID:10916565"
                     /translation="MTQAHTATTVTTVSVDSLRQSARSHALPDDAAWRVDDVAALFAL
                     PFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCPQSAHHDAGVKAEKLM
                     ALDEVLDAARAAKANGATRFCMGAAWRSPKDRHLEPVMDMVREVKAMGLETCVTLGML
                     KAEQAQQLKDAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIGHVRDAGINVCCGGI
                     VGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEALDPFEFVRTIAVA
                     RITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQADRDRALLARL
                     DIRAEGYAG"
     misc_feature    173475..174365
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /note="biotin synthase; Region: bioB; TIGR00433"
                     /db_xref="CDD:232973"
     misc_feature    173586..174137
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(173595..173597,173601..173603,173607..173609,
                     173613..173621,173733..173735,173739..173744,
                     173820..173828,173895..173897,174012..174014,
                     174105..174110)
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    174096..174374
                     /gene="bioB"
                     /locus_tag="CNE_1c01740"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; smart00876"
                     /db_xref="CDD:214877"
     gene            174457..176484
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /db_xref="GeneID:10916566"
     CDS             174457..176484
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /EC_number="6.3.4.14"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-/propionyl-coenzyme A carboxylase alpha
                     chain"
                     /protein_id="YP_004684025.1"
                     /db_xref="GI:339324332"
                     /db_xref="GeneID:10916566"
                     /translation="MFNKILIANRGEIACRVAATCRRLGIRTVAVYSDADADARHVAF
                     CDEAVHIGGSAARDSYLRADHIIEMAKETGAQAIHPGYGFLSENEAFAEACAAAGLVF
                     IGPPASAIHAMGSKSAAKQLMEKAAVPLVPGYHGEDQGPALLRREADRIGYPVLLKAS
                     AGGGGKGMRVVESGDGFEAALASVKREASASFGDDKVLVEKYLTRPRHIEIQVFADTH
                     GNCVYLFERDCSVQRRHQKVLEEAPAPGMTEERRRAMGEAAVAAAKAVGYVGAGTVEF
                     IANQDGSFYFMEMNTRLQVEHPVTEMITGQDLVEWQLRVAAGEALPLTQDQLRIDGHA
                     LEARIYAENPDKQFLPSTGTLRFLRTPPAVQFMRGEDAHGPAGIRIDAGVREGDTISP
                     FYDPMIAKLIVWGKDRDEALARMRQALAAYHVVGLSTNVAFLQRLVSSQAFRTADLDT
                     GLIERNEKILFPPPAPVGLEVIALAVAALFDREARERRIDAADQHSPWTHGGTWRLNG
                     GVSRALRFGYGEQVLEVTLSTNERGSTLIYADQAAPFACTCQADDIRINLGTRRAHGQ
                     VHADDETFHVFYAGRHVSLAWLDPLAHAGETESEGGKLTAPMPGKVIAVMVEAGSTVT
                     RGTPLLVMEAMKMEHTISAPVDGVVSEVLYGVGEQVVEGAQLLAFEGKSGT"
     misc_feature    174457..176469
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="Acetyl/propionyl-CoA carboxylase, alpha subunit
                     [Lipid metabolism]; Region: COG4770"
                     /db_xref="CDD:227111"
     misc_feature    174460..174783
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    174802..175428
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    175462..175818
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     misc_feature    176266..176460
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    order(176332..176334,176359..176367,176386..176388)
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    176362..176364
                     /gene="accA1"
                     /locus_tag="CNE_1c01750"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            176593..177534
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /db_xref="GeneID:10916567"
     CDS             176593..177534
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /EC_number="1.1.1.79"
                     /EC_number="1.1.1.81"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate/hydroxypyruvate reductase A"
                     /protein_id="YP_004684026.1"
                     /db_xref="GI:339324333"
                     /db_xref="GeneID:10916567"
                     /translation="MKLQLYVPDGRYDPWIAGFAEALPEAQCVTWEDSRGEPADYAVV
                     WRPPVEMLRGRTDLKAVFNLGAGVDGILRLRDEAPDALPAGVPIVRLDDAGMAAQMAE
                     YVTHAVLRYFRKMDAYEAQQRAGNWKFLKPHRREDFTIGMMGVGTLGTHIARTLAGFG
                     FPVRGWSRTARAIEGVSGFYGDAGQAPFLDGLRVLVNVLPLTPQTENILNAGLFARLA
                     QGAYVINVARGQHLAEEDLLAAVQSGQVAGATLDVFRTEPLPAEHPFWQEPRITLTPH
                     ISALTLREDSIAQIAGKIRALRAGQPIAGVVDVQRGY"
     misc_feature    176593..177531
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    176593..177525
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="Putative glycerate dehydrogenase and related
                     proteins of the D-specific 2-hydroxy dehydrogenase family;
                     Region: GDH_like_2; cd12164"
                     /db_xref="CDD:240641"
     misc_feature    order(176728..176730,176785..176793,176878..176880,
                     177274..177276,177418..177420)
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240641"
     misc_feature    order(176788..176793,176860..176862,176878..176880,
                     176890..176892,177022..177036,177088..177099,
                     177103..177105,177184..177192,177202..177207,
                     177268..177276,177346..177351,177418..177420,
                     177424..177429,177523..177525)
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240641"
     misc_feature    order(176887..176889,176893..176901,176905..176910,
                     176917..176922,176929..176931,176935..176937,
                     176944..176949,176953..176958,176968..176973,
                     176977..176979,176986..176988,176995..176997,
                     177067..177069,177340..177342,177352..177354,
                     177361..177369,177373..177375,177385..177390,
                     177394..177396,177403..177405,177409..177417,
                     177421..177426,177436..177438)
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240641"
     misc_feature    order(177274..177276,177361..177363,177418..177420)
                     /gene="ghrA"
                     /locus_tag="CNE_1c01760"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240641"
     gene            177573..178508
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /db_xref="GeneID:10916568"
     CDS             177573..178508
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /EC_number="4.1.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase MvaB"
                     /protein_id="YP_004684027.1"
                     /db_xref="GI:339324334"
                     /db_xref="GeneID:10916568"
                     /translation="MTMPNYVKIVEVGPRDGLQNEKAMVPTEVKVALINQLTDAGFVN
                     IEAASFVSPKWVPQMADGADVMARIQRRPGTLYSALTPNMKGFESAIEAGADEVVIFG
                     AASEAFSQKNINCSIAESIARFAPVAAAAKEKGVRLRGSISCALGCPYQGEVPVHAVV
                     DVVRRMRELGCDEIDIADTIGVGTPVRVQEVMRAAAAEFALDRLSGHFHDTYGQALSN
                     ILASLEVGISIFHASVAGLGGCPYAKGATGNVATEDVLYMLHGMGIHTGIDLEAVVRT
                     GDYISQAIGRANSSRVGRALLTRWAAASDAAPACA"
     misc_feature    177591..>178466
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /note="Isopropylmalate/homocitrate/citramalate synthases
                     [Amino acid transport and metabolism]; Region: LeuA;
                     COG0119"
                     /db_xref="CDD:223197"
     misc_feature    177597..178418
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /note="3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM
                     barrel domain; Region: DRE_TIM_HMGL; cd07938"
                     /db_xref="CDD:163676"
     misc_feature    order(177615..177620,177627..177629,177717..177719,
                     177723..177725,177873..177875,178191..178193,
                     178197..178199,178317..178319)
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /note="active site"
                     /db_xref="CDD:163676"
     misc_feature    order(177615..177620,177708..177710)
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163676"
     misc_feature    order(177618..177620,178191..178193,178197..178199,
                     178317..178319)
                     /gene="mvaB1"
                     /locus_tag="CNE_1c01770"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163676"
     gene            178550..179050
                     /locus_tag="CNE_1c01780"
                     /db_xref="GeneID:10916569"
     CDS             178550..179050
                     /locus_tag="CNE_1c01780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684028.1"
                     /db_xref="GI:339324335"
                     /db_xref="GeneID:10916569"
                     /translation="MTVNDEALPESAQRVADLLAGLGHDRPVVMLPATGKTSAEAAAG
                     LGCSVAEIAKSIIFRRVADDAPVLVIASGSNRVDEAKVAAHVGALGKADARFVREKTG
                     YAIGGVCPIGHAVAPVMLLDQDLFRYDSLWAAAGHPHAVFNLTPQQLQQMTGAEVADV
                     AAGSVA"
     misc_feature    178583..179029
                     /locus_tag="CNE_1c01780"
                     /note="This CD, composed mainly of bacterial single-domain
                     proteins, includes the Thermus thermophilus (Tt) YbaK-like
                     protein, a homolog of the trans-acting Escherichia coli
                     YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium
                     tumefaciens  ProX Ala-tRNA(Pro)...; Region:
                     ProX_deacylase; cd04333"
                     /db_xref="CDD:239825"
     misc_feature    order(178709..178711,178865..178870,178949..178951)
                     /locus_tag="CNE_1c01780"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239825"
     gene            179047..179475
                     /locus_tag="CNE_1c01790"
                     /db_xref="GeneID:10916570"
     CDS             179047..179475
                     /locus_tag="CNE_1c01790"
                     /EC_number="3.1.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="YP_004684029.1"
                     /db_xref="GI:339324336"
                     /db_xref="GeneID:10916570"
                     /translation="MSPNLRPGLTFSWQYTVPPKATVPRLYDDIPGCPEMPDVLATGY
                     MVGIMECACLQMLREHLDWPREQSLGTLVSFSHLAPTPPGMTVTVKGELVAVDGRRLR
                     FQLSAWDGEDKISEGVHERHLIDAGRFNEKVAAKAARAAG"
     misc_feature    179173..179388
                     /locus_tag="CNE_1c01790"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cd03440"
                     /db_xref="CDD:239524"
     misc_feature    order(179185..179187,179194..179199,179206..179208,
                     179257..179265)
                     /locus_tag="CNE_1c01790"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     misc_feature    179275..179286
                     /locus_tag="CNE_1c01790"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     gene            179739..180695
                     /gene="gloB1"
                     /locus_tag="CNE_1c01800"
                     /db_xref="GeneID:10916571"
     CDS             179739..180695
                     /gene="gloB1"
                     /locus_tag="CNE_1c01800"
                     /EC_number="3.1.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase GloB"
                     /protein_id="YP_004684030.1"
                     /db_xref="GI:339324337"
                     /db_xref="GeneID:10916571"
                     /translation="MAGRRGDIPLNESPVPHLPATMRVFERGWLSANNILFVEGDDTA
                     LVDTGYVTHAPQTVALVAAALQGRPLARVINTHLHSDHCGGNAALQARWQPRTAIPAA
                     EAAAVAAWDTEALSYNATGQQCDRFTFDSVLNDGDRLRLGGIDWQVVAAPGHDPHAVM
                     LFAPAERILVSGDALWENGFGVIFPELDGESGFAEQAAVLERIAQLDARLVIPGHGRM
                     FTDVAAAVERAQGRLAYLGADPARNASHAVKVLVKFKLLEQQRMTQDALVAWMEAAPL
                     MVRIRQRFMPGLAIAEICAQTVRALAGVKALAVEGEWVVNRD"
     misc_feature    179838..180383
                     /gene="gloB1"
                     /locus_tag="CNE_1c01800"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(180718..182910)
                     /locus_tag="CNE_1c01810"
                     /db_xref="GeneID:10916572"
     CDS             complement(180718..182910)
                     /locus_tag="CNE_1c01810"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent outer membrane receptor"
                     /protein_id="YP_004684031.1"
                     /db_xref="GI:339324338"
                     /db_xref="GeneID:10916572"
                     /translation="MSKNRYTAPTSAPRLTPLAALAASLTATMATAFVAPAALAQAAT
                     APAADSAPATATATATAPAGATLREVVVTANPLGSDLNDMVAPVSTLGGDALAVRQGS
                     TLGDTLDKLPGVSSSYFGPNASRPVIRGLDGDRIKVLQNGGTTVDASTLSYDHAVPVD
                     PLVAERIEVVRGPAALMYGGNAIGGVVNVIDNRIPKEPIEGIGGAVDASATAGGDQAR
                     NASALIEAGNGKFAVHADAFARKTSDLHIPGYARSDRLRTTDPLPAGETEAYGRLPNT
                     SAQQEGGAMGGSYTWADGFVGANYSAYRNEYGTPAEDDVRLKMRQDRFALEGEARNLA
                     GNTAGWLESVKGKFSYTDYEHKEIEGGETGTIFKNRGWDARLEARHAKIGNMTGVIGT
                     QFGHTDFSALGEEAFVPSTNTDNAALFVFEELPLTASGDLKLNLGGRLDHSSIKASAN
                     GNDRFTDANRSFNATSASAGLLYKVNPLWSLTSNLSYTERAPTFYELYANGPHVATGA
                     WELGDPNANKERATSIDLGVRFKSGAHSAGVSGYYSRFANYLALNATGRTRDEAGDVI
                     AAGSPGALPEFQYLGVPATLYGFEAEGKTRLLQKMLTTSDTLDFEARADYVRGENRDT
                     GEPLPRLAPLRLGGALVYGAGPWGARVDVTYAAKQTRVPTNDTPTDAYTLLSLALTYK
                     FKVSGTQTLVYLRGDNLTNQDARNSASILRDIAPLAGRSVKVGFRTSF"
     misc_feature    complement(180721..182712)
                     /locus_tag="CNE_1c01810"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    complement(180721..182652)
                     /locus_tag="CNE_1c01810"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(182326..182331,182344..182364,
                     182398..182430,182476..182499,182518..182535,
                     182566..182595,182623..182652))
                     /locus_tag="CNE_1c01810"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(181774..181776,181846..181848))
                     /locus_tag="CNE_1c01810"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(183070..183471)
                     /locus_tag="CNE_1c01820"
                     /db_xref="GeneID:10916573"
     CDS             complement(183070..183471)
                     /locus_tag="CNE_1c01820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684032.1"
                     /db_xref="GI:339324339"
                     /db_xref="GeneID:10916573"
                     /translation="MRTDWFARLRTHGPGLWSALWLALCLLLAQYAGLTHRIVHGGLL
                     APSATVTTADAASANDPEPHPLAQKFSGHSCVLFDGATVADTLCGKLPLPQLAFGKPV
                     KPANLAWRWPDLPATHPFQSRAPPAPAIALA"
     gene            complement(183461..184753)
                     /gene="yciC"
                     /locus_tag="CNE_1c01830"
                     /db_xref="GeneID:10916574"
     CDS             complement(183461..184753)
                     /gene="yciC"
                     /locus_tag="CNE_1c01830"
                     /codon_start=1
                     /transl_table=11
                     /product="metal chaperone YciC"
                     /protein_id="YP_004684033.1"
                     /db_xref="GI:339324340"
                     /db_xref="GeneID:10916574"
                     /translation="MADRLPVTVLSGFPGAGKTTLLNHLLAHSASRRMAVLVCGPQNG
                     QALAPLPPGCEAAVLPAGDALLGEVARLAAEGRFDALLMEADGLDEPLAIAEGFLFEA
                     EHGAGPDATVQPDTLVTVIDAATFLRDLNEAEFLADRGLAQATDDDRTVAEVLVAQVE
                     CCDVIVLNKADLASAAELARLHAVLQALNPRADIVEASFGKVPPERVQGTGRFDFEAA
                     ADAPGWLAALRGEALAANASGVSTLVYRRRRPFHPQRFADLIHTEWLREHGSVLRSRG
                     LFWLASRMDTAGDWNQSGGVCRHGGAGAWWAALDPAEWPADSAERAEVEADMQVDGAP
                     AAFGDRRQELVLTGLDLDHAALQARLDACLLTDAEMSAGAQAWAAYEDPFPGWVDDFD
                     DDHEHDHGHDHGDSHGNDCGCGDPDHHHGNHAGHPHAH"
     misc_feature    complement(183656..184741)
                     /gene="yciC"
                     /locus_tag="CNE_1c01830"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    complement(184166..184738)
                     /gene="yciC"
                     /locus_tag="CNE_1c01830"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(183662..184036)
                     /gene="yciC"
                     /locus_tag="CNE_1c01830"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; smart00833"
                     /db_xref="CDD:214844"
     gene            complement(184986..185672)
                     /gene="dksA"
                     /locus_tag="CNE_1c01840"
                     /db_xref="GeneID:10916575"
     CDS             complement(184986..185672)
                     /gene="dksA"
                     /locus_tag="CNE_1c01840"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaK suppressor protein DksA"
                     /protein_id="YP_004684034.1"
                     /db_xref="GI:339324341"
                     /db_xref="GeneID:10916575"
                     /translation="MTAATKTKESRSKTGSAAAETLKAQPVKAAPAPRGSTANAEAGA
                     TKGGPRSSKTAASQSETAVARKRADSAPERTQTPPAASTRESAATMSSNKLLTEAEIL
                     KMSDKDYMNEAQLAFFKHRLEQLRDEILKNADQTTEHLRETVIVPDPADRATIEEEHA
                     LELRTRDRERKLLKKVEQSLQRIESGDYGWCEETGEPIGVPRLLARPTATLSLEAQQR
                     RELRQKLFGD"
     misc_feature    complement(185019..185345)
                     /gene="dksA"
                     /locus_tag="CNE_1c01840"
                     /note="RNA polymerase-binding protein DksA; Region: dksA;
                     TIGR02420"
                     /db_xref="CDD:131473"
     gene            complement(186019..187104)
                     /locus_tag="CNE_1c01850"
                     /db_xref="GeneID:10916576"
     CDS             complement(186019..187104)
                     /locus_tag="CNE_1c01850"
                     /EC_number="3.6.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase G3E family"
                     /protein_id="YP_004684035.1"
                     /db_xref="GI:339324342"
                     /db_xref="GeneID:10916576"
                     /translation="MSKLTPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEE
                     NIDNEILVQDGREQIVQMSNGCICCTIRGDLVQALSTLLTRRDAGEIGFDRVVIETTG
                     VANPGPVAQTFFMDEEIASRYLLDAVITLVDAKHAHLQLDKQEEAQRQVGFADAIFIT
                     KSDLVTEADVAELRHRLLHMNPRAPIRLVNFGEAPIDTIFDLRGFNLNAKLEIDPEFL
                     RADDHDHDHDHEHGEHCGDDCGHDHGHDHAHGHGHAHDHHHHHHHTDRIASFVFRSDK
                     PFHYGKLEEFLSGILAVYGEKLLRYKGVLYMDGVDRKVVFQGVHQLMGSDIGAKWEEE
                     TPGTRMVFIGVDLPRDAILKGLENCLA"
     misc_feature    complement(186022..187092)
                     /locus_tag="CNE_1c01850"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    complement(186613..187089)
                     /locus_tag="CNE_1c01850"
                     /note="The function of this protein family is unkown. The
                     amino acid sequence of YjiA protein in E. coli contains
                     several conserved motifs that characterizes it as a P-loop
                     GTPase. YijA gene is among the genes significantly induced
                     in response to DNA-damage...; Region: CobW_like; cd03112"
                     /db_xref="CDD:239386"
     misc_feature    complement(187048..187071)
                     /locus_tag="CNE_1c01850"
                     /note="P-loop, Walker A motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    complement(186616..186627)
                     /locus_tag="CNE_1c01850"
                     /note="Base recognition motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    complement(186025..186306)
                     /locus_tag="CNE_1c01850"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; pfam07683"
                     /db_xref="CDD:254355"
     gene            complement(187135..187671)
                     /locus_tag="CNE_1c01860"
                     /db_xref="GeneID:10916577"
     CDS             complement(187135..187671)
                     /locus_tag="CNE_1c01860"
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="YP_004684036.1"
                     /db_xref="GI:339324343"
                     /db_xref="GeneID:10916577"
                     /translation="MTRPSPDRPAAVPEPAIPTPASLEAAHERLRQLGARVTQPRLCI
                     LACLIGSDEALTHQAVIDRLPEPGETIDRVTVYRVLDWLVEQGVAQKRAGNDRVFRFS
                     LVEHEAARAQEHRQHSHFHCTRCDRTFCLDDASAPVQPAAPRVPSGFAIEHVELTVNG
                     VCAECGKRAPASPGGASH"
     misc_feature    complement(187186..187554)
                     /locus_tag="CNE_1c01860"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(187282..187284,187315..187317,
                     187321..187323,187366..187368,187510..187512))
                     /locus_tag="CNE_1c01860"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(187414..187458)
                     /locus_tag="CNE_1c01860"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(187210..187212,187261..187263,
                     187318..187320,187324..187326))
                     /locus_tag="CNE_1c01860"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(187189..187215,187219..187227,
                     187252..187257,187303..187311))
                     /locus_tag="CNE_1c01860"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(187186..187188,187297..187299,
                     187306..187308))
                     /locus_tag="CNE_1c01860"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            187819..188718
                     /gene="dehH"
                     /locus_tag="CNE_1c01870"
                     /db_xref="GeneID:10916578"
     CDS             187819..188718
                     /gene="dehH"
                     /locus_tag="CNE_1c01870"
                     /EC_number="3.8.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacetate dehalogenase H-1"
                     /protein_id="YP_004684037.1"
                     /db_xref="GI:339324344"
                     /db_xref="GeneID:10916578"
                     /translation="MLNDASALLFPNFETFRQRVGEVEIAGVRGGSGPPLLLLHGHPQ
                     SHLIWHRVAPALADHFTVIATDLRGYGSSSAPPGNAGHEHYSKRTMAQDQVSLMAAFG
                     FEHFALCGHDRGARVAHRLCMDHPEAVSRAMLLDIAPTLAMYERTSMAFAAAYWHWFF
                     LIQPAPFPETLINAEPDFYIEKLMGLRHAGLTPFAPDAMAAYTAAMRDPARVHAMCED
                     YRAAATIDLEHDRADREAGRRLALPLRVLWGEHGVVARCFEPLALWQEVATDISGQAL
                     PCGHYIPEEAAEPLLEEMLSFFR"
     misc_feature    187900..188715
                     /gene="dehH"
                     /locus_tag="CNE_1c01870"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    187912..>188277
                     /gene="dehH"
                     /locus_tag="CNE_1c01870"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            189014..190000
                     /locus_tag="CNE_1c01880"
                     /db_xref="GeneID:10916579"
     CDS             189014..190000
                     /locus_tag="CNE_1c01880"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004684038.1"
                     /db_xref="GI:339324345"
                     /db_xref="GeneID:10916579"
                     /translation="MKRVVKMVAGALAVSAMGVAAGAYAQEFPGGKPISAVVPFSAGG
                     PTDKVSRELTAIMSKHLGSTIVIENLGGAGGTIGAKKVAQAKNDGHTVLIHHIGMATA
                     PALYRNLGFDPLKDFEMIGEIADVPMILVGNKSLPPNTFKDLLPYIKANAGKLSLANA
                     GIGSASHLCGLLFQSAIQTELTTVPYKGAAPALTDILGGQVNLLCDQTTNLAGHLKAH
                     SVKPYAAMQARRVEAFKDVPTAAEQGMPGVEVKVWHAMYAPKGTPKPVIDKLSAALQK
                     SVADPAFRAKMAELGAEAVPAQRATPDSLRNYLTAEINKWTPVIKKAGVYAD"
     misc_feature    189158..189985
                     /locus_tag="CNE_1c01880"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            190230..190766
                     /gene="hslV"
                     /locus_tag="CNE_1c01890"
                     /db_xref="GeneID:10916580"
     CDS             190230..190766
                     /gene="hslV"
                     /locus_tag="CNE_1c01890"
                     /EC_number="3.4.25.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease subunit HslV"
                     /protein_id="YP_004684039.1"
                     /db_xref="GI:339324346"
                     /db_xref="GeneID:10916580"
                     /translation="MEQYHGTTIVSVRRGNQVALGGDGQVTLGNIVMKGTARKVRRIY
                     NGKVLVGFAGSTADAFSLLDRFEAKLEKYQGNLTRAAVDLAKDWRSDRALRRLEAMLI
                     TADRDTTLVITGNGDVLDPEGGIAAIGSGGAYAQSAAKALVENTEMAPKDVVEKALTI
                     AGELCIYTNTNFVIETLE"
     misc_feature    190248..190760
                     /gene="hslV"
                     /locus_tag="CNE_1c01890"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    order(190248..190250,190296..190298,190302..190304,
                     190344..190346,190617..190619)
                     /gene="hslV"
                     /locus_tag="CNE_1c01890"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    order(190317..190325,190494..190496,190575..190577,
                     190587..190589,190626..190631,190638..190640,
                     190662..190664,190695..190697,190707..190709,
                     190716..190721,190725..190727)
                     /gene="hslV"
                     /locus_tag="CNE_1c01890"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            190817..192148
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /db_xref="GeneID:10916581"
     CDS             190817..192148
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATPase subunit HslU"
                     /protein_id="YP_004684040.1"
                     /db_xref="GI:339324347"
                     /db_xref="GeneID:10916581"
                     /translation="MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEP
                     LRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVR
                     DLAEMAIKQTRESEMKKVRTKAEDAAEDRLLDVLLPPARDIGFSQPEEKDSNTRQVFR
                     KKLREGSLDDKEIELELSAGMPSMDIMGPPGMEDMTEQIRTMFAGLGQGKKARRKMKV
                     KEAFKLLIDEEAAKLVNDEELKHKAIANVEQNGIVFLDEIDKIASRSEIGGGEVSRQG
                     VQRDLLPLVEGTTVSTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELDS
                     LSVQDFEAILTQTDASLTKQYQALLSTEEVSLVFAPDGIRRLAEIAFSVNEKVENIGA
                     RRLYTVMERLLEDLSFHATRSSGETVTIDAAYVDERLGDLAGNEDLSRYVL"
     misc_feature    190826..192145
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    190871..>191152
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    190988..191011
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    190991..191014
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    <191492..191818
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    191570..191587
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    191789..191791
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    191819..192103
                     /gene="hslU"
                     /locus_tag="CNE_1c01900"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            192494..192787
                     /locus_tag="CNE_1c01910"
                     /db_xref="GeneID:10916582"
     CDS             192494..192787
                     /locus_tag="CNE_1c01910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684041.1"
                     /db_xref="GI:339324348"
                     /db_xref="GeneID:10916582"
                     /translation="MVNYKTRRVVLTTGGLLAALAAATAFLCVRPAIPAAEAAQSGTV
                     GAAAAAAATLALDSGALFTLADRHAGDAMRIAQGSTPQDRAEGLDWDYVQLRL"
     gene            complement(192861..193472)
                     /locus_tag="CNE_1c01920"
                     /db_xref="GeneID:10916583"
     CDS             complement(192861..193472)
                     /locus_tag="CNE_1c01920"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator containing a Fis-type
                     DNA-binding domain"
                     /protein_id="YP_004684042.1"
                     /db_xref="GI:339324349"
                     /db_xref="GeneID:10916583"
                     /translation="MTDTLPPVPEAIAPAGTPFLVIDDDEVFAGTLARALTRRGYAVQ
                     VAHDSRTALALASRIEFAYVTLDLHLEPPPDAGSTVPAESGLQLVSPLRQALPDARIL
                     ILTGYASIATAVAAVKQGADEYLAKPANVDSILTALMAGVSEDAAQAALEEPVPLSVA
                     RLEWEHIQRVLAEHDGNISATARALNMHRRTLQRKLGKRPVSR"
     misc_feature    complement(192867..193418)
                     /locus_tag="CNE_1c01920"
                     /note="Response regulator consisting of a CheY-like
                     receiver domain and a Fis-type HTH domain [Signal
                     transduction mechanisms / Transcription]; Region: COG4567"
                     /db_xref="CDD:226933"
     misc_feature    complement(193053..193415)
                     /locus_tag="CNE_1c01920"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(193089..193094,193101..193103,
                     193158..193160,193218..193220,193272..193274,
                     193401..193406))
                     /locus_tag="CNE_1c01920"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(193272..193274)
                     /locus_tag="CNE_1c01920"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(193218..193226,193230..193232,
                     193263..193265))
                     /locus_tag="CNE_1c01920"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(193086..193094)
                     /locus_tag="CNE_1c01920"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(192879..193001)
                     /locus_tag="CNE_1c01920"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(193469..194863)
                     /locus_tag="CNE_1c01930"
                     /db_xref="GeneID:10916584"
     CDS             complement(193469..194863)
                     /locus_tag="CNE_1c01930"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_004684043.1"
                     /db_xref="GI:339324350"
                     /db_xref="GeneID:10916584"
                     /translation="MTTAAAVTRLPDLPFLSPLPAGTSARHGQVTLRRLFWLRWALLA
                     GQALTVLSCEPIAGIRLPYGPLLVVFGLQALFNLLTGLRLRQHTRRNSAPGEAELMGQ
                     LLVDLTALSAILFYTGGATNPFVSFYLPGLAIAAAILPWRQVIALALYALACYTLLLF
                     EYVPLDLHNPDNAVNYHLAGMWLNFVASAVMIALFVARLSGVLRQREAQLNLAREQLL
                     REARVEDLNGQAAAVAHEIGTPLATLAVIAGELRADASDAGRGTSAINGYLPDLQTME
                     QQLALCRTTLARLREDPATLAPQRIDGWLPAFAERWQLRHPNASLQASATPGAGAQAV
                     ETARVGQILTILLDNAARSQQTASRGQEPLQLQIAMAPGNTAPWLSFRIADHGDGIPE
                     MLRGQLGETPVASQHGGQGIGLYLAQSAARQMGGELAWHDRAGGGTVAELRLPALSTL
                     SASAATAAMAPRIP"
     misc_feature    complement(193529..194536)
                     /locus_tag="CNE_1c01930"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(193532..193843)
                     /locus_tag="CNE_1c01930"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(193544..193546,193550..193555,
                     193568..193570,193574..193576,193622..193633,
                     193694..193699,193703..193705,193709..193711,
                     193715..193717,193808..193810,193817..193819,
                     193829..193831))
                     /locus_tag="CNE_1c01930"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(193817..193819)
                     /locus_tag="CNE_1c01930"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(193625..193627,193631..193633,
                     193697..193699,193703..193705))
                     /locus_tag="CNE_1c01930"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            195040..195528
                     /locus_tag="CNE_1c01940"
                     /db_xref="GeneID:10916585"
     CDS             195040..195528
                     /locus_tag="CNE_1c01940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684044.1"
                     /db_xref="GI:339324351"
                     /db_xref="GeneID:10916585"
                     /translation="MQAKFRSATLAASVALAAALASGAALAQVDVSNAWVRGTVPTQT
                     ASGAFMVLHAHDDAKLVGVSSPVGAAELHEMKMEGNVMRMRQVKSLDLPKMKDVELKP
                     GGYHVMLMDLKSQLKKGDTVPITLKIEQGGKVTEQKVTAEVRDMVPAIAGASGGHGEH
                     KH"
     misc_feature    195136..195444
                     /locus_tag="CNE_1c01940"
                     /note="Protein of unknown function (DUF461); Region:
                     DUF461; pfam04314"
                     /db_xref="CDD:252520"
     gene            complement(195708..196643)
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /db_xref="GeneID:10916586"
     CDS             complement(195708..196643)
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-typetranscriptional regulator SyrM"
                     /protein_id="YP_004684045.1"
                     /db_xref="GI:339324352"
                     /db_xref="GeneID:10916586"
                     /translation="MNSLRGIDLNLLVVLEALLAERHISRAALRLHLSQPAVSHALGR
                     LRQLLDDPILVRGKGGLVLSARAHELSGPLAEALAQVRILLGPSGFQPATARRSFRLA
                     MSDYGALVVLPRLLRAVRKAAPNIDLVVSQASREGMTAQVADGEIDMALGVFTHQPEG
                     VKSAELFCESYACAVDAATVRDTGRLDQVAYLARSHVLVATHSERMDAIDTAVAKLGG
                     RRKIACVVPHWSVAPALIAGTNLVLTTARRSLAALEEDPRYAVFAPPFALDDFTFSMI
                     WHERTEADPAHTWLRERVLAAAASQESEEPISLRG"
     misc_feature    complement(195768..196640)
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /note="leucine transcriptional activator; Reviewed;
                     Region: leuO; PRK09508"
                     /db_xref="CDD:181918"
     misc_feature    complement(196440..>196580)
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(195753..196349)
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator ToxR regulates the
                     expression of the toxoflavin biosynthesis genes; contains
                     the type 2 periplasmic bindinig fold; Region: PBP2_ToxR;
                     cd08465"
                     /db_xref="CDD:176154"
     misc_feature    complement(order(195825..195827,196026..196028,
                     196137..196139,196311..196313,196323..196328,
                     196332..196334))
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176154"
     misc_feature    complement(order(195888..195890,195930..195932,
                     195939..195944,195951..195956,195963..195977,
                     196059..196061,196248..196250,196254..196268,
                     196272..196277,196284..196289,196293..196298,
                     196305..196310,196317..196322,196329..196331))
                     /gene="syrM"
                     /locus_tag="CNE_1c01950"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176154"
     gene            196737..197267
                     /locus_tag="CNE_1c01960"
                     /db_xref="GeneID:10916587"
     CDS             196737..197267
                     /locus_tag="CNE_1c01960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684046.1"
                     /db_xref="GI:339324353"
                     /db_xref="GeneID:10916587"
                     /translation="MSGTQLPFSLPVSLWLPLGTAVLAGAAIPFQAGANATLGRTLGH
                     PLSATLVSLLVSLAALLPVLWLMRVPLPAPSALARAPGWLWIGGVLGVFYISAALMMA
                     PRLGAAGFIAAVVAGQVLAALLVDQFGLAGFAVRALTPARLAGAALIVAGMLVMQWGS
                     ATASGPASQPAAESGS"
     misc_feature    196782..197201
                     /locus_tag="CNE_1c01960"
                     /note="Protein of unknown function, DUF606; Region:
                     DUF606; pfam04657"
                     /db_xref="CDD:252723"
     gene            complement(197240..197482)
                     /locus_tag="CNE_1c01970"
                     /db_xref="GeneID:10916588"
     CDS             complement(197240..197482)
                     /locus_tag="CNE_1c01970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684047.1"
                     /db_xref="GI:339324354"
                     /db_xref="GeneID:10916588"
                     /translation="MSDASAVLTGQPRPVEHCSHCGAGFVCGYVAGLPECWCASQPLL
                     PARRIVPGQHCLCPACLAERRQAAQEPAQEPDSAAG"
     misc_feature    complement(197294..197431)
                     /locus_tag="CNE_1c01970"
                     /note="Cysteine-rich CWC; Region: Cys_rich_CWC; pfam14375"
                     /db_xref="CDD:258545"
     gene            197829..198755
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /db_xref="GeneID:10916589"
     CDS             197829..198755
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /EC_number="2.7.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase ArgB"
                     /protein_id="YP_004684048.1"
                     /db_xref="GI:339324355"
                     /db_xref="GeneID:10916589"
                     /translation="MSPMNADNPGPAATTVAAIAPALKAEILAEALPYIRKFHGKTIV
                     VKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQIDEALKKVGKVGTFVQGM
                     RVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLIRAKRLQMPDRENP
                     GAFIDIGYVGDIEAINPAVVKALQDDAFIPVISPIGFSDDGQAYNINADVVAGKMAEI
                     LKAEKLVMMTNIPGVMDKKGNLLTDLSAREIEELFADGTISGGMLPKISSALDAAKSG
                     VHSVHIIDGRIEHSLLLEILTEQAFGTMIRSH"
     misc_feature    197907..198743
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /note="AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic
                     (NAGK-C) catalyzes the phosphorylation of the gamma-COOH
                     group of N-acetyl-L-glutamate (NAG) by ATP in the second
                     step of arginine biosynthesis found in some bacteria and
                     photosynthetic organisms using the...; Region: AAK_NAGK-C;
                     cd04250"
                     /db_xref="CDD:239783"
     misc_feature    197907..197936
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /note="feedback inhibition sensing region; other site"
                     /db_xref="CDD:239783"
     misc_feature    order(197910..197918,197922..197924,197931..197936,
                     198015..198017,198027..198029,198039..198041,
                     198099..198104,198159..198161,198168..198173,
                     198186..198188,198195..198197,198207..198209,
                     198228..198230,198234..198242,198246..198248,
                     198252..198263,198363..198365,198390..198392,
                     198693..198695,198702..198707,198717..198719)
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /note="homohexameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239783"
     misc_feature    order(197964..197966,197973..197978,198447..198449,
                     198510..198518,198528..198530,198597..198599,
                     198603..198605,198609..198614,198621..198623)
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239783"
     misc_feature    order(198066..198071,198132..198137,198441..198443,
                     198447..198452)
                     /gene="argB"
                     /locus_tag="CNE_1c01980"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239783"
     gene            198827..199765
                     /locus_tag="CNE_1c01990"
                     /db_xref="GeneID:10916590"
     CDS             198827..199765
                     /locus_tag="CNE_1c01990"
                     /EC_number="3.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="YP_004684049.1"
                     /db_xref="GI:339324356"
                     /db_xref="GeneID:10916590"
                     /translation="MPSSLPSPRRVRARLCRRPAGNTSGDTVWLFDLDNTLHDASHAI
                     FPAINRLMTDYVARVLGCDEATASRVRVDYWQRYGATLLGMIRHHGVDPADFLRAAHE
                     FPELADMVRVRRGLAAHLRRLPGRKILVTNAPQDYARAVLEIAGIRHCFERVVAIEQM
                     WVHGHLRPKPDRRMLRRLLVQTRIAPHRAVLVEDTVSHLKRYAGTGIRTAWVTGYLRT
                     IAPSRPHEVPAVRDDGSRRDAAVRSTLEAEDRRHVGHAAQEQSVTLVAAETQAPQAQP
                     DNVPRVRARVPNRPAYVNIKVQSMHQLQRRMRRIGS"
     misc_feature    198905..199453
                     /locus_tag="CNE_1c01990"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    198911..199462
                     /locus_tag="CNE_1c01990"
                     /note="Haloacid dehalogenase-like hydrolase; Region:
                     HAD_2; pfam13419"
                     /db_xref="CDD:257744"
     gene            199762..200433
                     /locus_tag="CNE_1c02000"
                     /db_xref="GeneID:10916591"
     CDS             199762..200433
                     /locus_tag="CNE_1c02000"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004684050.1"
                     /db_xref="GI:339324357"
                     /db_xref="GeneID:10916591"
                     /translation="MTQSNGREPEAVISGSAQDAQDGGQPPATPARKRPRPGERRVQI
                     LQTLATMLEHPRGEKITTAALAARLSVSEAALYRHFASKAQMYEGLIGFIEQTVFGLI
                     NQITDKEEHGLRQAHAIVRMLLSFAEKNPGMTRVLTGEALVGEHERLQERINQLVDRI
                     EASLRQCLKMAVTQAAFPADADIPARAALIMAAVQGQWHRYAKSGFRKSPSDHAEAHL
                     RVLLS"
     misc_feature    199849..200430
                     /locus_tag="CNE_1c02000"
                     /note="division inhibitor protein; Provisional; Region:
                     slmA; PRK09480"
                     /db_xref="CDD:181894"
     misc_feature    <199933..200031
                     /locus_tag="CNE_1c02000"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            200709..201890
                     /gene="metX"
                     /locus_tag="CNE_1c02010"
                     /db_xref="GeneID:10916592"
     CDS             200709..201890
                     /gene="metX"
                     /locus_tag="CNE_1c02010"
                     /EC_number="2.3.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase MetX"
                     /protein_id="YP_004684051.1"
                     /db_xref="GI:339324358"
                     /db_xref="GeneID:10916592"
                     /translation="MTDVALPTATPAAFDLPPDSVGVVTPQRMHFAEPLKLRNGSSIA
                     GYDLMVETYGTLNAARSNAVLVCHALNASHHVAGVYAEDPRDVGWWDNMVGPGKPLDT
                     NRFFVIGVNNLGSCFGSTGPMSLNPATGAPYGAAFPVVTVEDWVNAQARVADAFGITQ
                     FAAVMGGSLGGMQAVAWSLMYPDRLRHCIVVASTPKLSAQNIAFNEVARSAILSDPDF
                     HGGNYYAHGVKPKRGLRVARMIGHITYLSDEDMAEKFGRELKTDDIRFSFDVEFQVES
                     YLRYQGDKFAEYFDANTYLLITRALDYFDPALAFGGDLTRAMAQTQASFLVASFGTDW
                     RFAPSRSRELVKALLDNKRPVSYAEIDAPHGHDAFLLDDPRYHNLMRAYYDRIAEEIG
                     A"
     misc_feature    200751..201884
                     /gene="metX"
                     /locus_tag="CNE_1c02010"
                     /note="homoserine O-acetyltransferase; Provisional;
                     Region: metX; PRK00175"
                     /db_xref="CDD:234678"
     misc_feature    200799..201857
                     /gene="metX"
                     /locus_tag="CNE_1c02010"
                     /note="homoserine O-acetyltransferase; Region:
                     homoserO_Ac_trn; TIGR01392"
                     /db_xref="CDD:233393"
     gene            201887..202498
                     /gene="metW"
                     /locus_tag="CNE_1c02020"
                     /db_xref="GeneID:10916593"
     CDS             201887..202498
                     /gene="metW"
                     /locus_tag="CNE_1c02020"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="YP_004684052.1"
                     /db_xref="GI:339324359"
                     /db_xref="GeneID:10916593"
                     /translation="MNALANPNILALRPDFRAIARWIEPNSTVLDLGCGDGSLLRVLQ
                     DELDVQAYGIEIRDEGVLACAQKGVHVIQQNLEGGLALFEDKSFDTVILSQTLQTIHN
                     TAQVLRDTLRVGRECIVSFPNFGYWPHRLSVFRGRMPVSESLPYQWYNTPNVRVLTIS
                     DFEALAPKVGLRVIDRVVMHEGVTVNWGGNWRGSLAVYRVCAA"
     misc_feature    201953..>202255
                     /gene="metW"
                     /locus_tag="CNE_1c02020"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    201968..202234
                     /gene="metW"
                     /locus_tag="CNE_1c02020"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(201980..202000,202049..202054,202106..202114,
                     202166..202168)
                     /gene="metW"
                     /locus_tag="CNE_1c02020"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(202499..203413)
                     /locus_tag="CNE_1c02030"
                     /db_xref="GeneID:10916594"
     CDS             complement(202499..203413)
                     /locus_tag="CNE_1c02030"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004684053.1"
                     /db_xref="GI:339324360"
                     /db_xref="GeneID:10916594"
                     /translation="MPDMPLNAMAVFARVVECGSFSAAALDLGMTPSAVSRHVSRLEA
                     TLGASLLQRTTRAFALTELGQSVYAACARMTAAAREVTALAGEHGGTPHGVLRVSAPV
                     SFGQAWLAPRLPALLAKYPGLDLQLTLADRMVDLVEEGMDVAVRIARELAPGLAARPL
                     REVRYRLVASPGYLARHGTPATPADLPAARCLYLGYGNFGERWTMRHHAGGEKVEVRI
                     PPRLTLNNSLAIMSMVERDAGIGLVPDFSLGDALDQGRVVTVLADWDILEPYIGTAYA
                     VYTPTRHVPPKVRAFVDHLAATAADAPA"
     misc_feature    complement(202529..203404)
                     /locus_tag="CNE_1c02030"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(203219..203398)
                     /locus_tag="CNE_1c02030"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(202529..203134)
                     /locus_tag="CNE_1c02030"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(202592..202594,202682..202684,
                     202733..202735,202925..202927,202931..202933,
                     202973..202975,203090..203092,203102..203104))
                     /locus_tag="CNE_1c02030"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(202706..202708,202715..202720,
                     202739..202753,202844..202846,203027..203047,
                     203051..203053,203063..203065,203072..203077,
                     203081..203086,203096..203101))
                     /locus_tag="CNE_1c02030"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            203524..204411
                     /locus_tag="CNE_1c02040"
                     /db_xref="GeneID:10916595"
     CDS             203524..204411
                     /locus_tag="CNE_1c02040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684054.1"
                     /db_xref="GI:339324361"
                     /db_xref="GeneID:10916595"
                     /translation="MPSQQPLPGGAWRMVAAMLLSGTIGWFVVTSGQPPLDVVFFRCL
                     FGGAALLGVLTLQRGWVRMTRAQLGWLVLGGVTLVLNWLALFSAYAYSGIAIATVVYH
                     TQPFFLLMLTSVIQREPFPFARLPWLVLAFAGVMLITGLEHGATGTAMLAGIGLGLLA
                     ALLYAVTTLATRRLQAIPPGQIAGLQMVLGVLMLAPLAHPAAGSYGTGTWAALLALGL
                     VHTGVMYTLLYGAFQRLTVVSIATLSFIYPLVAIVIDVMVFGVVLGPLQIAGMALVLL
                     GVVANQLGWSLPLRRRAQG"
     misc_feature    203581..204378
                     /locus_tag="CNE_1c02040"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    203623..203940
                     /locus_tag="CNE_1c02040"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    204016..204360
                     /locus_tag="CNE_1c02040"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            204536..205384
                     /locus_tag="CNE_1c02050"
                     /db_xref="GeneID:10916596"
     CDS             204536..205384
                     /locus_tag="CNE_1c02050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684055.1"
                     /db_xref="GI:339324362"
                     /db_xref="GeneID:10916596"
                     /translation="MSTAPQTQAATAASPLHPFDDALALEPAGGHRFLGRTTPEYWNM
                     IGPFGGITAATLLQAALDHPQRLGDPVSLTVNFAGPIAEGPFEIEARPVRTNRSTQHW
                     TLELRQGDAVATTATAMFAVRRETWACGEALMPEVPAADTLPVMSGFAPVRWLKSYDM
                     RPVRGAKPATEAGTEHPDSLTQFWLRDAPARTPDFAALAAWADSFYPRIFLKRAGFVP
                     AGTVSMTTYFHADAATLAALGDSHVLASAQAQVFRQGFFDQRAQLWSARGELIASSHQ
                     IVYYKE"
     misc_feature    204653..205372
                     /locus_tag="CNE_1c02050"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    <204677..204907
                     /locus_tag="CNE_1c02050"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(204680..204682,204764..204775)
                     /locus_tag="CNE_1c02050"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(204698..204700,204707..204712,204740..204748)
                     /locus_tag="CNE_1c02050"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            complement(205398..206657)
                     /gene="ampG"
                     /locus_tag="CNE_1c02060"
                     /db_xref="GeneID:10916597"
     CDS             complement(205398..206657)
                     /gene="ampG"
                     /locus_tag="CNE_1c02060"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AmpG"
                     /protein_id="YP_004684056.1"
                     /db_xref="GI:339324363"
                     /db_xref="GeneID:10916597"
                     /translation="MTFQTYLDIFRNRRIGAMLALGFASGLPLALTSGTLQAWMTVEG
                     LDIKTIGFFSLVGQAYIFKFLWAPLMDRYTPPLLGRRRGWLLVTQLGLVLGIAGMAFC
                     PPREALWMLAALATLVAFLSASQDIVFDAYSTDVLRPAERGAGAAVKVLGYRLAMLVS
                     GGLALWLADRVLGWQQTYLLMAALMGVGIVTLLWAPEPDVPARTPHSLEEAVVGPLRD
                     FFGRQGAWWLLLLIVLYKLGDAFAGSLSTTFLIRGVGFSAGEVGIVNKTLGLAATIIG
                     ALFGGTLMVRLGLYRSLMLFGVLQAVSNLGYWILAVTPPHLWTMGTAIAVENLCGGMG
                     TAAFVALLMTLCNRSFSATQYALLSALASVGRVYVGPSSGYMVEAWGWAPFYLGTVVV
                     ALPGVMLLWAMRHTVHRYEAQAREAIA"
     misc_feature    complement(205446..206615)
                     /gene="ampG"
                     /locus_tag="CNE_1c02060"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(205545..206582)
                     /gene="ampG"
                     /locus_tag="CNE_1c02060"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(205560..205562,205569..205574,
                     205581..205586,205593..205598,205629..205631,
                     205638..205643,205653..205655,205662..205667,
                     205674..205676,205827..205829,205839..205841,
                     205848..205850,205863..205865,205875..205877,
                     205917..205919,205926..205931,205938..205943,
                     205950..205952,206187..206189,206205..206210,
                     206217..206222,206256..206258,206265..206270,
                     206277..206282,206289..206294,206457..206462,
                     206466..206471,206484..206489,206496..206498,
                     206547..206552,206556..206564,206571..206573))
                     /gene="ampG"
                     /locus_tag="CNE_1c02060"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            206813..207775
                     /locus_tag="CNE_1c02070"
                     /db_xref="GeneID:10916598"
     CDS             206813..207775
                     /locus_tag="CNE_1c02070"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase family M48"
                     /protein_id="YP_004684057.1"
                     /db_xref="GI:339324364"
                     /db_xref="GeneID:10916598"
                     /translation="MLRRLQGVQRPTRDRLVRALALAAVAAPMAWCMPAQAQDSEAGG
                     IRLDRSGSAVRKIVPVEAIEQQAAQEYEQLKQEAIAKHALAAADNPQLVRLRTIGKRL
                     LPQTARWNERARQWQWEINLIGSRQVNAFCMPGGKIAFYTGLLDQLKLTDDEIAMAMG
                     HEIAHALQEHARERAAKSEITNLGANVISQLFGFGNLGNMALGTGAHLLTLRFSRADE
                     SEADLIGMDIAARAGYDPRAAVSLWQKMGKVSQSGTEFLSTHPSGRSRIADLEKHLPE
                     VLPLYARASNTTVDRLPPYRANVANLGGAPVDSGDDDRQKPLQR"
     misc_feature    207092..207616
                     /locus_tag="CNE_1c02070"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     pfam01435"
                     /db_xref="CDD:250620"
     gene            complement(207846..208793)
                     /gene="argC"
                     /locus_tag="CNE_1c02080"
                     /db_xref="GeneID:10916599"
     CDS             complement(207846..208793)
                     /gene="argC"
                     /locus_tag="CNE_1c02080"
                     /EC_number="1.2.1.38"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase
                     ArgC"
                     /protein_id="YP_004684058.1"
                     /db_xref="GI:339324365"
                     /db_xref="GeneID:10916599"
                     /translation="MVFKVFVDGQEGTTGLRLLDYLSGRSDVELLRIADDKRKDPAER
                     ARFLNAADVAFLCLPDAASREAVSLVTNPNTCVIDASTAFRTSDSWAYGLPELARGQR
                     EKIRDSKRIAVPGCHASAFVLAVRPLVDAGVLPSDYPVSAFSLTGYSGGGKSMIAEFE
                     AGGNPKLDSPRPYALGLEHKHLPEMRVQAGLAQAPIFNPIVGNFLKGLAVTVPVFTDR
                     LARKVSPEQIVEIYRKHYEGEQFVRVMPYNSADNLDGGFFDVQANNDTNRVDLFVFGN
                     AERLNLVARLDNLGKGAAGAAVQCMNVHVGADEATGLRA"
     misc_feature    complement(207855..208793)
                     /gene="argC"
                     /locus_tag="CNE_1c02080"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Provisional; Region: PRK11863"
                     /db_xref="CDD:237004"
     misc_feature    complement(208479..208784)
                     /gene="argC"
                     /locus_tag="CNE_1c02080"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; smart00859"
                     /db_xref="CDD:214863"
     misc_feature    complement(<208056..208415)
                     /gene="argC"
                     /locus_tag="CNE_1c02080"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; cl19935"
                     /db_xref="CDD:268288"
     gene            complement(209123..209899)
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /db_xref="GeneID:10916600"
     CDS             complement(209123..209899)
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /EC_number="3.1.11.2"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="YP_004684059.1"
                     /db_xref="GI:339324366"
                     /db_xref="GeneID:10916600"
                     /translation="MLRIISANLNGIRSASKKGFFDWMGKQDADMVCVQELKAQAADM
                     TEAFLAPHGYHGYFHYAEKKGYSGVGLYTRHQPERVVTGFGIPEFDNEGRYVEVQYPH
                     LAVISVYVPSGSSGEERQQAKFRFMEAFLPHLLQLKASGREIVLCGDVNIAHKEIDIK
                     NWKGNLKNSGFLPEERAWIGELFDSHGYVDVFRKLDPRPDQYTWWSNRGQAYAKNVGW
                     RIDYHLATPKIADTAHLCSIYKDEKFSDHAPLSIDYDFPL"
     misc_feature    complement(209138..209896)
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="Neisseria meningitides Nape-like subfamily of the
                     ExoIII family purinic/apyrimidinic (AP) endonucleases;
                     Region: Nape_like_AP-endo; cd10281"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209164,209168..209170,
                     209237..209242,209246..209248,209252..209254,
                     209258..209260,209270..209272,209276..209284,
                     209288..209290,209405..209407,209411..209413,
                     209417..209419,209447..209449,209453..209455,
                     209543..209545,209558..209560,209564..209566,
                     209573..209575,209618..209620,209702..209707,
                     209771..209773,209786..209788,209792..209794,
                     209855..209872,209876..209878))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative active site [active]"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209161,209168..209170,
                     209240..209242,209246..209248,209252..209254,
                     209258..209260,209276..209284,209288..209290,
                     209405..209407,209411..209413,209417..209419,
                     209447..209449,209453..209455,209543..209545,
                     209558..209560,209564..209566,209573..209575,
                     209618..209620,209702..209707,209771..209773,
                     209786..209788,209792..209794,209855..209872,
                     209876..209878))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209161,209447..209449,
                     209453..209455,209564..209566,209573..209575,
                     209792..209794,209876..209878))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209164,209237..209239,
                     209447..209449,209453..209455,209573..209575,
                     209792..209794,209876..209878))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209162..209164,209792..209794,
                     209870..209872))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="metal binding site A [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209161,209240..209242,
                     209246..209248,209288..209290,209447..209449,
                     209453..209455,209564..209566,209573..209575))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative AP binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(209159..209161,209447..209449,
                     209453..209455))
                     /gene="exoA"
                     /locus_tag="CNE_1c02090"
                     /note="putative metal binding site B [ion binding]; other
                     site"
                     /db_xref="CDD:197336"
     gene            209927..210613
                     /gene="pyrE"
                     /locus_tag="CNE_1c02100"
                     /db_xref="GeneID:10916601"
     CDS             209927..210613
                     /gene="pyrE"
                     /locus_tag="CNE_1c02100"
                     /EC_number="2.4.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase PyrE"
                     /protein_id="YP_004684060.1"
                     /db_xref="GI:339324367"
                     /db_xref="GeneID:10916601"
                     /translation="MMTQQKPPAGADLSQTFIRFALDAGVLSFGEFVTKAGRKSPYFF
                     NAGLFNQGAMLGQVAQFYAKTLLASGVQFDVLFGPAYKGITLASATAVALAGMGRDVG
                     FAYNRKEAKDHGEGGTLVGAKLQGKVVIIDDVISAGTSVRESVNMIRAAGAEPAAVLI
                     ALDRMEKSGTAEQVGTHSAVQDVQREFGIPVIAIASLKDLLAYLDASQDPALGASREA
                     VAAYRQRYGV"
     misc_feature    210098..210451
                     /gene="pyrE"
                     /locus_tag="CNE_1c02100"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(210164..210166,210170..210172,210320..210328,
                     210332..210346,210416..210418)
                     /gene="pyrE"
                     /locus_tag="CNE_1c02100"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            210716..212023
                     /locus_tag="CNE_1c02110"
                     /db_xref="GeneID:10916602"
     CDS             210716..212023
                     /locus_tag="CNE_1c02110"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase alpha-beta hydrolase superfamily"
                     /protein_id="YP_004684061.1"
                     /db_xref="GI:339324368"
                     /db_xref="GeneID:10916602"
                     /translation="MAAKERQERAGRQAATPSTTAESAGNGESLAERGAQVLPRKPVR
                     QAAKAPDRAAHEAYAVRALVLQGGGALGAYQAGVYQGLAEGGIYPNWVAGISIGALNA
                     AIIAGNPPQRRVEQLCAFWEYICAQPWMPSLSHTWFADHAEGWPEPMRIWFDGLHAAR
                     AMLEGQRGFFQPRSWPELMSRYSDPSHASFYDTTPLKATLERFADFDLINHRPDLMRV
                     SVGAVNVRTGNFAYFDNTRDKLCPEHFMASGALPPGFPAVEIGGEYYWDGGLVSNTPL
                     AEVLTAQPRRDALIFQVDLWSARGKLPHDLVDVAERQKDIQYSSRTRAITDYMREQQN
                     LRRMLNEVMALVPPSKRDNAWYRRAAEQACDARRNVIQLIYRDKSFENLAKDYQFGAL
                     TMHEHWTSGLDDIRQTLRHPQWLAMPSREHPFVTHDVHRGNGG"
     misc_feature    210731..>210901
                     /locus_tag="CNE_1c02110"
                     /note="DNA polymerase III subunits tau domain IV
                     DnaB-binding; Region: DNA_pol3_tau_4; pfam12168"
                     /db_xref="CDD:256886"
     misc_feature    210899..211951
                     /locus_tag="CNE_1c02110"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    210902..211756
                     /locus_tag="CNE_1c02110"
                     /note="Hypothetical patatin similar to Z1214 protein of
                     Escherichia coli; Region: Pat_hypo_Ecoli_Z1214_like;
                     cd07209"
                     /db_xref="CDD:132848"
     misc_feature    order(210917..210922,210926..210928,211001..211003,
                     211514..211516)
                     /locus_tag="CNE_1c02110"
                     /note="active site"
                     /db_xref="CDD:132848"
     misc_feature    210995..211009
                     /locus_tag="CNE_1c02110"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132848"
     misc_feature    211661..211981
                     /locus_tag="CNE_1c02110"
                     /note="Patatin phospholipase; Region: DUF3734; pfam12536"
                     /db_xref="CDD:193067"
     gene            complement(212038..212847)
                     /locus_tag="CNE_1c02120"
                     /db_xref="GeneID:10916603"
     CDS             complement(212038..212847)
                     /locus_tag="CNE_1c02120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684062.1"
                     /db_xref="GI:339324369"
                     /db_xref="GeneID:10916603"
                     /translation="MPLDDFRITSGKRFRLADFDPGSKPLSCGKKEEDLARIIELSNA
                     LDAQQDIFYAEHRRKLLVVLQGMDTSGKDGTVRGVFRSFDPLGIRVVGFKAPSPEELA
                     RDYLWRIHLQVPKTGEIVVFNRSHYEDVLITRVHDWIDAAECERRFRQIRDFESMLTE
                     TGTTIVKCFLHISRDEQKARLEARLADPEKHWKFDTTDLAERKHWKAYMDAYEAAIMA
                     TSTPECPWYVVPADSKTHRNLMVAEILTKVFEDLKPAYPPARPELATIKVD"
     misc_feature    complement(212047..212841)
                     /locus_tag="CNE_1c02120"
                     /note="polyphosphate:nucleotide phosphotransferase, PPK2
                     family; Region: PPK2_rel_1; TIGR03709"
                     /db_xref="CDD:234322"
     gene            complement(212956..213822)
                     /gene="dapF"
                     /locus_tag="CNE_1c02130"
                     /db_xref="GeneID:10916604"
     CDS             complement(212956..213822)
                     /gene="dapF"
                     /locus_tag="CNE_1c02130"
                     /EC_number="5.1.1.7"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase DapF"
                     /protein_id="YP_004684063.1"
                     /db_xref="GI:339324370"
                     /db_xref="GeneID:10916604"
                     /translation="MKLQFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGA
                     DQILIVEKPSRPDVDFRYRIVNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVM
                     NGVITLTLQDDGQVTVDMGAPELEPARVPFRAEGLPTRAEGADTLYGLEVNGRTEWIS
                     AVSMGNPHAVQVVDNVENFPVLQDGPVVEHHAAFPNRVNAGFMQVQDRHTIRLRVYER
                     GAGETLACGTGACAAVVAGIRRGLLDSPVRVHTHGGELTIAWDGGAEPVRMTGPATTV
                     FEGSIDLAALPA"
     misc_feature    complement(212968..213822)
                     /gene="dapF"
                     /locus_tag="CNE_1c02130"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     misc_feature    complement(213448..213810)
                     /gene="dapF"
                     /locus_tag="CNE_1c02130"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     misc_feature    complement(212995..213342)
                     /gene="dapF"
                     /locus_tag="CNE_1c02130"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     gene            complement(213865..214758)
                     /gene="htrB"
                     /locus_tag="CNE_1c02140"
                     /db_xref="GeneID:10916605"
     CDS             complement(213865..214758)
                     /gene="htrB"
                     /locus_tag="CNE_1c02140"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="YP_004684064.1"
                     /db_xref="GI:339324371"
                     /db_xref="GeneID:10916605"
                     /translation="MSRVFTWLGIGLLTVLGKLPYPFVARFGEALGSLLYLVPSERRR
                     VVQANLRLCFPDRTEAEIDELSRQSFRILFRSFAERGIFWTGSEAQMRRWVQIDDQAD
                     LVALDGTPHILVTLHLSGVEAGAIRLTINLREHLGRSGASLYTRQKNDLFDHFLKHAR
                     GRFGANMISRNDSARDILRCLKKGEALQLIADMDFGERDSEFVPFFGVQALTLTSVSR
                     LARLTGAKVVPIYTEMLPDYQGYVLRILPPWEDYPGASVTDDTRRMNAFFEDCIRPRV
                     PEYYWVHKRFKHRLPGEPEIY"
     misc_feature    complement(213898..214485)
                     /gene="htrB"
                     /locus_tag="CNE_1c02140"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    complement(order(214174..214182,214318..214329,
                     214393..214395,214399..214401,214408..214410))
                     /gene="htrB"
                     /locus_tag="CNE_1c02140"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(214755..215774)
                     /locus_tag="CNE_1c02150"
                     /db_xref="GeneID:10916606"
     CDS             complement(214755..215774)
                     /locus_tag="CNE_1c02150"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl/myristoyl acyltransferase"
                     /protein_id="YP_004684065.1"
                     /db_xref="GI:339324372"
                     /db_xref="GeneID:10916606"
                     /translation="MNPDDGTLRAELNTAIEKTLPVRLFPGTDPQQTCFSRLMTFLFW
                     LISRFPLRLLQAAGGALGLLSARLPGRYGRRLRENFRQAFPDATEAMIDEAARSAGRM
                     IIEMPYFWSRSKIGAKLYGFDDYLWPELGKLQARGKGIIILTPHLGCFEVLPQSHALQ
                     RPVTALFKPPHQPWLRDWIEKMRTRPDMHMAPATPRGVRMLVKALKRGQAVGILPDQV
                     PSGGEGNWAPFFGKPAYTMALVHRLQQLTGAPVVAVFAERLPRGAGYRGHLRVINDGG
                     MLPDDPAAAAAVINRTIEELVRLCPTQYLWAYNRYKQPAGAGTPDAPDTPGNDTEPAA
                     DQSIS"
     misc_feature    complement(<215331..215642)
                     /locus_tag="CNE_1c02150"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     misc_feature    complement(214839..215381)
                     /locus_tag="CNE_1c02150"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    complement(order(215118..215126,215265..215276,
                     215322..215324,215328..215330,215337..215339))
                     /locus_tag="CNE_1c02150"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            215944..217155
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /db_xref="GeneID:10916607"
     CDS             215944..217155
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase MetK"
                     /protein_id="YP_004684066.1"
                     /db_xref="GI:339324373"
                     /db_xref="GeneID:10916607"
                     /translation="MNRTGWHAIANLENKFVANDFLFTSESVSEGHPDKVADQISDAV
                     LDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQIARDTIKRIGYDNTEYGI
                     DYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYY
                     AHRLVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGKPHSVDTVVLSTQHSPDITQAQI
                     REAVIEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPH
                     GGGAFSGKDPSKVDRSAAYAARYVAKNVVASGLARQCQVQVSYAIGVARPINVTVYTE
                     GTGKIPDAKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATD
                     KAAALRAAAGL"
     misc_feature    215998..217122
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    215998..216297
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    216340..216690
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    216694..217110
                     /gene="metK"
                     /locus_tag="CNE_1c02160"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            217358..218302
                     /locus_tag="CNE_1c02170"
                     /db_xref="GeneID:10916608"
     CDS             217358..218302
                     /locus_tag="CNE_1c02170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684067.1"
                     /db_xref="GI:339324374"
                     /db_xref="GeneID:10916608"
                     /translation="MSEAPVLAPSTSTQPPAAAGQLNLIRPQPYTDWAPQVTAEERAT
                     LRRELEQGAVLYFPNLNFRFQPGEERFLDSRYSDGKSKNINLRADDTAVRGAQGSPQD
                     LADLYTLIRRYADNSELLVRTLFPEYIPHMTRAGTSLRPSEIAGRPVSWRKDDTRLHV
                     DSFPSNPMLGKRLLRVFHNIDPAAARVWRVGEPFGDFAQKFVPKTHGMWPGQAALMKL
                     LHITKRKRSEYDHRMLQLHDLAKADLDYQAKVPQQEFHFPPGSTWIVFSDQLLHAAMR
                     GRAMMEQTIYLAPQAISDHTHSPEAVLSRMLGRPMLVS"
     misc_feature    217451..218290
                     /locus_tag="CNE_1c02170"
                     /note="3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)
                     hydroxylase; Region: Kdo_hydroxy; pfam11004"
                     /db_xref="CDD:256241"
     gene            complement(218303..219706)
                     /gene="calB"
                     /locus_tag="CNE_1c02180"
                     /db_xref="GeneID:10916609"
     CDS             complement(218303..219706)
                     /gene="calB"
                     /locus_tag="CNE_1c02180"
                     /EC_number="1.2.1.68"
                     /codon_start=1
                     /transl_table=11
                     /product="coniferyl aldehyde dehydrogenase CalB"
                     /protein_id="YP_004684068.1"
                     /db_xref="GI:339324375"
                     /db_xref="GeneID:10916609"
                     /translation="MREVPDLSSVFGAMHAASRRDQLPAWAVRADRLQRLRRLVTENE
                     AAIAAAIHADFTNRPRQETALLEVFPSLGGIDDALRHGKRWMRVRRAATGFWFRPGRS
                     RLVPQPLGVVGIVVPWNYPLYLTVGPLAGALAAGNRAMVKLSEYTPRFAALFAQLVPQ
                     HFAPDEIVVVNGDAEVASAFTALPFDHLLFTGSTAVGHHVMRAAAANLTPVTLELGGK
                     SPAIIGAGADLPRAVERILVGKLMNAGQTCIAPDYVLVPEDLREQLVEAARQCVGRLY
                     PDLARNVDYTSIISPRHFARLAALVDEASAQGATVVPLSDAQPDAQARRLPPVLLLDV
                     PEGITAMREEIFGPVLPVVTYRTLDEAVDYINARPRPLALYLFERDRGAIGHVMKQTV
                     AGGVTVNDTLFHIAQDGLPFGGVGASGMGAYHGQAGFDTFSKVKPVFHQAGLNGAGLL
                     KPPYGKTFETMLRLLLR"
     misc_feature    complement(218387..219685)
                     /gene="calB"
                     /locus_tag="CNE_1c02180"
                     /note="Coniferyl aldehyde dehydrogenase-like; Region:
                     ALDH_CALDH_CalB; cd07133"
                     /db_xref="CDD:143451"
     misc_feature    complement(order(218669..218671,218675..218677,
                     218819..218821,218828..218833,218837..218839,
                     219131..219133,219185..219187,219272..219274,
                     219350..219358))
                     /gene="calB"
                     /locus_tag="CNE_1c02180"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143451"
     misc_feature    complement(order(218963..218965,218972..218974,
                     219065..219067,219350..219352))
                     /gene="calB"
                     /locus_tag="CNE_1c02180"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143451"
     gene            220021..221700
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /db_xref="GeneID:10916610"
     CDS             220021..221700
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /EC_number="1.1.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase BetA"
                     /protein_id="YP_004684069.1"
                     /db_xref="GI:339324376"
                     /db_xref="GeneID:10916610"
                     /translation="METTFDYVIVGAGSAGCALAGRLADSGDDTIALVEAGHHDHHVL
                     VRTPAALAALLPRAGARNYGYETVPQPGLNGRRGYQPRGRGLGGSSSINAMIYTRGRA
                     ADYDAWAAAGCDGWSWDDVLPYFRRAECNERLAGSDDDPLHGGNGPLHVSDLRTPNPF
                     AERFIEAAQQAGFPRNDDFNGEEQEGVGWYQVTQHAGERWNAARAYLHGGNKRDRACN
                     GGRAHLQVLTDTQALRIVFEGRHAAGVQVVREGRRQLLRARRDVIVCAGTFGSPQLLM
                     VSGVGPAAHLREHGIAVVHDLPGVGANLQDHLDIVLHKRVAVPELFGVSFGGLARLVS
                     EMLRYRRERTGMMSSNFAEAGGFLRSRPDLPEPDLQLHFVVGMADDHMRRLNFGHGYS
                     CHVCVLRPRSRGEVRLASHDIRRAPLIDPQYLSDARDLDDMVAGVRIVRSIFAQPQLA
                     SFGGRELYSAGLRADGSDDAAVREMIREHADTIYHPVGTCRMGMDAMAVVDPQLRVRG
                     VEGLRVVDASVMPTLVGGNINAPAIMIGERAHDLIRYAPRVMLRVLESMEA"
     misc_feature    220021..221652
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    220042..>220134
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    220240..220947
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    221218..221631
                     /gene="betA1"
                     /locus_tag="CNE_1c02190"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(221705..223366)
                     /gene="aidB"
                     /locus_tag="CNE_1c02200"
                     /db_xref="GeneID:10916611"
     CDS             complement(221705..223366)
                     /gene="aidB"
                     /locus_tag="CNE_1c02200"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004684070.1"
                     /db_xref="GI:339324377"
                     /db_xref="GeneID:10916611"
                     /translation="MTEAATHRVFNQVPDLAHYNLFSTDPSLRGALDRLGGGWHAAAL
                     GQFGARLGEPEVQQWAADANRHTPELHTHSRTGERIDAVDFHPSWHALLGLLRSQQLQ
                     ALPFAQPRAGAWVARTAGYFLQAQVESGSLCPPTMTFASIPVLRKETALFAELEPRLY
                     ATEHDARDLPWRSKSAIMIGMGMTEKQGGSDVRANTTVARAVRGEGRGAEYALTGHKW
                     FFSAPMCDAHLVVARMGAEDGPLSCFFVPRFRDDGSKNAVLIQRLKDKLGNRSNSSSE
                     VEFRDATGILIGEEGRGIPTIIEMATSTRLDCVIGSAAILRAAFVQALHHARHRSAFG
                     RLLADQPLMRNVLADLALESEAATLLMMELGHAFEHADDDPLAAAWKRVVTPAAKFWV
                     CKRTLEATGEAMEVWGGNGYVEEGPMARLYREAPVNSIWEGSGNIMCLDVLRAIQRNP
                     DDAARLLQDLSRRAGGHPAVRAELASLQAMLHENPELLEANARRFAQGLVLTAQAALM
                     LAHADTENAELFVASRLGRQHGRVFGTLDADADVLKRVFSRGFEG"
     misc_feature    complement(221717..223351)
                     /gene="aidB"
                     /locus_tag="CNE_1c02200"
                     /note="isovaleryl CoA dehydrogenase; Provisional; Region:
                     PRK11561"
                     /db_xref="CDD:183199"
     misc_feature    complement(222023..223303)
                     /gene="aidB"
                     /locus_tag="CNE_1c02200"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(222059..222061,222065..222067,
                     222071..222079,222704..222706,222710..222712,
                     222818..222820,222824..222826,222947..222949))
                     /gene="aidB"
                     /locus_tag="CNE_1c02200"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(223516..223656)
                     /locus_tag="CNE_1c02210"
                     /db_xref="GeneID:10916612"
     CDS             complement(223516..223656)
                     /locus_tag="CNE_1c02210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684071.1"
                     /db_xref="GI:339324378"
                     /db_xref="GeneID:10916612"
                     /translation="MKLPTPVLAGSGSKGLSQPHGPSVRHPCFIQRGEFKHKPPAGAS
                     AN"
     gene            223768..225648
                     /gene="thiC"
                     /locus_tag="CNE_1c02220"
                     /db_xref="GeneID:10916613"
     CDS             223768..225648
                     /gene="thiC"
                     /locus_tag="CNE_1c02220"
                     /EC_number="4.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="YP_004684072.1"
                     /db_xref="GI:339324379"
                     /db_xref="GeneID:10916613"
                     /translation="MARTAPAASFESLESDLDQKFAYPASSKTYLTGSRPDIRVPLRT
                     ILQTSTRTDKGEMSNPPIPVYDTSGPYSDPDVHIDLKAGLPALRAKWIDERGDTEVLK
                     GLSSEYGRDRANDPATAHLRFAQLTNPRRAKAGANVSQMHYARKGIITPEMEYVALRE
                     SLNLQALYDKPEYKALLRQHPGNALGAGLPLRPEDITPEFVRQEIASGRAIIPANINH
                     TELEPMAIGRNFRVKINGNLGNSAVTSSLAEEVEKMVWSIRWGADTIMDLSTGKHIHE
                     TREWILRNSPVPIGTVPIYQALDKTGGIAEDLTWEMFRDTLIEQAEQGVDYFTIHAGV
                     LLRYVPLTADRVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGD
                     GLRPGCIADSNDDAQFGELRTLGELTAKAWEHDVQVMIEGPGHVPLQRIQANMDEELK
                     HCYEAPFYTLGPLVTDIAPGYDHITSGIGAANIGWMGTAMLCYVTPKEHLGLPDKEDV
                     REGIITYKIAAHAADLAKGWPGAQLRDNALSKARFEFRWEDQFNLGLDPERARSYHDA
                     TLPAEGAKIAHFCSMCGPKFCSMKITQEVRDYAASLPKEAKQGMEEKSIEFLKKGSKI
                     YS"
     misc_feature    223822..225642
                     /gene="thiC"
                     /locus_tag="CNE_1c02220"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    223831..224064
                     /gene="thiC"
                     /locus_tag="CNE_1c02220"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    224182..225555
                     /gene="thiC"
                     /locus_tag="CNE_1c02220"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     gene            225787..226980
                     /gene="thiO"
                     /locus_tag="CNE_1c02230"
                     /db_xref="GeneID:10916614"
     CDS             225787..226980
                     /gene="thiO"
                     /locus_tag="CNE_1c02230"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis oxidoreductase ThiO"
                     /protein_id="YP_004684073.1"
                     /db_xref="GI:339324380"
                     /db_xref="GeneID:10916614"
                     /translation="MTAVQSFDVAILGAGLAGRLAAWQLVRSGARVALVERAGPDGAG
                     SAAYVAAAMLAPLAESAIAERRIVDLGIASVDLWRAWLAELPEPVFFQEDGTLVVWHA
                     RDRAEMSLFTSRVRAVAPPELVSQRLRALDGKGVGEVEPALAGRFPQGLLLAGEGQLD
                     NRGALRALLSCAVSEGVHCVWEAGEVDAESLPKLGIRADVVLDCRGLGARASWPAQPG
                     GTQPGLRGLRGEVVRVHAPDVRLHRPVRLLHPRYPIYIAPKPNDLYVIGATELESEDD
                     SPMSVRSALELLSAAHSLHPAFGEARVLELNVQRRPTRPDHLPAIRVDQRARVVRVNG
                     LYRHGFLIAPAVTEAACAVVGALLKGDPAAHAVPAALRWPGMIEAVTEAPAATTMAAP
                     GGLLH"
     misc_feature    225787..>225906
                     /gene="thiO"
                     /locus_tag="CNE_1c02230"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    225802..226905
                     /gene="thiO"
                     /locus_tag="CNE_1c02230"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    225853..226851
                     /gene="thiO"
                     /locus_tag="CNE_1c02230"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            226984..227190
                     /gene="thiS"
                     /locus_tag="CNE_1c02240"
                     /db_xref="GeneID:10916615"
     CDS             226984..227190
                     /gene="thiS"
                     /locus_tag="CNE_1c02240"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis sulfur transfer protein
                     ThiS"
                     /protein_id="YP_004684074.1"
                     /db_xref="GI:339324381"
                     /db_xref="GeneID:10916615"
                     /translation="MTDMEILLNGRPLALADSATLADAVSAAQIAPPFAAAVNGQFVP
                     RGAHANTLLAAGDRIDLVQPVTGG"
     misc_feature    226999..227187
                     /gene="thiS"
                     /locus_tag="CNE_1c02240"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    order(227107..227109,227161..227169)
                     /gene="thiS"
                     /locus_tag="CNE_1c02240"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            227194..228030
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /db_xref="GeneID:10916616"
     CDS             227194..228030
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /EC_number="4.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase ThiG"
                     /protein_id="YP_004684075.1"
                     /db_xref="GI:339324382"
                     /db_xref="GeneID:10916616"
                     /translation="MTFEPSETLRDPFVLYGESFGSRLLLGTARYPSPATLEAAVQAS
                     RPAMITVALRRQGAVGAGEGGQAFWQMLKALDVPVLPNTAGCFTAQEVITTAMMAREV
                     FETPWIKLELIGDDYTLQPDTLNLPAVAETLIKEGFKVLPYCTEDLVLCRRLLDVGCQ
                     ALMPWAAPIGTGRGAVNPHAMRVLRERLPDTPLIVDAGLGLPSHAAQVLEWGYDGVLL
                     NTAVAQAAYPVNMARAFAQAVEAGRTAYLAGPMPEREVAQASTPVVGMPFWHADSTEQ
                     RA"
     misc_feature    227230..227982
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    order(227347..227349,227386..227388,227401..227403)
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    order(227518..227520,227524..227526,227779..227781)
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    order(227533..227535,227542..227544,227551..227559,
                     227626..227628,227632..227640,227647..227652,
                     227704..227712,227719..227721,227737..227739,
                     227749..227751,227794..227802,227812..227814,
                     227821..227826,227851..227853,227866..227874,
                     227881..227886,227893..227895,227914..227916,
                     227923..227928,227932..227946,227950..227955,
                     227959..227961,227965..227973,227977..227979)
                     /gene="thiG"
                     /locus_tag="CNE_1c02250"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            228027..229163
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /db_xref="GeneID:10916617"
     CDS             228027..229163
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /EC_number="2.5.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase ThiE"
                     /protein_id="YP_004684076.1"
                     /db_xref="GI:339324383"
                     /db_xref="GeneID:10916617"
                     /translation="MTRRAVHAASDGPLRQAVLEHYGETFGVDDKPWQAWRLADAPAQ
                     PGAHDVLLFDGEADAGTIARLAAAGATLIETDREGGQWIDTVRSPMGTWVFSVAADTD
                     QPHSPAFVAVLLASLSLHFPAHDALCLSRAWEPGSADWPSDFARFPHVRHAALAAPEQ
                     AAAPFAPCPALGLYVVVPSAEWIERLAPLNVPTVQLRFKSDDPAEVRAEIARAAKAMQ
                     GSSSRLFVNDHWQAAIDYRAANGGEHSGIYGIHLGQEDLDDADLDAIRASGLRLGVST
                     HGYAEMLRVAAIRPSYLALGAIFPTTTKVMPTQPQGMGRFRAYVKLMQPVIPSLVGIG
                     GVNVANMREVLAVGVGSAAVVRAVTEADDVPAAVAHLVSLFPAA"
     misc_feature    228543..229145
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    order(228546..228548,228552..228554,228609..228611,
                     228615..228617,228777..228779,228849..228851,
                     228900..228902,228906..228908,228927..228929,
                     228933..228935,229017..229019,229029..229031,
                     229083..229094)
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    order(228609..228611,228615..228617,228621..228623,
                     228705..228710,228792..228794,228849..228851,
                     228927..228929,228933..228938,229029..229031,
                     229089..229094)
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    order(228615..228617,228621..228623,228705..228710,
                     228783..228785,228792..228794,228849..228851,
                     228936..228938)
                     /gene="thiE"
                     /locus_tag="CNE_1c02260"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            229178..229696
                     /locus_tag="CNE_1c02270"
                     /db_xref="GeneID:10916618"
     CDS             229178..229696
                     /locus_tag="CNE_1c02270"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_004684077.1"
                     /db_xref="GI:339324384"
                     /db_xref="GeneID:10916618"
                     /translation="MAPTAAAHRVRLAVADDLARLPEIELAAAALFPDADLPALLRLV
                     STPESALAAAQRERRLWVAERGGELAGFALASRKGECGYLDEMDVHPDHGRRGIGRLL
                     VGAVQGWARADGLRSLNLTTFAHLPWNAPFYASLGFRQLRDDELCPLLADALAAQRAA
                     GLRQRVAMRQIF"
     misc_feature    229355..229540
                     /locus_tag="CNE_1c02270"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(229436..229444,229472..229477)
                     /locus_tag="CNE_1c02270"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            229750..229974
                     /locus_tag="CNE_1c02280"
                     /db_xref="GeneID:10916619"
     CDS             229750..229974
                     /locus_tag="CNE_1c02280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684078.1"
                     /db_xref="GI:339324385"
                     /db_xref="GeneID:10916619"
                     /translation="MLAIRLPEDIEDRLEALAKRTGRTKTFYAREAIMQHLDDLEDLY
                     LADKIAARVRAGEESTVTLDELEARLGLAD"
     misc_feature    229756..229971
                     /locus_tag="CNE_1c02280"
                     /note="Predicted DNA-binding protein with an HTH domain
                     [General function prediction only]; Region: COG4710"
                     /db_xref="CDD:227054"
     gene            229958..230227
                     /locus_tag="CNE_1c02290"
                     /db_xref="GeneID:10916620"
     CDS             229958..230227
                     /locus_tag="CNE_1c02290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684079.1"
                     /db_xref="GI:339324386"
                     /db_xref="GeneID:10916620"
                     /translation="MAWRIEVTQTAEKQLAKLDRPVARRIVTFLREQVAASDDPRSLG
                     EALKGSELGEYWKYRVGDWRLICQIEDARITVVVLRLGNRRDVYR"
     misc_feature    229958..230224
                     /locus_tag="CNE_1c02290"
                     /note="Cytotoxic translational repressor of
                     toxin-antitoxin stability system [Translation, ribosomal
                     structure and biogenesis / Cell division and chromosome
                     partitioning]; Region: RelE; COG2026"
                     /db_xref="CDD:224937"
     gene            230333..230785
                     /locus_tag="CNE_1c02300"
                     /db_xref="GeneID:10916621"
     CDS             230333..230785
                     /locus_tag="CNE_1c02300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684080.1"
                     /db_xref="GI:339324387"
                     /db_xref="GeneID:10916621"
                     /translation="MSSQTAPEIVPVAPGTPEKPYFGIDVPLMRYFGLQPVQIEEGLC
                     RTRLPAHPSLVNSRGDVHGGTLMATLDFTLSGAARSHAPLETGVITIDMSTHFLAAAR
                     GELTLEARCLRRGARIAFCEGEVKDAAGTVVCVARAAFKLVPLSAGGN"
     misc_feature    230429..230758
                     /locus_tag="CNE_1c02300"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    230513..>230752
                     /locus_tag="CNE_1c02300"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    order(230513..230515,230600..230602,230621..230632)
                     /locus_tag="CNE_1c02300"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(230516..230518,230522..230524,230531..230533,
                     230603..230617,230621..230623)
                     /locus_tag="CNE_1c02300"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(230519..230521,230543..230548,230555..230560,
                     230600..230602)
                     /locus_tag="CNE_1c02300"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            complement(230807..231241)
                     /locus_tag="CNE_1c02310"
                     /db_xref="GeneID:10916622"
     CDS             complement(230807..231241)
                     /locus_tag="CNE_1c02310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684081.1"
                     /db_xref="GI:339324388"
                     /db_xref="GeneID:10916622"
                     /translation="MTMLADIDLRSDPEAAFYLKHEIVDVLFATEPGELISREGPNRY
                     QPGDALITSRGGDRWCVSRDRFDPKYEAVPPLAHGQDGAYRNKPIPVLAREMHEAFSI
                     ARSAGGDVLHGKPGDWLMQYAPGDYGITERARFEQVYRPLQD"
     misc_feature    complement(230822..231124)
                     /locus_tag="CNE_1c02310"
                     /note="PGDYG protein; Region: PGDYG; pfam14083"
                     /db_xref="CDD:206253"
     gene            complement(231247..232119)
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /db_xref="GeneID:10916623"
     CDS             complement(231247..232119)
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /EC_number="2.7.1.49"
                     /EC_number="2.7.4.7"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylpyrimidine/phosphomethylpyrimidine
                     kinase ThiD"
                     /protein_id="YP_004684082.1"
                     /db_xref="GI:339324389"
                     /db_xref="GeneID:10916623"
                     /translation="MPGRLAHRLPPIPAQMIPTPPRTLTIAGSDSGGGAGIQADLKTF
                     SALGCFGMSAITAITAQNTLGVTGVHAIPADMVAAQIDAVASDIGVDAAKTGMLGTAA
                     IVEAVAAAADRHGIRKLVVDPVMISTSGATLSDDATTQAMVRLLFPRALLVTPNLPEA
                     SYLLGRRIARRAEMEQAAADLIAMGCPAVLLKGGHLEDGAAAGGLDDLLMLADGSVRV
                     FTHPRVDTRNLHGTGCTLAAAIAAQLARGDALEAAVGTALDYVAQAIAAGAGLRLGAG
                     NGPLNHLFAPRALG"
     misc_feature    complement(231316..232011)
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /note="4-amino-5-hydroxymethyl-2-methyl-pyrimidine
                     phosphate kinase (HMPP-kinase) catalyzes two consecutive
                     phosphorylation steps in the thiamine phosphate
                     biosynthesis pathway, leading to the synthesis of vitamin
                     B1. The first step is the phosphorylation of...; Region:
                     HMPP_kinase; cd01169"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(231868..231873,231883..231885,
                     231892..231894,231901..231906,231910..231912,
                     231916..231921,231934..231948,231955..231957,
                     231961..231978,231985..231987,231994..231999,
                     232006..232008))
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(231418..231420,231829..231831,
                     231937..231939,232000..232002))
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(231421..231423,231427..231429,
                     231544..231546,231643..231645,231754..231756))
                     /gene="thiD"
                     /locus_tag="CNE_1c02320"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238574"
     gene            232371..233789
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /db_xref="GeneID:10916624"
     CDS             232371..233789
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /EC_number="3.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="YP_004684083.1"
                     /db_xref="GI:339324390"
                     /db_xref="GeneID:10916624"
                     /translation="MNAVTDLKQDYLVADINLAGWGRKEIAIAETEMPGLMAIRDEFA
                     AAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIYSTQDHAAAAIAAGGTP
                     VFAFKGESLKEYWDFTHRIFDWSDGGTPNMILDDGGDATLLLHLGARAEKDASLIAKP
                     GSEEETYLFAAIKEKLAKDPSWYSRNLEAIRGVTEETTTGVHRLYQMAQKGELRFPAI
                     NVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAIVAGYGDVGKGSAQALRALS
                     AQVWVTEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQA
                     IVCNIGHFDNEIDIASIEKYEWDEIKPQVDHVKFPDGKKLIILAKGRLVNLGCATGHP
                     SYVMSSSFANQTIAQIELWQERDSGKYPVGVYTLPKHLDEKVARLQLRKLNAQLTELT
                     EQQAAYIGVKKEGPYKADHYRY"
     misc_feature    232383..233768
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="S-adenosyl-L-homocysteine hydrolase; Provisional;
                     Region: PRK05476"
                     /db_xref="CDD:235488"
     misc_feature    232431..233747
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="S-Adenosylhomocysteine Hydrolase, NAD-binding and
                     catalytic domains; Region: SAHH; cd00401"
                     /db_xref="CDD:240619"
     misc_feature    order(232431..232433,232440..232442,232452..232454,
                     232461..232466,232974..232976,232983..232988,
                     233034..233036,233040..233042,233052..233057,
                     233067..233069,233076..233081,233091..233093,
                     233100..233105,233112..233132,233154..233159,
                     233166..233168,233193..233198,233202..233204,
                     233217..233243,233247..233258,233262..233273,
                     233280..233282,233319..233333,233361..233369,
                     233400..233402,233445..233450,233463..233465,
                     233535..233537,233544..233546,233550..233555,
                     233562..233564,233643..233645,233661..233666,
                     233673..233678,233685..233687,233694..233699,
                     233703..233711,233715..233717,233724..233729,
                     233736..233741)
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240619"
     misc_feature    order(232545..232547,232551..232553,232557..232562,
                     232776..232778,232956..232961,233046..233048,
                     233058..233060,233523..233525,233538..233543,
                     233556..233558,233568..233570)
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240619"
     misc_feature    order(232545..232547,232776..232778,232956..232958,
                     233058..233060)
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240619"
     misc_feature    order(232959..232967,233061..233063,233073..233075,
                     233148..233150,233154..233162,233214..233225,
                     233232..233234,233313..233324,233331..233333,
                     233385..233393,233514..233516,233520..233522,
                     233541..233543)
                     /gene="ahcY"
                     /locus_tag="CNE_1c02330"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240619"
     gene            233861..234211
                     /locus_tag="CNE_1c02340"
                     /db_xref="GeneID:10916625"
     CDS             233861..234211
                     /locus_tag="CNE_1c02340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684084.1"
                     /db_xref="GI:339324391"
                     /db_xref="GeneID:10916625"
                     /translation="MRLLVVWVINAVALFVLPYLISSIHIKSFGSAMLAALVLGLVNT
                     LIRPILVILTLPVTLLTLGLFIFVINALLFLFVGNLLSGFTVGGFWAALLGSILYSVI
                     SWLLASLLLGERTA"
     misc_feature    233861..234178
                     /locus_tag="CNE_1c02340"
                     /note="Membrane protein of unknown function; Region:
                     DUF360; pfam04020"
                     /db_xref="CDD:252320"
     gene            234273..235103
                     /gene="metF"
                     /locus_tag="CNE_1c02350"
                     /db_xref="GeneID:10916626"
     CDS             234273..235103
                     /gene="metF"
                     /locus_tag="CNE_1c02350"
                     /EC_number="1.5.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_004684085.1"
                     /db_xref="GI:339324392"
                     /db_xref="GeneID:10916626"
                     /translation="MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAG
                     GTTQQGTLDAVLEIQREGIEAAPHLSCVGSSCESIRAVLQQYRDGGIRHIVALRGDMP
                     SGMGEIGEFRYANELVEFIRAETGDWFNIEVAAYPEYHPQAKSPRHDLDNFVRKVKAG
                     ADSAITQYFYNADAYFRFVDDVRAQGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRW
                     VAKRLESFGDDRESIRAFGLDVVTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL
                     "
     misc_feature    234288..235094
                     /gene="metF"
                     /locus_tag="CNE_1c02350"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(234393..234395,234474..234476,234561..234569,
                     234609..234614,234672..234674,234678..234680,
                     234690..234692,234696..234698,234717..234719,
                     234726..234728,234735..234740,234765..234767,
                     234771..234773,235047..235049)
                     /gene="metF"
                     /locus_tag="CNE_1c02350"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            235112..235471
                     /locus_tag="CNE_1c02360"
                     /db_xref="GeneID:10916627"
     CDS             235112..235471
                     /locus_tag="CNE_1c02360"
                     /codon_start=1
                     /transl_table=11
                     /product="competence-specific genes regulator"
                     /protein_id="YP_004684086.1"
                     /db_xref="GI:339324393"
                     /db_xref="GeneID:10916627"
                     /translation="MATRRPDPFIEHLLELMGPLAARIGPVSARRMFGGHGLFYDGLM
                     FALVSGGTCYLKADDATRGKFEAEGSEPFRYQSAKREVTMRHYLSLPPAALESPGAMT
                     PWAKLAVEAALRLGNAG"
     misc_feature    235169..235450
                     /locus_tag="CNE_1c02360"
                     /note="TfoX N-terminal domain; Region: TfoX_N; pfam04993"
                     /db_xref="CDD:147262"
     gene            235523..236281
                     /locus_tag="CNE_1c02370"
                     /db_xref="GeneID:10916628"
     CDS             235523..236281
                     /locus_tag="CNE_1c02370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684087.1"
                     /db_xref="GI:339324394"
                     /db_xref="GeneID:10916628"
                     /translation="MVTATFRFYEELNDFLAPDQRRRDLSCACARAATVKHMIEALGV
                     PHTEVELILVNGESSGFERQLRDGDRVSVYPKFERLDVSPLLRVREQPLRVMRFVADA
                     HLGGLAHLLRMTGFDTLYDNHFEDSEIERIAVDQGRVVLTRDRELLKRRGITHGCYVR
                     AIKSQLQVREIFARLDLARSARPFSLCLDCNAPLRALDAAGAAGRVPEGVLERHRSFV
                     TCDQCRRVFWEGSHWRCMRALVDELVRGAEAGPG"
     misc_feature    235523..235765
                     /locus_tag="CNE_1c02370"
                     /note="Mut7-C ubiquitin; Region: Ub-Mut7C; pfam14451"
                     /db_xref="CDD:206617"
     misc_feature    235808..236242
                     /locus_tag="CNE_1c02370"
                     /note="Mut7-C RNAse domain; Region: Mut7-C; pfam01927"
                     /db_xref="CDD:250974"
     gene            complement(236441..237025)
                     /locus_tag="CNE_1c02380"
                     /db_xref="GeneID:10916629"
     CDS             complement(236441..237025)
                     /locus_tag="CNE_1c02380"
                     /EC_number="6.3.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="YP_004684088.1"
                     /db_xref="GI:339324395"
                     /db_xref="GeneID:10916629"
                     /translation="MSSTPVTTAPNPAADDRRALRTQLLAQRAALPARAEADARIAAA
                     LSGLLAGLAVRCLGFYWPIQQEFDARDAVGRWLAAMPGRSAALPSVSRPGAPLDFHLW
                     TPDTPMATGHYGIPVPDGTEAVTPDALLIPCVGFSPDKFRLGYGGGFYDRTLAAMAQR
                     PVAIGIGYESCRLPLQAQPHDIAMDWIVTESGQF"
     misc_feature    complement(236456..236977)
                     /locus_tag="CNE_1c02380"
                     /note="5-formyltetrahydrofolate cyclo-ligase family;
                     Region: 5-FTHF_cyc-lig; cl00360"
                     /db_xref="CDD:260381"
     gene            237132..239084
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /db_xref="GeneID:10916630"
     CDS             237132..239084
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /EC_number="3.2.1.147"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase"
                     /protein_id="YP_004684089.1"
                     /db_xref="GI:339324396"
                     /db_xref="GeneID:10916630"
                     /translation="MLKGVYLQRAGRAAWIALACALLVTPVHAQKRPQAVSRPQAAVI
                     PSDPDEAFTALREAARKNDVERAYAISATLVDYPVPSYVEYFRIKPQLFDASGLARID
                     APDDQVRAFLQRYKGDAIADRMRNDWLLVLGKKRDWANFDVEYPQFALKDDTQVECYA
                     LLSRALKGQNVAADARNVLSDPKYYGEGCVDLIGYLAQSQQIQRSDVAYQARLALEQN
                     FVTLAGKIAALVPDARADGDTLATVVKMARNDPSQAAAYLGTAQGALSRDEQGAAWGV
                     IGQFAAKKLLPDAAGFYRRQMDLGGNQWLSDDTQEWRVRAALRQGDWKQVRQAVELMR
                     PELRAKDPAWIYWYGRALKADGRDTEAQQNFQQIAGQFNFYGQLASEELGNRITLPAR
                     TTVSDAEAMAMRTRAGFQRAQKFYAMNLRFEGNREWNWELRNMSDRELLAAAEYARRL
                     ELLDRTVNSADRTRNEHDFTLRFLMPYRDIMQRATDDVGLDMAWVYGLIRQESRFLMN
                     ARSSAGAHGLMQVMPATAKYVARKIGMADFSPSMMADPNINILLGTNYLNMVLTDLDS
                     SWTLASAAYNAGPGRPKAWRSTLARPVEGAIFAETIPFNETRGYVKNVLSNATYYAAL
                     MSGRPQSLKSRLGMVAPSAVTTTSLP"
     misc_feature    238155..239030
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    238353..238502
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /note="Soluble lytic murein transglycosylase L domain;
                     Region: SLT_L; pfam14718"
                     /db_xref="CDD:258855"
     misc_feature    238608..238985
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(238635..238637,238695..238697,238797..238799,
                     238854..238856)
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    238635..238637
                     /gene="slt"
                     /locus_tag="CNE_1c02390"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            239191..240213
                     /locus_tag="CNE_1c02400"
                     /db_xref="GeneID:10916631"
     CDS             239191..240213
                     /locus_tag="CNE_1c02400"
                     /EC_number="5.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar epimerase"
                     /protein_id="YP_004684090.1"
                     /db_xref="GI:339324397"
                     /db_xref="GeneID:10916631"
                     /translation="MQTSNVLVIGGAGFIGSHLVSRLAGAASASGAPLEPGANPDSPI
                     APDRIVVGARNIEHAQHLLLLPRVEVVELGLADNAALDDAIGSLGVDGIVVNLVGVLH
                     GERADPYGEAFASAHVEMVRQIAASCLSTGVRRLLHMSALGADSNGPSMYLRSKGDGE
                     RVVRASGLDWTIFRPSVVFGPDDHFLNLFAHMQQMAPVVPLACAHARFQPVFVQDVVQ
                     AYLNAMVNPATIGHGYELGGPQVYTLEELVRFAGRASGHPRPVIALPDALARVQASIM
                     EHMPGEPLLSRDNLDSMQLDNVLEHPVAPELNLHPASLESIMTDALAGRNRDTTLTHM
                     RASVHR"
     misc_feature    239203..240081
                     /locus_tag="CNE_1c02400"
                     /note="NADH dehydrogenase (ubiquinone) 1 alpha subcomplex,
                     subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs;
                     Region: NDUFA9_like_SDR_a; cd05271"
                     /db_xref="CDD:187579"
     misc_feature    239206..239901
                     /locus_tag="CNE_1c02400"
                     /note="NAD dependent epimerase/dehydratase family; Region:
                     Epimerase; pfam01370"
                     /db_xref="CDD:250566"
     misc_feature    order(239218..239220,239224..239235,239347..239355,
                     239479..239487,239536..239538,239605..239613,
                     239644..239646,239656..239658,239713..239724)
                     /locus_tag="CNE_1c02400"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187579"
     misc_feature    order(239644..239646,239656..239658)
                     /locus_tag="CNE_1c02400"
                     /note="active site"
                     /db_xref="CDD:187579"
     gene            240399..241097
                     /locus_tag="CNE_1c02410"
                     /db_xref="GeneID:10916632"
     CDS             240399..241097
                     /locus_tag="CNE_1c02410"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004684091.1"
                     /db_xref="GI:339324398"
                     /db_xref="GeneID:10916632"
                     /translation="MKLVIGNKNYSSWSLRPWLLLRQAGIDFEEVQVRLFTGSFAAEI
                     ARYSPAGKVPALVDGEVTVWDSLAISEYLAERFPEKHLWPADRAQRAVARAVCAEMHS
                     GFGNLRNQLPMNVTAVLPGRGWNVAVQRDVERIAAIWEGLRQQHGANGPFLFGEFTVA
                     DAFFAPVVSRFATYGIHLPDEAEDAKAYADFMLALPAMQEWIAGAREERDFLADDEPY
                     RLAPDRPDAIIINH"
     misc_feature    240399..241025
                     /locus_tag="CNE_1c02410"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    240402..240620
                     /locus_tag="CNE_1c02410"
                     /note="GST_N family, unknown subfamily 1; composed of
                     uncharacterized proteins, predominantly from bacteria,
                     with similarity to GSTs. GSTs are cytosolic dimeric
                     proteins involved in cellular detoxification by catalyzing
                     the conjugation of glutathione (GSH) with...; Region:
                     GST_N_1; cd03043"
                     /db_xref="CDD:239341"
     misc_feature    order(240435..240437,240441..240446,240450..240455,
                     240462..240467,240597..240599,240606..240611)
                     /locus_tag="CNE_1c02410"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239341"
     misc_feature    order(240435..240437,240552..240560,240591..240596)
                     /locus_tag="CNE_1c02410"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239341"
     misc_feature    order(240552..240554,240588..240593,240597..240602,
                     240609..240611)
                     /locus_tag="CNE_1c02410"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239341"
     misc_feature    240657..241010
                     /locus_tag="CNE_1c02410"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 3 of Glutathione S-transferases; Region:
                     GST_C_3; cd03194"
                     /db_xref="CDD:198303"
     misc_feature    order(240666..240668,240687..240689,240873..240875,
                     240882..240887,240894..240896,240906..240908)
                     /locus_tag="CNE_1c02410"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198303"
     misc_feature    order(240666..240671,240678..240683,240690..240692,
                     240798..240800)
                     /locus_tag="CNE_1c02410"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198303"
     misc_feature    order(240687..240689,240699..240704,240711..240716,
                     240897..240899,240906..240908)
                     /locus_tag="CNE_1c02410"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198303"
     gene            241154..242389
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /db_xref="GeneID:10916633"
     CDS             241154..242389
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /EC_number="2.7.7.72"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA nucleotidyltransferase Cca"
                     /protein_id="YP_004684092.1"
                     /db_xref="GI:339324399"
                     /db_xref="GeneID:10916633"
                     /translation="MQVYAVGGAIRDELLGKPSQDRDYVVVGATPAQMEAAGFRPVGK
                     DFPVFLHPRTQEEYALARTERKTAMGYKGFAFYCEPDVTLEDDLVRRDLTINAMARAV
                     DADGNLAGPVIDPHGGQRDLAARLFRHVSDAFAEDPVRILRLARFAARFQDFTVAAET
                     MRLMREMVAAGEVDALVPERVWQELARGLMEARPSRMFEVLRECGALARLLPELDRLW
                     GVPQRADYHPEVDTGVHVMMVIDCAAALGAPLPVRFAALVHDLGKGTTPEDVLPRHTG
                     HEMRSVKLLEAVCARLRVPNDCRDLAVVVAREHGNIHRSLEFSAAAVVRLLERCDALR
                     KPARFAEALQACEADMRGRKGFEASAYPQAARLLAALDAAAAVDAGAVARACGDDVSQ
                     IRDRVHAARVAAVAQRLGC"
     misc_feature    241154..242242
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="multifunctional tRNA nucleotidyl
                     transferase/2'3'-cyclic
                     phosphodiesterase/2'nucleotidase/phosphatase; Reviewed;
                     Region: cca; PRK10885"
                     /db_xref="CDD:182810"
     misc_feature    241154..241525
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="Nucleotidyltransferase (NT) domain of ClassII
                     CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
                     /db_xref="CDD:143388"
     misc_feature    order(241172..241177,241184..241189,241214..241216,
                     241220..241222,241322..241324,241337..241339,
                     241421..241432,241439..241441)
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="active site"
                     /db_xref="CDD:143388"
     misc_feature    order(241172..241177,241184..241186,241214..241216,
                     241220..241222,241421..241429,241439..241441)
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143388"
     misc_feature    order(241214..241216,241220..241222,241322..241324)
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143388"
     misc_feature    241610..241804
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="Probable RNA and SrmB- binding site of polymerase
                     A; Region: PolyA_pol_RNAbd; pfam12627"
                     /db_xref="CDD:257174"
     misc_feature    241844..>242017
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(241856..241858,241928..241933)
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    241931..241933
                     /gene="cca"
                     /locus_tag="CNE_1c02420"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(242386..242823)
                     /locus_tag="CNE_1c02430"
                     /db_xref="GeneID:10916634"
     CDS             complement(242386..242823)
                     /locus_tag="CNE_1c02430"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspA family"
                     /protein_id="YP_004684093.1"
                     /db_xref="GI:339324400"
                     /db_xref="GeneID:10916634"
                     /translation="MFKHLLVAVDGSDLSDTAYRKAIELASSIQARLTAIQVVAHYDV
                     MRLQTAMLQETRQRFMQEAYRQAEAYLATIAQEAAAAGVPCETACPTGDHIFQAIIDE
                     AEARKCDLIVMASHGRRGLQALLIGSETHKVLTHATIPVLVFR"
     misc_feature    complement(242395..242814)
                     /locus_tag="CNE_1c02430"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(242434..242445,242473..242478,
                     242482..242487,242710..242712,242794..242802))
                     /locus_tag="CNE_1c02430"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(242865..243698)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /db_xref="GeneID:10916635"
     CDS             complement(242865..243698)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system ATP-binding protein LivF"
                     /protein_id="YP_004684094.1"
                     /db_xref="GI:339324401"
                     /db_xref="GeneID:10916635"
                     /translation="MISAHTAAQPAVHAPAATLAAALSRPRPTIGQLEQLAGGTPMVA
                     VDNLVAGYGAMEIVHGFSLRVARGGSLCLIGPNGAGKSTVLRAIYGLARVMSGTITVA
                     GAPVTHLRAEQKLRQAGVAYVLQEGSIFPDMTVEENLLMGGYLMPHSRDARAAAERIF
                     QRHGALAQRRGERASVLSGGERRLLEISRALMMDPAVLLVDEPSIGLEPRYVDLVFEH
                     LRQLQQDEGKTIILVEQNARKGLAFADLGYVLVAGQLAMAGTGGELGRDPEVGRLFLG
                     A"
     misc_feature    complement(242871..243581)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(242898..243566)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(243453..243476)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(242994..242996,243093..243098,
                     243324..243326,243450..243458,243462..243467))
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(243324..243335)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(243141..243170)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(243093..243110)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(243075..243086)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(242988..243008)
                     /gene="livF1"
                     /locus_tag="CNE_1c02440"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(243695..244441)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /db_xref="GeneID:10916636"
     CDS             complement(243695..244441)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein LivG"
                     /protein_id="YP_004684095.1"
                     /db_xref="GI:339324402"
                     /db_xref="GeneID:10916636"
                     /translation="MNDLLAVRGVTKRFGGVVANHDISLQVPHGSIVGLIGPNGSGKT
                     TLFNSIVGYHPIDGGSIAFDGREISRLRVPEIARLGLVRTFQQTRVFGKMSCLQNLLV
                     SVPHMREGLAAMCMRQAPAVTERARQTLRMAGLEDHGDRRGADLSFGQQKLLEICMAL
                     MNEPRLLLLDEPTAGVNPVTIDSLIALLRDINARLGITLLVIEHNMRVMMQLAGHIYC
                     LAHGEVLAQGSPAQITANPTVIEAYLGGQP"
     misc_feature    complement(243704..244441)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(243725..244429)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(244310..244333)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(243830..243832,243929..243934,
                     244184..244186,244307..244315,244319..244324))
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(244184..244195)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(243977..244006)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(243929..243946)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(243911..243922)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(243824..243844)
                     /gene="livG1"
                     /locus_tag="CNE_1c02450"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(244438..245385)
                     /gene="livM1"
                     /locus_tag="CNE_1c02460"
                     /db_xref="GeneID:10916637"
     CDS             complement(244438..245385)
                     /gene="livM1"
                     /locus_tag="CNE_1c02460"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system permease LivM"
                     /protein_id="YP_004684096.1"
                     /db_xref="GI:339324403"
                     /db_xref="GeneID:10916637"
                     /translation="MALLAGSVGALIAPWLFAGITTQLTFLWLMVLFALTWDVMGGQM
                     GYNSFGNIVFFGVGAYVCAVVQRDFGLGYFAGLAVGTGLAALAAVAAALALGPAMLGL
                     RGHYFAIGTLGLGIACADGAAGWDFIGAGSGMTLPLFPGAAGSREPFFYYAMLVLAVV
                     TLLSLRWLYARPFGLALNAIRDDEDKAEALGLHTTRYKILAWCVCALFLGMAGALTGN
                     LVGFIDPRELAFAGATFGVWMVVMAILGGKGTLWGPVIGAALFHLTQELFWTYLLNWQ
                     RVALGVLIVLIVVLFPTGIMGWLRDYSANRRRITGSPAP"
     misc_feature    complement(244495..245301)
                     /gene="livM1"
                     /locus_tag="CNE_1c02460"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(244777..244833)
                     /gene="livM1"
                     /locus_tag="CNE_1c02460"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(245457..246353)
                     /gene="livH1"
                     /locus_tag="CNE_1c02470"
                     /db_xref="GeneID:10916638"
     CDS             complement(245457..246353)
                     /gene="livH1"
                     /locus_tag="CNE_1c02470"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system permease LivH"
                     /protein_id="YP_004684097.1"
                     /db_xref="GI:339324404"
                     /db_xref="GeneID:10916638"
                     /translation="MSNLAVLFQSPELNLQLVVDGLLAGAIFALAAYGMALVWGVMNL
                     INIAQGELVMLGGYIVIWLVGKGVPPMLAVPVAAAVMYCVGWGLYRIVIFRLVERDLF
                     VSVLATFGLSIVLQQLANLAFGANVRTVDAGLGSLLLPGGLVVPKIKLAAFAAALALG
                     ASLMLFLRHSRRGQAIRATAQNARAARVLGVDADRIYASTFALNAAICGAAGGLVAMT
                     WIIHPYLGLPYTVRAFMIVVVAGLGSMLPVLGAGGGLGIAENYAGFLLGTEYQTAFLY
                     ALLVAILVSRNLMLRRRRGYLR"
     misc_feature    complement(245502..246293)
                     /gene="livH1"
                     /locus_tag="CNE_1c02470"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(245748..245804)
                     /gene="livH1"
                     /locus_tag="CNE_1c02470"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(246379..247608)
                     /locus_tag="CNE_1c02480"
                     /db_xref="GeneID:10916639"
     CDS             complement(246379..247608)
                     /locus_tag="CNE_1c02480"
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein 5"
                     /protein_id="YP_004684098.1"
                     /db_xref="GI:339324405"
                     /db_xref="GeneID:10916639"
                     /translation="MRHAAVCALAGLGLAVSAPAAAKVEGDTIVLGAAVSLTGKYSTN
                     GKNTQDGYNLAVKRVNEMGGVKVGGKAYQLKVLYYDDESTSARGAQLAERLINQDGVK
                     YVLGPYSSGLTKAIAPVTEKYKIPMVEGNGADRNLFTQGYRYMFAVLNTSDYYLRSAI
                     QLAAEEAQRAGKSPKSLKVAIAIENDNFSRDVRDGVEEDAKRLGMQVVIDDKLPPELN
                     DMSATLAKVKALKPDILVVSGHEKGAALAVRQVAEMRIDVPMLALTHCDSAQVIEKFG
                     KSAEFAVCGSQWDRTLGYKDRWFGTADQYAQRFEKEYHYEAPYQAAESTAAVLAFADA
                     FERAGSFDTEKVRDALAKTDLMTFYGPLRFDQSGKNIAKSMVLYQVQDGKFKVVAPGK
                     WASSKVIYPAPAWARRK"
     misc_feature    complement(246469..247521)
                     /locus_tag="CNE_1c02480"
                     /note="Type I periplasmic ligand-binding domain of
                     uncharacterized ABC (ATPase Binding Cassette)-type active
                     transport systems that are predicted to be involved in
                     transport of amino acids, peptides, or inorganic ions;
                     Region: PBP1_ABC_ligand_binding_like_5; cd06338"
                     /db_xref="CDD:107333"
     misc_feature    complement(246463..247452)
                     /locus_tag="CNE_1c02480"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    complement(order(246817..246819,246889..246891,
                     247045..247047,247210..247218,247279..247287))
                     /locus_tag="CNE_1c02480"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107333"
     gene            247856..249247
                     /locus_tag="CNE_1c02490"
                     /db_xref="GeneID:10916640"
     CDS             247856..249247
                     /locus_tag="CNE_1c02490"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar uptake ABC transporter"
                     /protein_id="YP_004684099.1"
                     /db_xref="GI:339324406"
                     /db_xref="GeneID:10916640"
                     /translation="MAKTAHPGGTHVAVATSPNTNTNTGRRGFIRATGAVGLAAGLGP
                     FVIPRYAHAAKHTLKILQWNHFVPGYDKWFDDTYVKEWGQKNDTEVVVDHVGIPALAT
                     RAAAEVSAQKGHDLFMFLSPPPVYEEQVIDHRELYEECQRKHGKPMELAIKSTYNPKT
                     KKYFGFSDSFVPDPINYRKDLWDEAGMKPPDTWLDVLAAGRKIKAKSGIPVGVGLSAE
                     LDTAMAMRAILYAFGGSVQDDRHTVVLNSKNTIEAVKFVKALYQEAMAPDVLAWDPSS
                     NNRAMLAGKISLCLNAISITREAENKNLPIARDIWLTQALQGPVRRIALEHVMDCYVI
                     WKFAENIAGAKKFLVDYIDNFRQGFLGSEFYNFPCFPSTVPDLQKLIADDQKATPRDK
                     YKVLGALMNQATNVGYPGYANAAVDEIFNTWVLNTMFAKAATGDETPENAVRIADAAC
                     KRIFSKWRDKGMV"
     misc_feature    247940..249226
                     /locus_tag="CNE_1c02490"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    <248339..248899
                     /locus_tag="CNE_1c02490"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            249261..250289
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /db_xref="GeneID:10916641"
     CDS             249261..250289
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /EC_number="3.6.3.20"
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_004684100.1"
                     /db_xref="GI:339324407"
                     /db_xref="GeneID:10916641"
                     /translation="MASVEVRSLTKHFDGANVVDNVDLGARDAEFLVLLGPSGSGKTT
                     LLRLIAGLETPSHGDILVDGRVVTALPPRLRNMAMVFQSYALYPHLNVFDNIAFPLRA
                     RHMSREEVGRKVDWAAQLFGIGHLLQRKPRQLSGGERQRVALARAVVREPVAFLLDEP
                     LSNLDAKLRTSARDELQRFQRRLAITTVYVTHDQIEALGLGDRIAILDHGRIHQIGTP
                     QEVYERPADLFVATFIGSPPMNLIEADGVVTGFRPEHFLPREAYPAADALRAFAMDVT
                     RIENLGSDRLVYGKLEAPLPPASVVSRIPCTVTVPIEPGAGHRFVVRERDLRRFDAKS
                     GASLGAAP"
     misc_feature    249261..250259
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    249270..249908
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    249366..249389
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(249375..249380,249384..249392,249504..249506,
                     249732..249737,249834..249836)
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    249495..249506
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    249660..249689
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    249720..249737
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    249744..249755
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    249822..249842
                     /gene="ugpC1"
                     /locus_tag="CNE_1c02500"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     gene            250286..251233
                     /locus_tag="CNE_1c02510"
                     /db_xref="GeneID:10916642"
     CDS             250286..251233
                     /locus_tag="CNE_1c02510"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004684101.1"
                     /db_xref="GI:339324408"
                     /db_xref="GeneID:10916642"
                     /translation="MTPLHIATGQPAQDQARQPAQRLADDDRWLGRAMLAPAVIYIAL
                     LVGFPFMLSIYYSLSDATVGSQVLHFVGLENFRRVLESNTFWRSLRNALVFTLVSQVL
                     VVVLAKMLAMALYQDFRGKWLVRLLILLPWVAPISLGTIGWLWIFDPVYSIINWTLAA
                     VGVLGPRNWPVWLGQPELAMASVIVVDVWRLLPLATVIILAGLSGIPQDIHDAAAMDG
                     AGFWRHLFLINLPLVMPIMLVALLFGIVFTFTDMIIIYVLTRGGPYDTTQVLASLAFF
                     TGIQGGDLAEGAAISLFLFPVLVAVVIVLLTVARRAEVT"
     misc_feature    250616..251170
                     /locus_tag="CNE_1c02510"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(250625..250627,250655..250666,250670..250699,
                     250706..250711,250715..250717,250847..250852,
                     250859..250861,250865..250867,250874..250879,
                     250883..250885,250895..250900,250907..250909,
                     250958..250960,251000..251005,251012..251014,
                     251033..251044,251051..251056,251099..251104,
                     251132..251137,251144..251149,251153..251158,
                     251165..251170)
                     /locus_tag="CNE_1c02510"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(250673..250717,251033..251050)
                     /locus_tag="CNE_1c02510"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(250715..250717,250832..250834,251051..251053,
                     251093..251095,251102..251104,251132..251134)
                     /locus_tag="CNE_1c02510"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(250910..250948,250964..250969,250979..250981)
                     /locus_tag="CNE_1c02510"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            251235..252089
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /db_xref="GeneID:10916643"
     CDS             251235..252089
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004684102.1"
                     /db_xref="GI:339324409"
                     /db_xref="GeneID:10916643"
                     /translation="MRAAAITYRRWAARGAHFGLLAAFVAFCAFPFYWMLITTFKDVH
                     DLINTANNPFLFNLPPTMENLRILFGETRYLRWVLNTLVVAVGVVLITLLLAVPAGYS
                     LARLSGRWGRQWAIGIFLTYLIPPTILFIPFSRIIGSLGLQDSLWSLVLVYPSFTVPF
                     CSWLMMGFFKAVPRDIEEAAMMDGLSRFGAFLKVVVPLSSSGILTVVIFSATLAMQEF
                     VYALTFITSSSQYTVSVGVPTFLVRGDVYFWGSLMGACLIVSVPVAALYNSFLDRFVA
                     GFTVGAIK"
     misc_feature    251259..252086
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    251469..252023
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(251514..251519,251526..251531,251544..251546,
                     251574..251585,251589..251618,251625..251630,
                     251697..251702,251706..251708,251712..251714,
                     251721..251726,251730..251732,251742..251747,
                     251754..251756,251805..251807,251847..251852,
                     251859..251861,251880..251891,251901..251906,
                     251943..251948,251976..251981,251988..251993,
                     251997..252002,252009..252014,252021..252023)
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(251592..251630,251880..251891,251895..251900)
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(251682..251684,251901..251903,251937..251939,
                     251946..251948,251976..251978)
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(251757..251795,251811..251816,251826..251828)
                     /gene="ycjP"
                     /locus_tag="CNE_1c02520"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(252099..252293)
                     /locus_tag="CNE_1c02530"
                     /db_xref="GeneID:10916644"
     CDS             complement(252099..252293)
                     /locus_tag="CNE_1c02530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684103.1"
                     /db_xref="GI:339324410"
                     /db_xref="GeneID:10916644"
                     /translation="MLRWTLTIFLSVIILSAALPWLQKVGLGRLPGDVRFRLFGREFV
                     LPFASTILLSMVALVIGKLL"
     misc_feature    complement(252102..252293)
                     /locus_tag="CNE_1c02530"
                     /note="Protein of unknown function (DUF2905); Region:
                     DUF2905; pfam11146"
                     /db_xref="CDD:256316"
     gene            complement(252310..253497)
                     /locus_tag="CNE_1c02540"
                     /db_xref="GeneID:10916645"
     CDS             complement(252310..253497)
                     /locus_tag="CNE_1c02540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684104.1"
                     /db_xref="GI:339324411"
                     /db_xref="GeneID:10916645"
                     /translation="MQKAASLPLPPADAQAASDTLTARIGESIDAAGGWIGFDRYMAL
                     ALYAPGLGYYSGGSAKFGRDARDGSDFITAPELSPFFARTLARQFAPLLAQGLPRMLE
                     FGAGTGRLAADLLLGLEQEGQLPDTYAIVELSGELRARQQATLAQRAPHLADRVTWLD
                     TLPASFEGVIVGNEVLDAMPVQLYARSGSRWHERGVVRGDDATSAFRFEDRPLADADV
                     PEALRDIPGDHDLVTETHAEAEGFTRAVGAMLARGAAFFIDYGFPAGEYYHPQRAGGT
                     LMCHYRHHAHPDPFLYPGLQDITAHVNFSGIALAAVDAGLTVAGFASQARFLMNAGIT
                     ELLMALDPSDARAFLPQANAVQKLLSEAEMGELFKVIALTRALDDSEPMDGFARGDRC
                     HTL"
     misc_feature    complement(252337..253443)
                     /locus_tag="CNE_1c02540"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1565"
                     /db_xref="CDD:224481"
     misc_feature    complement(252535..253248)
                     /locus_tag="CNE_1c02540"
                     /note="Putative S-adenosyl-L-methionine-dependent
                     methyltransferase; Region: Methyltransf_28; pfam02636"
                     /db_xref="CDD:251439"
     gene            253672..254367
                     /locus_tag="CNE_1c02550"
                     /db_xref="GeneID:10916646"
     CDS             253672..254367
                     /locus_tag="CNE_1c02550"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004684105.1"
                     /db_xref="GI:339324412"
                     /db_xref="GeneID:10916646"
                     /translation="MAVHCHRSVDEAEALAAQIRALGRRAAVLRADLADEAATGRLVA
                     DCTAALGVPTCLVNNASLFQYDVATSFSYASLDTHMRTNVAAPLLLARELHKALGAAA
                     GNDKVIEPRGVVINLLDQKLDNLNPDFLSYTLSKAALQTATVQLAQALAPRLRVVGVA
                     PGITLVSGEQSEQSFRRAHRVTPLGQSSTPEDIAQAVAYLAQARAVTGTTLYVDGGQH
                     LMPLARDVMFLTE"
     misc_feature    253675..254364
                     /locus_tag="CNE_1c02550"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK09134"
                     /db_xref="CDD:236389"
     misc_feature    253678..254319
                     /locus_tag="CNE_1c02550"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(253684..253692,253846..253854,254020..254028,
                     254065..254067,254077..254079,254152..254163)
                     /locus_tag="CNE_1c02550"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(253918..253920,254026..254028,254065..254067,
                     254077..254079)
                     /locus_tag="CNE_1c02550"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            254454..254855
                     /gene="folB"
                     /locus_tag="CNE_1c02560"
                     /db_xref="GeneID:10916647"
     CDS             254454..254855
                     /gene="folB"
                     /locus_tag="CNE_1c02560"
                     /EC_number="4.1.2.25"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase FolB"
                     /protein_id="YP_004684106.1"
                     /db_xref="GI:339324413"
                     /db_xref="GeneID:10916647"
                     /translation="MTMLAALSHPSLQDCRRMFLRNYEVQINIGVHEFEKKGEQRVLI
                     NIDLFVPLAQSTPQADKLDEVVDYDFMRNTVAERMAQGHVHLQETLCDDVARAMLKHP
                     KVRAVRVSTEKPDVYPDCDSVGVEVFHIKQA"
     misc_feature    254505..254837
                     /gene="folB"
                     /locus_tag="CNE_1c02560"
                     /note="Dihydroneopterin aldolase; Region: FolB;
                     smart00905"
                     /db_xref="CDD:214902"
     misc_feature    order(254571..254573,254577..254579,254784..254786,
                     254832..254834)
                     /gene="folB"
                     /locus_tag="CNE_1c02560"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            254965..255909
                     /gene="ttcA"
                     /locus_tag="CNE_1c02570"
                     /db_xref="GeneID:10916648"
     CDS             254965..255909
                     /gene="ttcA"
                     /locus_tag="CNE_1c02570"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA 2-thiocytidine biosynthesis protein TtcA"
                     /protein_id="YP_004684107.1"
                     /db_xref="GI:339324414"
                     /db_xref="GeneID:10916648"
                     /translation="MSHSNNFYRLETRLQSQTGKAIGDFGMIEDGDTVLVCMSGGKDS
                     YTMLSVLMALQKRAPIQFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEADTYSI
                     VKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVQTFFLNMFFGGKM
                     KAMPPKLSTDDGQHIVIRPLAYCSEKDIASYARAMEFPIIPCNLCGSQENLQRKKVSE
                     MLQDWERQNPGRIDNIFSALRNVVPSHLADTDLFPFTGLATGLAKVDEASLFGETTFQ
                     QQPLMFAGNVEENRMEFVRFERPPAAAAAPAAEQAGTQ"
     misc_feature    254971..255744
                     /gene="ttcA"
                     /locus_tag="CNE_1c02570"
                     /note="tRNA 2-thiocytidine biosynthesis protein TtcA;
                     Provisional; Region: PRK10696"
                     /db_xref="CDD:236737"
     misc_feature    255064..255588
                     /gene="ttcA"
                     /locus_tag="CNE_1c02570"
                     /note="This is a subfamily of Adenine nucleotide alpha
                     hydrolases superfamily.Adeninosine nucleotide alpha
                     hydrolases superfamily  includes N type ATP PPases and ATP
                     sulphurylases. It forms a apha/beta/apha fold which  binds
                     to Adenosine group.  This subfamily; Region:
                     Alpha_ANH_like_II; cd01993"
                     /db_xref="CDD:238951"
     misc_feature    order(255073..255081,255085..255096,255166..255168,
                     255172..255174)
                     /gene="ttcA"
                     /locus_tag="CNE_1c02570"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238951"
     gene            complement(255982..256932)
                     /locus_tag="CNE_1c02580"
                     /db_xref="GeneID:10916649"
     CDS             complement(255982..256932)
                     /locus_tag="CNE_1c02580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684108.1"
                     /db_xref="GI:339324415"
                     /db_xref="GeneID:10916649"
                     /translation="MRADFNMAVSAHRAAVSEFHNCWARRIFAILGAAALCACSAMKL
                     GYQQGDHLAYWWIDNYVDVTTAQEPLTREAIARFFAWHRKAQLPEIATLLQQAKAEVR
                     QPVTPATVEHFQDASQQLARKSFEQAMPDLADLLLTLTPEQIGRMEKKFGEGNAKYRK
                     KFLNPNPAEREEARYDKVMEYARLVYGNFSSDQEKAIRARIGPVVQNAEARYAERVAR
                     QQEWLKMVRYVQATQPPKAQVIDVLHRFREYWQNPPARLAASHEASDNAGIALTVAIA
                     NMTTPQQKAHAQDRFQKWIDDTHALMRDKANAPVRAAAAN"
     misc_feature    complement(<256627..>256854)
                     /locus_tag="CNE_1c02580"
                     /note="CRISPR/Cas system-associated protein Csx17; Region:
                     Csx17_I-U; cl18967"
                     /db_xref="CDD:267320"
     gene            257100..258464
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /db_xref="GeneID:10916650"
     CDS             257100..258464
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /EC_number="2.3.1.-"
                     /EC_number="2.7.7.23"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-1-phosphate acetyltransferase /
                     UDP-N-acetylglucosamine pyrophosphorylase GluM"
                     /protein_id="YP_004684109.1"
                     /db_xref="GI:339324416"
                     /db_xref="GeneID:10916650"
                     /translation="MNIVILAAGMGKRMYSDLPKVLHPVAGRPMLAHVLDTARALSPS
                     RLVVVVGHGAGRVREAVAADDVAFAEQPQQLGTGHAVMQALPLLDDSQPTLVLYGDVP
                     LTSAATLQALVAEAGTQRFGVLTVEMPDPTGYGRIVRDAAGSIVRIVEQKDASDAEKA
                     IREINTGIIVCPTGHLRKWLSTLRNDNAQGEYYLTDTVERAVADGVETVSAQPAAIWE
                     TLGVNSKLQLAEVERIHQGNQARRLLEAGVTLLDPARIDVRGELSCGRDVTIDVGCVF
                     EGRVHLEDGVRIGAHCVIRNSTVGAGAQVHPFCHIDEARVGPAGRIGPYARLRPGTEL
                     GEDVHIGNFVEVKNAQVAAHSKANHLAYVGDATVGSRVNIGAGTITCNYDGVNKHRTV
                     IEDDVFIGSDTQLVAPVTVRRGATLGAGTTLTKEAPADKLTLSRAKQLTIDAWQRPVK
                     QPKK"
     misc_feature    257100..258461
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="N-acetylglucosamine-1-phosphate uridyltransferase
                     (contains nucleotidyltransferase and I-patch
                     acetyltransferase domains) [Cell envelope biogenesis,
                     outer membrane]; Region: GlmU; COG1207"
                     /db_xref="CDD:224128"
     misc_feature    257106..257783
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    order(257115..257123,257244..257246,257328..257330,
                     257337..257339,257391..257393,257397..257399)
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    order(257397..257399,257766..257768)
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    257838..258416
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    order(258084..258086,258132..258134,258138..258140,
                     258174..258176,258183..258185,258216..258227,
                     258240..258248,258261..258263,258291..258293,
                     258297..258302,258351..258356,258405..258407)
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    order(258084..258086,258132..258134,258138..258140,
                     258174..258176,258183..258185,258216..258224,
                     258243..258245,258261..258263)
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    order(258225..258227,258240..258242,258246..258248,
                     258297..258302,258351..258356,258405..258407)
                     /gene="gluM"
                     /locus_tag="CNE_1c02590"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            258582..260420
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /db_xref="GeneID:10916651"
     CDS             258582..260420
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /EC_number="2.6.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-fructose-6-phosphate transaminase"
                     /protein_id="YP_004684110.1"
                     /db_xref="GI:339324417"
                     /db_xref="GeneID:10916651"
                     /translation="MCGIVGAVSTRNIVPVLIEGLRRLEYRGYDSCGVAVVRDDAVER
                     ARTVSRVADLDAQTQASGLSGFTGVAHTRWATHGKPDTVNAHPHLSGETIALVHNGII
                     ENYEPLREELRAVGYGFESQTDSEVVAHLIHQAYTYPSSATRGDLFASVRAVTKRLHG
                     AYAIAVFAKDQPGRVVGARAGSPLVVALGENEAFLASDALAVAGTANRIIYLEEGDVV
                     EITLDGVTIHDVDDHPVEREARVVEAHAASVELGPYRHFMQKEIFEQPRALGDTLEGI
                     ESISPELFGSGAAEVFAGIDSVLILACGTSYYSGCTAKYWLESIARIPTQVEVASEYR
                     YRETVPNPRALVVVISQSGETADTMAALRHARALGHVHTLAVCNVATSAMVRETELRF
                     LTRAGTEIGVASTKAFTTQLAALYMLTLALAKVRGLLTEDAEAKALTNLRHLPVALHG
                     VLALEPQIIAWSEDFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKH
                     GPLALVTEAMPVVTVAPNDALLEKLKSNIQEVRARGGRLYVFADSDTQIQSSDGIQVI
                     RLPEHYGDLSPILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
     misc_feature    258582..260417
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="glucosamine--fructose-6-phosphate aminotransferase;
                     Reviewed; Region: PRK00331"
                     /db_xref="CDD:234729"
     misc_feature    258585..259241
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_GFAT-type. This domain is found at the N-terminus
                     of glucosamine-6P synthase (GlmS, or GFAT in humans).  The
                     glutaminase domain catalyzes amide nitrogen transfer from
                     glutamine to the appropriate substrate. In...; Region:
                     GFAT; cd00714"
                     /db_xref="CDD:238366"
     misc_feature    order(258585..258587,258660..258662,258798..258803,
                     258807..258812,258837..258839,258876..258881,
                     258951..258956)
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="glutaminase active site [active]"
                     /db_xref="CDD:238366"
     misc_feature    259473..259850
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    order(259488..259493,259521..259526,259533..259538,
                     259557..259559,259563..259565,259575..259577,
                     259584..259586,259650..259652)
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    order(259494..259499,259629..259637)
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    259947..260411
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    order(260010..260012,260052..260054,260064..260066,
                     260070..260072,260076..260078,260082..260084,
                     260094..260096,260100..260108,260112..260123,
                     260172..260177,260187..260189,260193..260198,
                     260388..260393,260406..260408)
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    order(260046..260048,260055..260057)
                     /gene="glmS"
                     /locus_tag="CNE_1c02600"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            261151..261780
                     /locus_tag="CNE_1c02610"
                     /db_xref="GeneID:10916652"
     CDS             261151..261780
                     /locus_tag="CNE_1c02610"
                     /note="membrane anchoring protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate reductase cytochrome b subunit"
                     /protein_id="YP_004684111.1"
                     /db_xref="GI:339324418"
                     /db_xref="GeneID:10916652"
                     /translation="MKNAHHVPPDKLAPHSQSIQPAWVRITHWLNLIAVLIMMLSGWR
                     IYNASPLFGFHFPNAITLGGWLAGGLQWHFAAMWLLVANGLFYLVMNIVTGRFRRRFF
                     PLSVPAALRDIAAAMRGKLAHPNLAEYNAAQKLFYVGVVVVIVLTVLSGLAIWKSVQF
                     PLLRVLMGGYDAARWVHFIGMSAIALFLVIHVVMVLLVPRTLIIMLRGR"
     misc_feature    261202..261774
                     /locus_tag="CNE_1c02610"
                     /note="Cytochrome b(N-terminal)/b6/petB; Region:
                     Cytochrom_B_N; pfam00033"
                     /db_xref="CDD:249526"
     misc_feature    261205..261777
                     /locus_tag="CNE_1c02610"
                     /note="Thiosulfate reductase cytochrome B subunit
                     (membrane anchoring protein) [Energy production and
                     conversion]; Region: COG4117"
                     /db_xref="CDD:226602"
     gene            261802..262575
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /db_xref="GeneID:10916653"
     CDS             261802..262575
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase molybdopterin binding protein
                     SorA"
                     /protein_id="YP_004684112.1"
                     /db_xref="GI:339324419"
                     /db_xref="GeneID:10916653"
                     /translation="MSKAEQIVRLDRKLILHDATRELSMPSRRLFGKRAITLGGLLLL
                     TGCSITDKPSVESFLMAVSRFNDRVQGWLFDPNRLAPTYPESRLTRPFPFNAYYGLAD
                     VPEVDANAFQLEVGGLVSRRTAWTLEELYALPQTAQVTRHICVEGWSAIGKWGGTRFS
                     DFLQRVGADTTAKYVGFLCADDYYTSIDMPTALHPQTLLTFTYDGERLPPKYGFPIKL
                     RMPTKLGYKNPKHIVAIYVTNKYPGGYWEDQGYNWFGGS"
     misc_feature    261943..262569
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    262036..262566
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /note="Sulfite oxidase (SO) family, molybdopterin binding
                     domain. This molybdopterin cofactor (Moco) binding domain
                     is found in a variety of oxidoreductases, main members of
                     this family are nitrate reductase (NR) and sulfite oxidase
                     (SO). SO catalyzes the...; Region: SO_family_Moco;
                     cl00199"
                     /db_xref="CDD:260254"
     misc_feature    order(262087..262089,262093..262095,262099..262101,
                     262231..262233,262348..262350,262435..262437,
                     262450..262452,262474..262476,262483..262485,
                     262489..262494)
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    262231..262233
                     /gene="sorA"
                     /locus_tag="CNE_1c02620"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            262562..262912
                     /locus_tag="CNE_1c02630"
                     /db_xref="GeneID:10916654"
     CDS             262562..262912
                     /locus_tag="CNE_1c02630"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide MXKDX repeat-containing protein"
                     /protein_id="YP_004684113.1"
                     /db_xref="GI:339324420"
                     /db_xref="GeneID:10916654"
                     /translation="MGAPDPPKPDRQVCRPLFTNPIKGYNMNKRLVLLLSSAVLLASH
                     AWAQDAMKKDEMGKGAMGASGSMAKESMGKDDMDMKKEKMSKSHAKKPHEKKEGMSKG
                     TMEKDSMSKDATKQ"
     misc_feature    <262694..262900
                     /locus_tag="CNE_1c02630"
                     /note="pentapeptide MXKDX repeat protein; Region:
                     penta_MxKDx; TIGR02953"
                     /db_xref="CDD:131998"
     gene            263159..263596
                     /locus_tag="CNE_1c02640"
                     /db_xref="GeneID:10916655"
     CDS             263159..263596
                     /locus_tag="CNE_1c02640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684114.1"
                     /db_xref="GI:339324421"
                     /db_xref="GeneID:10916655"
                     /translation="MKKLFAALASAALVGTVFAQTAVPASATQPQGGASKDQAKVVKE
                     KSATLAKADKNHKSAGAHEVKAQASTNKEKADVKADASKSAAKGSHHNASKTKAAHTE
                     AGMAKADAKNDSDTAKAKADVAKPVAQPDAAKAAASVDKTKNQ"
     misc_feature    <263213..263593
                     /locus_tag="CNE_1c02640"
                     /note="prolipoprotein diacylglyceryl transferase;
                     Reviewed; Region: PRK13108"
                     /db_xref="CDD:237284"
     gene            263907..264266
                     /locus_tag="CNE_1c02650"
                     /db_xref="GeneID:10916656"
     CDS             263907..264266
                     /locus_tag="CNE_1c02650"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004684115.1"
                     /db_xref="GI:339324422"
                     /db_xref="GeneID:10916656"
                     /translation="MEMVRYYQRCGMLSISERVHGAIRQYSGDSLQWHHFIRRAQALG
                     FTLDEVRTLLQLNDGSKCGTARALAEQTLQVVEERLRDLRMLRTELRSLVGQCRDNRD
                     EVMCPLIANLCEANWPK"
     misc_feature    263910..264242
                     /locus_tag="CNE_1c02650"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    order(263919..263921,263970..263978)
                     /locus_tag="CNE_1c02650"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            complement(264315..264950)
                     /locus_tag="CNE_1c02660"
                     /db_xref="GeneID:10916657"
     CDS             complement(264315..264950)
                     /locus_tag="CNE_1c02660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684116.1"
                     /db_xref="GI:339324423"
                     /db_xref="GeneID:10916657"
                     /translation="MENKLTGLEGHAGYAAPRYSRGLRTTLLLLEAGRRLLRERTLEQ
                     VSIQEICAHAGVTTGAFYSRFEGKESYFKALQALVLTTLRKAMAERLAQLDTCPPTLE
                     DAVCTLARDSRIWAYRNAGVLRASLVARVTSGEDPIRQLNRQYMDDLASRLARLLPAG
                     ASPELELRIRFAHQALAGTLLYALINRDSTFAMSDRRLDMEMARAFLLYVA"
     misc_feature    complement(264327..264860)
                     /locus_tag="CNE_1c02660"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(264726..264860)
                     /locus_tag="CNE_1c02660"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            265137..266497
                     /locus_tag="CNE_1c02670"
                     /note="major facilitator superfamily MFS_1"
                     /pseudo
                     /db_xref="GeneID:10916658"
     gene            complement(266498..267700)
                     /locus_tag="CNE_1c02680"
                     /db_xref="GeneID:10916659"
     CDS             complement(266498..267700)
                     /locus_tag="CNE_1c02680"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="YP_004684117.1"
                     /db_xref="GI:339324424"
                     /db_xref="GeneID:10916659"
                     /translation="MSLSSLVGQEYDWAMQRLQAFKYELMPNGEQQRNMRRYAGSCRF
                     VYNKALALQKQRYDQGEKKLSYAGLCKQLTEWRNSTETAWLADAPVHPLQQTLKDLER
                     AYTNFFAKRADFPRFKKKGLGDSFRYPDQKQIKLDQTNSRIFLPKLGWLRYRNSRDVL
                     GEVRNACVSLSGGKWFVSIQTERKVERPVPKATSAIGIDMGIARFATMSDGTFLAPLN
                     SFRKHEARLRRAQRAMSRKTKFSNNWKKSKARIQRIHARIGNARLDYLHKATTTISEN
                     QAMVCIEDLKVRNMSKSAAGSSGQPGKNVRAKSGLNKAILDQGWYEFGRQLEYKLAWN
                     GGWLIAVPPQHTSRTCPCCGHVSAENRQSQASFACVACGYANHADVVGAINILARGHR
                     VAACGESA"
     misc_feature    complement(267515..267649)
                     /locus_tag="CNE_1c02680"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    complement(266501..267643)
                     /locus_tag="CNE_1c02680"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    complement(266828..267454)
                     /locus_tag="CNE_1c02680"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    complement(266534..266743)
                     /locus_tag="CNE_1c02680"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            267866..268012
                     /locus_tag="CNE_1c02690"
                     /db_xref="GeneID:10916660"
     CDS             267866..268012
                     /locus_tag="CNE_1c02690"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200-family protein"
                     /protein_id="YP_004684118.1"
                     /db_xref="GI:339324425"
                     /db_xref="GeneID:10916660"
                     /translation="MIRKKNYPSISKKLWGGALWSPSYFAGSCGGAPIEIIRQYIEQQ
                     QTPH"
     misc_feature    <267866..267997
                     /locus_tag="CNE_1c02690"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:250874"
     gene            complement(268083..269504)
                     /gene="tnpA1"
                     /locus_tag="CNE_1c02700"
                     /db_xref="GeneID:10916661"
     CDS             complement(268083..269504)
                     /gene="tnpA1"
                     /locus_tag="CNE_1c02700"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for transposon Tn5"
                     /protein_id="YP_004684119.1"
                     /db_xref="GI:339324426"
                     /db_xref="GeneID:10916661"
                     /translation="MSGVNFRPSYLCCCSGLAIRDDTADWASEEFAEASLGDARLSQR
                     LVALARQLAISPHTSLPQALSPAELKAAYRFFDNDQVDTNVVLAPHIAQTLHRMEQLP
                     VVLAIQDTTEFNLTHLHATEGLGRCTGGNERGFLMHSLLAVSPEGLPLGVLGMKTWTR
                     AEATKGSAAQRKSRPVHEKESAKWIEGLAHLSALKSRCAQTQLVGIGDRESDVYELFA
                     AERPDGVDWLVRAAWNRCARHPQRYLWQAVLDTPAAGYTELLIPARGARTLRTARLTL
                     RYAPVRLQPPQTRAGLPEQNVFAVHVIEDEPPAGIEPLEWMLLSSVPTHSPEQALERL
                     QWYARRWTIETWHRVLKSGCRIEARQFGTLERFVRATSLFAVIAWRILYTTLLARLDG
                     DLPCEVVLQPIEWQALYCRVHRTTRPPDKVPSLNQAVLWIATLGGYLNRRSDPPPGAT
                     VIWRGFFVLHEITEMFRIFSSGP"
     misc_feature    complement(269262..269432)
                     /gene="tnpA1"
                     /locus_tag="CNE_1c02700"
                     /note="Transposase DNA-binding; Region: Tnp_DNA_bind;
                     pfam14706"
                     /db_xref="CDD:258844"
     misc_feature    complement(268101..>268319)
                     /gene="tnpA1"
                     /locus_tag="CNE_1c02700"
                     /note="Transposase Tn5 dimerization domain; Region:
                     Dimer_Tnp_Tn5; pfam02281"
                     /db_xref="CDD:145436"
     gene            complement(269686..270627)
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /db_xref="GeneID:10916662"
     CDS             complement(269686..270627)
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /codon_start=1
                     /transl_table=11
                     /product="SDS degradation transcriptional activation
                     protein SdsB"
                     /protein_id="YP_004684120.1"
                     /db_xref="GI:339324427"
                     /db_xref="GeneID:10916662"
                     /translation="MGLRQLHHFVTLVEQGSFARAASALHLSQPALTRSIQALEADLG
                     PLIDRSYGKVRPTAAGMLALERARRMLREQRELRRDLQLLEEVEIGTIRAGFGPFAAS
                     FLLDPVLEALVRRYPHLRIDLETADTPAMRRSLEAERLDVFVGESRSLAEQGHLQIDR
                     LPALETAFFVRSGHPLARQREVTLAELRAYPVAGTRLPAHVLRFFRQALHEARGGSGP
                     VSEDAPGLMTVTCNDMHALRSLLLAVDAVALVPVAMMADACAQGMAVALPMHPPTELR
                     AQYGIVSLAGRSPSPAMRAFAALVHEAVAQASGGAGP"
     misc_feature    complement(269704..270627)
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(270448..270621)
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(269713..270360)
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /note="LysR substrate binding domain; Region:
                     LysR_substrate; pfam03466"
                     /db_xref="CDD:251977"
     misc_feature    complement(order(269899..269904,269908..269913,
                     269929..269946,270253..270273,270277..270279,
                     270289..270291,270298..270303,270307..270312))
                     /gene="sdsB"
                     /locus_tag="CNE_1c02710"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            270746..271738
                     /locus_tag="CNE_1c02720"
                     /db_xref="GeneID:10916663"
     CDS             270746..271738
                     /locus_tag="CNE_1c02720"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004684121.1"
                     /db_xref="GI:339324428"
                     /db_xref="GeneID:10916663"
                     /translation="MNRRAWLALAAGGLIGGFSLSLALPAAAQTYPAKPIRIVVPYVA
                     GGGTDTIARAMGEKLSKRLGQPVVVDNKAGASGIIGTDAVAKAAPDGYTLLMTLTQSV
                     LTNQFLYQKLPYDPRKDLTMISVLADAQLVLVAHPSVPARTVRELGEYARSRPGKLSY
                     ASWGVGSLSHLSGAYYSKLVHGQATHVPYKGEAPMMQDLLGGQVQFGFASILTAKPYI
                     QSGKLKALAVTGTQRSSALPDMPTFAESGMQDSAFKTVGWIGLVAPVGVPAPILARLE
                     GEVRAILQAPDMQERLVALGLRTVGSSPAEAQALYARDWPVLKTLVADSGAKLD"
     misc_feature    270896..271660
                     /locus_tag="CNE_1c02720"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            272033..272500
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /db_xref="GeneID:10916664"
     CDS             272033..272500
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="cytochrome b3"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="YP_004684122.1"
                     /db_xref="GI:339324429"
                     /db_xref="GeneID:10916664"
                     /translation="MKSDKKVIQLLNGQLRHELTAINQYFLHARMYRHWGLGALGKHE
                     YEESIEEMKHADKLIERILLLDGLPNLQDLDKLLLGENTEEMLGCDLKLEQVSQASCK
                     EAIKFFESVGDYVSREIVVDILADTEEHIDWLEAQLELVNKVGLQNYIQSAMG"
     misc_feature    272036..272494
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="Bacterioferritin, ferritin-like diiron-binding
                     domain; Region: Bacterioferritin; cd00907"
                     /db_xref="CDD:153099"
     misc_feature    272054..272464
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    order(272075..272077,272099..272101,272120..272122,
                     272165..272167,272186..272188,272198..272200)
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(272081..272086,272090..272095,272105..272107,
                     272183..272185,272192..272194,272309..272314,
                     272321..272323,272333..272335,272408..272413)
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="ferroxidase pore; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(272084..272086,272105..272107,272183..272185,
                     272192..272194,272312..272314,272333..272335,
                     272411..272413,272420..272422)
                     /gene="bfr1"
                     /locus_tag="CNE_1c02730"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153099"
     gene            272587..272661
                     /gene="trnC1"
                     /locus_tag="CNE_1c02740"
                     /note="tRNA-Cys-GCA"
                     /db_xref="GeneID:10916665"
     tRNA            272587..272661
                     /gene="trnC1"
                     /locus_tag="CNE_1c02740"
                     /product="tRNA-Cys"
                     /codon_recognized="UGC"
                     /db_xref="GeneID:10916665"
     gene            272981..273424
                     /locus_tag="CNE_1c02750"
                     /db_xref="GeneID:10916666"
     CDS             272981..273424
                     /locus_tag="CNE_1c02750"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="YP_004684123.1"
                     /db_xref="GI:339324430"
                     /db_xref="GeneID:10916666"
                     /translation="MIKDLRIRAAVPSDAPAVGSVLERCGLPVDDVARLLEHFHVAIL
                     GAQIIGCAAGERFGETVVIRSVAVLPEHRDQGVATHVVRAALMRARANGARRAVLLAS
                     SCPSYFARYGFTLVPAAKLPAEVMSSSEFHRHTDTPPLCMWCELD"
     misc_feature    273101..>273238
                     /locus_tag="CNE_1c02750"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(273176..273184,273212..273217)
                     /locus_tag="CNE_1c02750"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(273449..274438)
                     /gene="czcD1"
                     /locus_tag="CNE_1c02760"
                     /db_xref="GeneID:10916667"
     CDS             complement(273449..274438)
                     /gene="czcD1"
                     /locus_tag="CNE_1c02760"
                     /codon_start=1
                     /transl_table=11
                     /product="Co/Zn/Cd efflux system component CzcD"
                     /protein_id="YP_004684124.1"
                     /db_xref="GI:339324431"
                     /db_xref="GeneID:10916667"
                     /translation="MHSHDLSAWTHSHAFDAGNRAAERGTRLVMAITAATMVVEIAAG
                     LWFNSMALLADGWHMSSHALAIGLSAVAYAAARRYAGDRRFAFGTWKIEVLAGFASAV
                     FLLGIAALMAAGSVERLFSPQAIHYREAMAVTALGLLVNLGCALILGGHAHGHDHGHD
                     HGHHHHGHDHDHGHGHHHDINLRAAYMHVLADAATSVLALVALAGGWWLGWAWLDPVM
                     GLVGAALVGRWAVGLLRQSGTVLLDREMDHPVVEEVREMLAGLDPAYANGEERTRVTD
                     LHVWRVGRQQFACIACLVTHDPVLTPQRVREALSVHEELVHVTVEISRCDGAH"
     misc_feature    complement(273467..274438)
                     /gene="czcD1"
                     /locus_tag="CNE_1c02760"
                     /note="Co/Zn/Cd efflux system component [Inorganic ion
                     transport and metabolism]; Region: CzcD; COG1230"
                     /db_xref="CDD:224151"
     gene            complement(274818..276278)
                     /locus_tag="CNE_1c02770"
                     /db_xref="GeneID:10916668"
     CDS             complement(274818..276278)
                     /locus_tag="CNE_1c02770"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="MocR family transcriptional regulator"
                     /protein_id="YP_004684125.1"
                     /db_xref="GI:339324432"
                     /db_xref="GeneID:10916668"
                     /translation="MLTLNLTRSRRDGDTLTEQIVAGIAALVEQRALRAGTALPSVRR
                     FAQHHHVSTFTVAEAYGRLTALGYLAARPGSGYTVAHRHAPAGRARAPHWEAPGLNAA
                     WLLSDVFADHSVPIKAGAGWLPGDWLNEEGLHQAMRASARVPAAQLSGYGHPYGFAPL
                     REHIAAGLGQYGIPLQAQQVVLTQGATQALDLVVRTLLRAGDTVLVESPCYCNLLQIL
                     RLAGLRVVGVPRSAAGLDTDALDDAIRAHAPRALFINTVLQNPTGASLSSMNAFRVLQ
                     LAEQHRLLVVEDDIYRELAPAGSPMLAAMDGLSQVVYINGFSKTITPSLRVGYLAASP
                     DLAKAFARTKMAVGLTSSEVTERLVYSVLTSGHYGRHVAALAERLRAQQDRVTEKMET
                     HGLEVLLRPEGGMFAWARLNEAAQARLQASRRGEPLHGNRLATLALEHGIWLAPGSYF
                     EPDETDSPWIRFNVATGDAPQLWQFFDRLAQAPRAA"
     misc_feature    complement(274833..276236)
                     /locus_tag="CNE_1c02770"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(276039..276236)
                     /locus_tag="CNE_1c02770"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(276048..276059,276063..276068,
                     276096..276098,276105..276110,276114..276128,
                     276150..276155,276159..276161,276228..276230,
                     276234..276236))
                     /locus_tag="CNE_1c02770"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(274836..275876)
                     /locus_tag="CNE_1c02770"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(275301..275303,275322..275327,
                     275331..275333,275406..275408,275499..275501,
                     275646..275648,275718..275726))
                     /locus_tag="CNE_1c02770"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(275205..275207,275214..275216,
                     275301..275309,275427..275429,275616..275618,
                     275715..275717))
                     /locus_tag="CNE_1c02770"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(275322..275324)
                     /locus_tag="CNE_1c02770"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            276608..277939
                     /locus_tag="CNE_1c02780"
                     /db_xref="GeneID:10916669"
     CDS             276608..277939
                     /locus_tag="CNE_1c02780"
                     /EC_number="2.6.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="omega-amino acid--pyruvate aminotransferase"
                     /protein_id="YP_004684126.1"
                     /db_xref="GI:339324433"
                     /db_xref="GeneID:10916669"
                     /translation="MDAAKTVIPDLDALWMPFTANRQYKAAPRLLASASGMYYTTHDG
                     RQIMDGCAGLWCVAAGHCRKEISEAVARQAATLDYAPPFQMGHPLSFEAATKVASIMP
                     QGLDRIFFTNSGSESVDTALKIALAYHRARGEGQRTRFIGRERGYHGVGFGGMAVGGI
                     GPNRRAFSANLMPGTDHLPATLNIAEAAFSKGQPQWGAHLADELERILALHDPSNVAA
                     VIVEPLAGSAGVLVPPVGYLEKLREITSKHGILLIFDEVITAFGRLGAATAAERFKVT
                     PDLITMAKAINNAAVPMGAVAVRREVHDTVVNSAAPGAIELLHGYTYSGHPLAAAAAI
                     ATLDLYQRENLFGRAAELAPVFEAAVHGVRSAPHVKDIRNYGLVAGIELEPRPGQPGA
                     RAYEAFLKCLELGVLVRYTGDILAFSPPLIISEAQIGELFDTVKKALQDIK"
     misc_feature    276635..277933
                     /locus_tag="CNE_1c02780"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    276635..277924
                     /locus_tag="CNE_1c02780"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(276944..276952,277046..277051,277055..277057,
                     277271..277273,277370..277372,277376..277381,
                     277457..277459)
                     /locus_tag="CNE_1c02780"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(276947..276952,277046..277051,277271..277273,
                     277370..277372,277379..277381,277457..277459)
                     /locus_tag="CNE_1c02780"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    277457..277459
                     /locus_tag="CNE_1c02780"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            278049..279566
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /db_xref="GeneID:10916670"
     CDS             278049..279566
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /EC_number="1.2.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase MmsA"
                     /protein_id="YP_004684127.1"
                     /db_xref="GI:339324434"
                     /db_xref="GeneID:10916670"
                     /translation="MSIAENRQLAEIHHFIGGAVRRAGGQRHADVFNPATGEVAARVA
                     LGTTQDVADAVAAAQAAFPAWADTPPLRRARILFKFKELLDQHHDDLAALITREHGKV
                     FSDAKGEVTRGIEVVEFACGIPNLLKTDFTDNIGGGIDNWNLRQPLGVVAGITPFNFP
                     VMVPMWMFPVAIACGNTFVLKPSERDPSPSLLIADLLRQAGLPDGVFNVVQGDKEAVD
                     ALLAHPDVQALSFVGSTPIAEYIYTEGTKHGKRVQALGGAKNHLVVMPDADLDQAVDA
                     LIGAAYGSAGERCMAISVAVAVGDVADKLVPRLAERARTLKIRNGMESDAEMGPLVTG
                     AHKAKVEGYIAKGVQEGATLVTDGRGHKVDGHENGFYVGGTLFDNVKPDMTIYKEEIF
                     GPVLSVVRVHDFAEAVSLINAHEYGNGVSCYTSDGGIARAFARQIQVGMVGINVPIPV
                     PMAWHSFGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFTMPVAK"
     misc_feature    278082..279515
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /note="Methylmalonate semialdehyde dehydrogenase and ALDH
                     family members 6A1 and 6B2; Region: ALDH_F6_MMSDH;
                     cd07085"
                     /db_xref="CDD:143404"
     misc_feature    order(278253..278255,278259..278261,278271..278273,
                     278280..278282,278292..278294,278391..278393,
                     278400..278405,278430..278453,278466..278468,
                     278475..278477,278484..278486,278763..278765,
                     278775..278777,278784..278786,278793..278795,
                     278799..278801,279321..279323,279327..279332,
                     279336..279341,279348..279350,279357..279362,
                     279366..279368,279372..279383,279408..279410,
                     279420..279422,279426..279428,279468..279470,
                     279489..279506,279510..279515)
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143404"
     misc_feature    order(278511..278522,278544..278546,278589..278591,
                     278598..278600,278688..278690,278739..278750,
                     278757..278759,278811..278819,278913..278915,
                     279216..279218,279222..279224,279300..279302)
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143404"
     misc_feature    order(278520..278522,278811..278813,278904..278906,
                     278913..278915)
                     /gene="mmsA1"
                     /locus_tag="CNE_1c02790"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143404"
     gene            279646..279996
                     /locus_tag="CNE_1c02800"
                     /db_xref="GeneID:10916671"
     CDS             279646..279996
                     /locus_tag="CNE_1c02800"
                     /EC_number="4.4.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase"
                     /protein_id="YP_004684128.1"
                     /db_xref="GI:339324435"
                     /db_xref="GeneID:10916671"
                     /translation="MNVRRIVANISAAEPSLARAFYQDVLGLDLLMDHGWIQTYGRDT
                     AMSVQVSVASEGGSGTPVPDLSIEVDDVNEAHRRMVAAGFAIEYGPADEPWGVRRFYV
                     RDPFGRLVNILRHA"
     misc_feature    279658..279993
                     /locus_tag="CNE_1c02800"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_5; cd07238"
                     /db_xref="CDD:176662"
     misc_feature    order(279658..279684,279688..279690,279697..279699,
                     279709..279711,279721..279723,279727..279729,
                     279748..279771,279790..279816,279829..279855,
                     279928..279930,279961..279963)
                     /locus_tag="CNE_1c02800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176662"
     gene            complement(280003..280167)
                     /locus_tag="CNE_1c02810"
                     /db_xref="GeneID:10916672"
     CDS             complement(280003..280167)
                     /locus_tag="CNE_1c02810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684129.1"
                     /db_xref="GI:339324436"
                     /db_xref="GeneID:10916672"
                     /translation="MARARKLLAASTLPVEAIALKSGFASVQAFRACWNKGEAGTPSA
                     YRQASTCSAE"
     misc_feature    complement(280030..>280167)
                     /locus_tag="CNE_1c02810"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            complement(280301..281503)
                     /locus_tag="CNE_1c02820"
                     /db_xref="GeneID:10916673"
     CDS             complement(280301..281503)
                     /locus_tag="CNE_1c02820"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="YP_004684130.1"
                     /db_xref="GI:339324437"
                     /db_xref="GeneID:10916673"
                     /translation="MSLSSLVGQEYDWAMQRLQAFKYELMPNGEQQRNMRRYAGSCRF
                     VYNKALALQKQRYDQGEKKLSYAGLCKQLTEWRNSTETAWLADAPVHPLQQTLKDLER
                     AYTNFFAKRADFPRFKKKGLGDSFRYPDQKQIKLDQTNSRIFLPKLGWLRYRNSRDVL
                     GEVRNACVSLSGGKWFVSIQTERKVERPVPKATSAIGIDMGIARFATMSDGTFLAPLN
                     SFRKHEARLRRAQRAMSRKTKFSNNWKKSKARIQRIHARIGNARLDYLHKATTTISEN
                     QAMVCIEDLKVRNMSKSAAGSSGQPGKNVRAKSGLNKAILDQGWYEFGRQLEYKLAWN
                     GGWLIAVPPQHTSRTCPCCGHVSVENRQSQASFACVACGYANHADVVGAINILARGHR
                     VAACGESA"
     misc_feature    complement(281318..281452)
                     /locus_tag="CNE_1c02820"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    complement(280304..281446)
                     /locus_tag="CNE_1c02820"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    complement(280631..281257)
                     /locus_tag="CNE_1c02820"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    complement(280337..280546)
                     /locus_tag="CNE_1c02820"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            281564..281815
                     /locus_tag="CNE_1c02830"
                     /db_xref="GeneID:10916674"
     CDS             281564..281815
                     /locus_tag="CNE_1c02830"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200-family protein"
                     /protein_id="YP_004684131.1"
                     /db_xref="GI:339324438"
                     /db_xref="GeneID:10916674"
                     /translation="MEFDGEDDHVHLLVNYPPKVAVSALVNSLKGVSSRMIRKKNYPS
                     ISKKLWGGALWSPSYFAGSCGGAPIEIIRQYIEQQQTPH"
     misc_feature    <281567..281767
                     /locus_tag="CNE_1c02830"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:216708"
     gene            complement(281860..282693)
                     /locus_tag="CNE_1c02840"
                     /db_xref="GeneID:10916675"
     CDS             complement(281860..282693)
                     /locus_tag="CNE_1c02840"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004684132.1"
                     /db_xref="GI:339324439"
                     /db_xref="GeneID:10916675"
                     /translation="MTTAYFLVLPNVHMLDLGGPLQILSSVAELGLAPLTVRCVGPHS
                     SVTSFQGPALGRVERLPARLEAGDVVIAVGSKLLDTLTTSPAWHDSAAWLRDSFGEGR
                     NGGVQVAAVCTGAFLLGAAGLLDGRLCTTHHAHIKRLRARHPDASVIDNRVFVRDGNV
                     WTSAGVASGIDLALRLVANACGDEAAIAVARDNVVPFRRFGADPQLEPQFSARSHGNP
                     LVHAVQDAIARDLEANVADPRFAQRFAVSVRHLSRLFHEETGLTPKQYQLTRCAASLG
                     L"
     misc_feature    complement(282136..282693)
                     /locus_tag="CNE_1c02840"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(282106..282681)
                     /locus_tag="CNE_1c02840"
                     /note="AraC transcriptional regulators having a Type 1
                     glutamine amidotransferase (GATase1)-like domain; Region:
                     GATase1_AraC_1; cd03137"
                     /db_xref="CDD:153231"
     misc_feature    complement(282358..282360)
                     /locus_tag="CNE_1c02840"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153231"
     misc_feature    complement(<281884..282081)
                     /locus_tag="CNE_1c02840"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(281890..>281973)
                     /locus_tag="CNE_1c02840"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            282858..284108
                     /locus_tag="CNE_1c02850"
                     /db_xref="GeneID:10916676"
     CDS             282858..284108
                     /locus_tag="CNE_1c02850"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS superfamily transporter"
                     /protein_id="YP_004684133.1"
                     /db_xref="GI:339324440"
                     /db_xref="GeneID:10916676"
                     /translation="MHRTRLPAVTVALVAIGFAVMFVSTAVRGLYQVYFVDLATHFGQ
                     GRAQFAWSGSVFMLATGLMSPVVGALSDRVGPLRTAAAGALAAGIALGSAALWPGSLT
                     FFVLMFGLAGAFGLAAMTFVPMGILVDRLFEERRKGLAYAVVTNGTAIGFVVLSPLWI
                     WLQPQAGWITAFGVAGAVFALPVAGALWLASRWEPASAPAPRTAEADVPAWTVVRRDP
                     VFYALAAGFFGCGATMAFIDVHLIAYWQGQGVPRLAMGYAMSTLGGLELASGLVSGAL
                     ALSWDKHRLLATFYALRSASMLLLLVPGLGVLPFAVGFGASYLGTVILTSMFCFERYG
                     SRIKGKVFGLLFLGHQLGAFLTVQLGAWSFDATRSYQDSITALVAVTLCSAACSWFGL
                     RRAGPLPALARGPAHAAVPEAASR"
     misc_feature    282897..284027
                     /locus_tag="CNE_1c02850"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    282903..283922
                     /locus_tag="CNE_1c02850"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(282939..282941,282948..282956,282960..282965,
                     283014..283016,283023..283028,283035..283037,
                     283047..283052,283056..283061,283197..283202,
                     283218..283223,283230..283235,283242..283244,
                     283278..283283,283290..283295,283311..283313,
                     283548..283550,283557..283562,283569..283574,
                     283581..283583,283620..283622,283632..283634,
                     283644..283646,283653..283655,283665..283667,
                     283800..283802,283809..283814,283821..283823,
                     283833..283838,283845..283847,283878..283883,
                     283890..283895,283902..283907,283914..283916)
                     /locus_tag="CNE_1c02850"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            284116..284319
                     /locus_tag="CNE_1c02860"
                     /db_xref="GeneID:10916677"
     CDS             284116..284319
                     /locus_tag="CNE_1c02860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684134.1"
                     /db_xref="GI:339324441"
                     /db_xref="GeneID:10916677"
                     /translation="MLPRLLLARAALAPLGLGAWALPWAPRARIAALAALALAGAALL
                     ALDPLAAALARVDGILSAPGCGG"
     gene            284509..285906
                     /locus_tag="CNE_1c02870"
                     /db_xref="GeneID:10916678"
     CDS             284509..285906
                     /locus_tag="CNE_1c02870"
                     /codon_start=1
                     /transl_table=11
                     /product="CAT family APC transporter"
                     /protein_id="YP_004684135.1"
                     /db_xref="GI:339324442"
                     /db_xref="GeneID:10916678"
                     /translation="MSLFRTKDIDAMLAVARDDGLKKVLGPIDLVMMGIGAIIGTGIF
                     VLTGTGALTAGPALTVSFVIAALSCGFAALCYAEFASAIPVSGSIYTYSYATLGEIVA
                     WMIGWDLLLEYGLATSAVSVGWSGYFQSLMAGFGLKLPAALSAAPGSVPGVKTMLNLP
                     ACLIMLAITWVVSYGVRESTRINNLMVAIKIGVVLLFIAVGVWHVQPANWQPFAPFGF
                     AGIFNAAALVFFAFIGFDAVTSAAEEVRNPRRDLPIGIIGSLAVCTVLYVVVAAIMTG
                     IVPFAKFAGVDHPVSLALQFAGQNWVAGFVDLGAILGMTTVILVMTYGQTRVIFAMSR
                     DGLLPERLSSVHPVHATPYFATWTVGIVFAAIAAFVPLNVLAELINIGTLAAFTLISV
                     AVLVLRKTRPELPRAFRCPGVPVVPLLSIGFCLFLMAHLQALTWIAFLVWLAVGLVIY
                     FGYARRNAVLHNHGG"
     misc_feature    284569..285867
                     /locus_tag="CNE_1c02870"
                     /note="amino acid transporter; Region: 2A0306; TIGR00909"
                     /db_xref="CDD:129987"
     misc_feature    284674..285699
                     /locus_tag="CNE_1c02870"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     misc_feature    285730..285882
                     /locus_tag="CNE_1c02870"
                     /note="C-terminus of AA_permease; Region: AA_permease_C;
                     pfam13906"
                     /db_xref="CDD:258173"
     gene            complement(285913..287319)
                     /locus_tag="CNE_1c02880"
                     /db_xref="GeneID:10916679"
     CDS             complement(285913..287319)
                     /locus_tag="CNE_1c02880"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="MocR family transcriptional regulator"
                     /protein_id="YP_004684136.1"
                     /db_xref="GI:339324443"
                     /db_xref="GeneID:10916679"
                     /translation="MKLILDASTGIPLTDQIVNGVKSWIGNREARPGAKLPSIRQLAA
                     ANGISRFPVIEAYDRLVSQGLLDSRQGSGFYVADSPLAGRSACGWSDPSLAEDLSDHI
                     LEQFNHPSGTLKLAGGFVPETWRDVEGLTQAIRAISRNEIDSVIHYATPMGHPELRRQ
                     VLLRVRQLGIAAELPQVLITTGASQALDLVVRHLLKPGDTVFVEDPGYYNLFGLLRLH
                     GVQLVGVPHTANGPDPDATEALLRQHKPKLFFTNSVLQNPTGSTLAPPVAFRLLELAR
                     RHGFRFVEDDIFSDFQTHFTDRLATLDQLEHVIYIGGFSKTVSASLRVGYLVADKALV
                     KDLVDVKVLTSVAGSHFAEAVTAALLERGGYRKYVERLRLRVREASANAVRQLTGNGW
                     EVFCQPSGGNFLWARPPGIEDSRELVTLGEAYGVTLAPGNYFRPGGETSAWIRINAAY
                     ANEPRAVAFMKAAAGRGS"
     misc_feature    complement(285928..287295)
                     /locus_tag="CNE_1c02880"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(287089..287286)
                     /locus_tag="CNE_1c02880"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(287098..287109,287113..287118,
                     287146..287148,287155..287160,287164..287178,
                     287200..287205,287209..287211,287278..287280,
                     287284..287286))
                     /locus_tag="CNE_1c02880"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(285961..286917)
                     /locus_tag="CNE_1c02880"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(286351..286353,286372..286377,
                     286381..286383,286456..286458,286549..286551,
                     286696..286698,286768..286776))
                     /locus_tag="CNE_1c02880"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(286255..286257,286264..286266,
                     286351..286359,286477..286479,286666..286668,
                     286765..286767))
                     /locus_tag="CNE_1c02880"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(286372..286374)
                     /locus_tag="CNE_1c02880"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            287424..287867
                     /locus_tag="CNE_1c02890"
                     /db_xref="GeneID:10916680"
     CDS             287424..287867
                     /locus_tag="CNE_1c02890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684137.1"
                     /db_xref="GI:339324444"
                     /db_xref="GeneID:10916680"
                     /translation="MRIMEAWRRKAPAPVVIRHPGVGTGPDRRADEECDMRELRTFEL
                     DEPGQPVSWRAGYGQTVCAAAGKLWVTVEGNPTDIWLEPGAELPLPEGYRVWLSGDGA
                     GARFALAQVPAPWSLRRLAAWLRAMRHRVEEHSTDAFGECPRIWA"
     misc_feature    287544..287735
                     /locus_tag="CNE_1c02890"
                     /note="Protein of unknown function (DUF2917); Region:
                     DUF2917; pfam11142"
                     /db_xref="CDD:151586"
     gene            288148..291438
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /db_xref="GeneID:10916681"
     CDS             288148..291438
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /EC_number="5.4.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA mutase Sbm"
                     /protein_id="YP_004684138.1"
                     /db_xref="GI:339324445"
                     /db_xref="GeneID:10916681"
                     /translation="MTDLSDVHDVRRGAPQPKPTVQGRGPVNKVRFVTAASLFDGHDA
                     SINIMRRILQSHGCEVVHLGHNRSVEEVVTAALQEDAQGIAISSYQGGHVEFFKYMVD
                     LLREKGGEHIQVFGGGGGVIVPDEIRELQAYGVARIFSPEDGQRMGLAGMIADMVQRC
                     DIDLSRYAPATLEPVTGGDRRALAQLITALENGKADPALVDAMHAQAKQASIPVLGIT
                     GTGGAGKSSLTDELIRRFRLDQQDALSIAVISIDPSRRKSGGALLGDRIRMNAINHPN
                     IFMRSMATREAGSEISQALPDVIAACKVAGFDLVIVETSGIGQGDAAIVPHVDLSLYV
                     MTPEFGAASQLEKIDMLDFADFVAINKFDRKGAQDAWRDVAKQVQRNREQWHGKAEDM
                     PVYGTQASRFNDDGVTMLYQGLRAALAERGLKLQPGVLPAQAGRISTGQNVIVPPARS
                     RYLAELADTVRGYHRRVMTQSRLARERQQLRESSRMLQAAQGDGAALDALAAERESAL
                     GQVERKLLAMWPQMREAYSGDEYVVRIRDKEIRTGLVTTTLSGTKVRKVVLPRFEDDG
                     EVLKWLMRENVPGSFPYTAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKLVSEGMDAK
                     RLSTAFDSVTLYGEDPHVRPDIYGKVGNSGVSIATLDDLKVLYDGFDLTSPSTSVSMT
                     INGPAPTILAMFMNTAIDQQLDKFRADNQREPTADEEAKIRAWVLQNVRGTVQADILK
                     EDQGQNTCIFSTEFSLKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFT
                     LSNGFTYVEAYLARGMHIDDFAPNLSFFFSNGMDPEYGVLGRVARRIWAVTMRDKYGA
                     NERSQKLKYHIQTSGRSLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPT
                     GESVRRALAIQLIINREWGVAKCENPNQGSFLMEELTDLVEEAVLQEFERIAERGGVL
                     GAMETGYQRGKIQEESLYYEQLKHDGTLPIIGVNTFRNPDGDPTPQKLELARSSEAEK
                     LSQLDRLQAFQQAHAAEAPAMLAQLRQAVIDNQNVFAVLMDAVRVCSLGQITHALFEV
                     GGQYRRNM"
     misc_feature    288238..288609
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="methylmalonyl CoA mutase B12 binding domain. This
                     domain binds to B12 (adenosylcobamide), which initiates
                     the conversion of succinyl CoA and methylmalonyl CoA by
                     forming an adenosyl radical, which then undergoes a
                     rearrangement exchanging a hydrogen atom...; Region:
                     MM_CoA_mut_B12_BD; cd02071"
                     /db_xref="CDD:239022"
     misc_feature    order(288262..288282,288289..288291,288400..288408,
                     288412..288420,288508..288510,288562..288564,
                     288571..288573,288589..288591)
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239022"
     misc_feature    288271..288273
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239022"
     misc_feature    288787..289236
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="The function of this protein family is unkown. The
                     protein sequences are similar to the ArgK protein in E.
                     coli. ArgK protein is a membrane ATPase which is required
                     for transporting arginine, ornithine and lysine into the
                     cells by the arginine and...; Region: ArgK-like; cd03114"
                     /db_xref="CDD:239388"
     misc_feature    288802..288828
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="Walker A; other site"
                     /db_xref="CDD:239388"
     misc_feature    289690..291204
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="Coenzyme B12-dependent-methylmalonyl coenzyme A
                     (CoA) mutase (MCM) family, unknown subfamily 1; composed
                     of uncharacterized bacterial proteins containing a
                     C-terminal MCM domain. MCM catalyzes the isomerization of
                     methylmalonyl-CoA to succinyl-CoA. The...; Region:
                     MM_CoA_mutase_1; cd03678"
                     /db_xref="CDD:239650"
     misc_feature    order(289936..289938,289942..289944,289948..289950,
                     290026..290028,290035..290037,290041..290043,
                     290050..290052,290104..290106,290185..290187,
                     290191..290193,290344..290346,290377..290382,
                     290494..290496,290503..290505,290611..290613,
                     290617..290619,290623..290625,290737..290739,
                     290743..290745,290749..290751,290758..290763,
                     290842..290844,290869..290871,290878..290883)
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="putative active site [active]"
                     /db_xref="CDD:239650"
     misc_feature    order(289936..289938,289942..289944,289948..289950,
                     290026..290028,290185..290187,290191..290193,
                     290344..290346,290380..290382,290491..290496,
                     290611..290613,290617..290619,290623..290625,
                     290737..290739,290743..290745,290749..290751,
                     290842..290844)
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239650"
     misc_feature    order(289948..289950,290035..290037,290041..290043,
                     290050..290052,290104..290106,290377..290382,
                     290386..290388,290503..290505,290758..290763,
                     290869..290874,290878..290883)
                     /gene="sbm"
                     /locus_tag="CNE_1c02900"
                     /note="putative coenzyme B12 binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239650"
     gene            291580..292017
                     /locus_tag="CNE_1c02910"
                     /db_xref="GeneID:10916682"
     CDS             291580..292017
                     /locus_tag="CNE_1c02910"
                     /EC_number="3.6.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="diadenosine tetraphosphate (Ap4A) hydrolase"
                     /protein_id="YP_004684139.1"
                     /db_xref="GI:339324446"
                     /db_xref="GeneID:10916682"
                     /translation="MDTQYNPTNIFAKILRGELPCIKVYEDDDTIAFMDIMPQADGHT
                     LVVPKEAAVNLFDLSEQGAQAAIVATQRVARAVRAAFAPDGISIGQFNGAAAGQTVPH
                     VHFHIVPRYADSALRGHAREMQDPEQLKGHAERIIAALREQGA"
     misc_feature    291601..291909
                     /locus_tag="CNE_1c02910"
                     /note="HINT (histidine triad nucleotide-binding protein)
                     subgroup: Members of this CD belong to the superfamily of
                     histidine triad hydrolases that act on alpha-phosphate of
                     ribonucleotides. This subgroup includes members from all
                     three forms of cellular life; Region: HINT_subgroup;
                     cd01277"
                     /db_xref="CDD:238608"
     misc_feature    order(291883..291885,291889..291891,291895..291903)
                     /locus_tag="CNE_1c02910"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238608"
     misc_feature    291889..291891
                     /locus_tag="CNE_1c02910"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238608"
     gene            292070..292924
                     /gene="paaH1"
                     /locus_tag="CNE_1c02920"
                     /db_xref="GeneID:10916683"
     CDS             292070..292924
                     /gene="paaH1"
                     /locus_tag="CNE_1c02920"
                     /EC_number="1.1.1.35"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="YP_004684140.1"
                     /db_xref="GI:339324447"
                     /db_xref="GeneID:10916683"
                     /translation="MSIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVA
                     TVAGSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILK
                     QIDSIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTS
                     DTTHAAVEALSKQLGKYPITVRNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGM
                     KLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLLREMVAAGYLGRKTG
                     RGVYVYSK"
     misc_feature    292070..292915
                     /gene="paaH1"
                     /locus_tag="CNE_1c02920"
                     /note="3-hydroxybutyryl-CoA dehydrogenase; Validated;
                     Region: PRK05808"
                     /db_xref="CDD:180269"
     misc_feature    292082..292621
                     /gene="paaH1"
                     /locus_tag="CNE_1c02920"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    292625..292915
                     /gene="paaH1"
                     /locus_tag="CNE_1c02920"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            293107..293439
                     /locus_tag="CNE_1c02930"
                     /db_xref="GeneID:10916684"
     CDS             293107..293439
                     /locus_tag="CNE_1c02930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684141.1"
                     /db_xref="GI:339324448"
                     /db_xref="GeneID:10916684"
                     /translation="MAHPILFAALLAGAMSLLAARSAMAHVDVGVQVGAPVYVAPAPV
                     YVAPPPPVVYAPRYHGWHGDRYWDGRRWYGRGEWRGRHHHSHHYRDYDRHYGRGHGHG
                     HGHRGHGH"
     gene            complement(293487..293909)
                     /locus_tag="CNE_1c02940"
                     /db_xref="GeneID:10916685"
     CDS             complement(293487..293909)
                     /locus_tag="CNE_1c02940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684142.1"
                     /db_xref="GI:339324449"
                     /db_xref="GeneID:10916685"
                     /translation="MASAIDAATLQAYRETHYRVLGDLPMILRVDQPSAPLAALHRAL
                     GVASSAFITAANPFSLRCDDDANARRQQALARDVAKMGLRAIEAAGEHPANGWPAEPS
                     FLVPGLSLEDARALGEKYEQNAVVWSGADAVPRLVLLR"
     misc_feature    complement(293535..293756)
                     /locus_tag="CNE_1c02940"
                     /note="Protein of unknown function (DUF3293); Region:
                     DUF3293; pfam11697"
                     /db_xref="CDD:192793"
     gene            complement(293911..294579)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /db_xref="GeneID:10916686"
     CDS             complement(293911..294579)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /codon_start=1
                     /transl_table=11
                     /product="CRP family transcriptional regulator"
                     /protein_id="YP_004684143.1"
                     /db_xref="GI:339324450"
                     /db_xref="GeneID:10916686"
                     /translation="MLNDFVDRCVWAADLSPEQRERVRRAMFVHEYTQGDYVCHKGDM
                     AEHWMGVLEGIVKITTVSPSGKSVTFTGVPTGGWFGEGAVLKSEIRKYDVMALRRSTI
                     AFLPRDTFLWLLDTSLPFTRFLLTQFNERLGQFIAAVEYERLLDIDSRVARAVSSLFN
                     EHLYPGIGTTLEISQEEIGLLAGISRQRANQALKVLEQQGLVRVDYGVIEVLDLEGLR
                     QYGE"
     misc_feature    complement(294205..294543)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(293941..294537)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(order(294304..294312,294337..294342))
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(294220..294228,294238..294246))
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(<294052..294222)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="Regulator of G protein signaling (RGS) domain
                     superfamily; Region: RGS; cl02565"
                     /db_xref="CDD:261346"
     misc_feature    complement(294127..294132)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(293920..>294084)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(order(294025..294027,294052..294060,
                     294064..294066))
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(294007..294027)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(294007..294009,294019..294024))
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(294019..294024)
                     /gene="crp"
                     /locus_tag="CNE_1c02950"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            complement(294652..294816)
                     /locus_tag="CNE_1c02960"
                     /db_xref="GeneID:10916687"
     CDS             complement(294652..294816)
                     /locus_tag="CNE_1c02960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684144.1"
                     /db_xref="GI:339324451"
                     /db_xref="GeneID:10916687"
                     /translation="MSSAGPVVILGLLCPAAIAARHQARCALHQAAGKACALPRRAAG
                     GTRGSVVIVR"
     gene            294856..296814
                     /locus_tag="CNE_1c02970"
                     /db_xref="GeneID:10916688"
     CDS             294856..296814
                     /locus_tag="CNE_1c02970"
                     /EC_number="6.2.1.3"
                     /note="AMP-forming"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain acyl-CoA synthetase"
                     /protein_id="YP_004684145.1"
                     /db_xref="GI:339324452"
                     /db_xref="GeneID:10916688"
                     /translation="MQESSATTFPRWLLAHAQQRPDHPAHREKDLGIWQTYSWAQAAQ
                     QVRALACGLAALGFRRGMNLAVVGDNRPRLYWAMTAAQALGGVPVPLYQDAIANEMVY
                     VLNDAEIEFAIVEDQEQVDKLLEVEAQLAESGRAVRHVIFEDPRGLMDYDHPSLMSYE
                     RLQELGREFDQAHPGFYDEAIAAGQPDDTAIILYTSGTTGKPKGVCHSHYGLIGAARN
                     GCAFDKLSADDDVLSYLPMAWVGDNLFSYAQAMVAGFTVNCPESRETVMTDLREIGPT
                     YYFAPPRIYEGLLTQVMIRMEDAGWIKRKLFHWAMDVAKRCGTDILDGQPVSLADRAR
                     YALGEVLVYGPLRNVLGMSRIRVGYTAGEAIGPDLFRFYRSIGVNLKQFYGQTETCAY
                     VCLQPDGKVKFDSVGPAAPGMEIRIADNGEVLVRGVGLLKSYYKRDDATREAINDEGY
                     FMTGDAGVIDADGHLKIIDRAKDVGKLADGSMFAPKYIENKLKFFPYIKEAVAFGSDR
                     DQVCAFINIDFEAVGNWAERRHLPYAGYVDLAAQPDVLEMIGECVNQVNADLANDPML
                     AGSQVARFLVLHKELDPDDDELTRTRKVRRGFIADKYGVLVEALYAGKSEQFIETRVK
                     FEDGREGSVSATLKLVNAKRLPVAARAA"
     misc_feature    294877..296700
                     /locus_tag="CNE_1c02970"
                     /note="Long-chain acyl-CoA synthetases (AMP-forming)
                     [Lipid metabolism]; Region: FAA1; COG1022"
                     /db_xref="CDD:223953"
     misc_feature    294949..296652
                     /locus_tag="CNE_1c02970"
                     /note="Long-chain fatty acid CoA synthetases and
                     Bubblegum-like very long-chain fatty acid CoA synthetases;
                     Region: VL_LC_FACS_like; cd05907"
                     /db_xref="CDD:213275"
     misc_feature    order(295429..295431,295438..295455,295459..295464)
                     /locus_tag="CNE_1c02970"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    order(295438..295440,295783..295788,295999..296016,
                     296218..296220,296254..296256,296263..296265,
                     296299..296301,296626..296628)
                     /locus_tag="CNE_1c02970"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    order(295438..295440,295558..295563,295696..295698,
                     295702..295707,295714..295716,295783..295788,
                     295999..296016,296218..296220,296254..296256,
                     296263..296265,296290..296301,296557..296559)
                     /locus_tag="CNE_1c02970"
                     /note="putative active site [active]"
                     /db_xref="CDD:213275"
     misc_feature    order(295558..295560,295702..295707,295714..295716,
                     295783..295785,296290..296298,296527..296529,
                     296557..296559)
                     /locus_tag="CNE_1c02970"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     gene            296829..297791
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /db_xref="GeneID:10916689"
     CDS             296829..297791
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport ATP-binding protein LivG"
                     /protein_id="YP_004684146.1"
                     /db_xref="GI:339324453"
                     /db_xref="GeneID:10916689"
                     /translation="MTQVAWQGAGQREWAGTARTDASGTGSGGAIAPAGPMSPAGLAD
                     DSGAHPGTQRAQRTGEQARTGGEVILDLQHISLSFGGVKALTDISFDVCEHEVRAIIG
                     PNGAGKSSMLNVINGVYHPQQGRIVFRGEERKQMHPTAAARQGIARTFQNIALFKGMT
                     VLDNIMTGRNTQFRTGLFAHALWWGPARNEEMRHRQKVEEVIDFLEIQSIRKTPVGRL
                     PYGLQKRVELARALAAEPSMLLLDEPMAGMNVEEKQDMCRFILDVNRQFGTTIVLIEH
                     DMGVVMDISDRVVVLDYGKKIGDGTPDEVKGNPDVIKAYLGTSH"
     misc_feature    297027..297782
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    297036..297761
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    297132..297155
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(297141..297146,297150..297158,297279..297281,
                     297552..297557,297654..297656)
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    297270..297281
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    297480..297509
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    297540..297557
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    297564..297575
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    297642..297662
                     /gene="livG2"
                     /locus_tag="CNE_1c02980"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            297803..298717
                     /gene="livH2"
                     /locus_tag="CNE_1c02990"
                     /db_xref="GeneID:10916690"
     CDS             297803..298717
                     /gene="livH2"
                     /locus_tag="CNE_1c02990"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system permease LivH"
                     /protein_id="YP_004684147.1"
                     /db_xref="GI:339324454"
                     /db_xref="GeneID:10916690"
                     /translation="MTFFFEILIGGLLSGLMYSLVALGFVLIYKASGVFNFAQGAMVY
                     FAALAVVGLMDKGLPMWAAVIGAFVVMILVGMSTERFVLRKLVNQPPITLFMATIGLS
                     FFLEGLGPLLFGNEVRPINLGIVDEPIESILTNFNIVLSKFDIAAAAIAGVLVGSLAL
                     FFQYTKVGRALRAVADDHQAALSLGIPLQNIWAIVWGVAGFVALVAGMLWGSRNGVQF
                     ALTLTALKALPVLILGGFTSVPGAIVGGLIIGASEKLAEIYIPPVFQSMFGGNFGGIE
                     GWFPYVFALLFLLVRPEGLFGEKHIDRV"
     misc_feature    297833..298690
                     /gene="livH2"
                     /locus_tag="CNE_1c02990"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    298337..298393
                     /gene="livH2"
                     /locus_tag="CNE_1c02990"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            298742..299818
                     /gene="livM2"
                     /locus_tag="CNE_1c03000"
                     /db_xref="GeneID:10916691"
     CDS             298742..299818
                     /gene="livM2"
                     /locus_tag="CNE_1c03000"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system permease LivM"
                     /protein_id="YP_004684148.1"
                     /db_xref="GI:339324455"
                     /db_xref="GeneID:10916691"
                     /translation="MFYREAGQFKTSYVADSQIFPIRQDRIGFAVLMAVAFVAIPFVG
                     SEYWFSAILIPFLIFSLAALGLNILTGYAGQLSLGTAAFMAVGAYAAYNFQLRIEGIP
                     VLLSFLLAGLSAALVGVAFGLPSLRIKGFYLAVATLAAQFFVVWALTKFPWFSNNSSS
                     GVITAQRLDLFGVAIDTPLKKYLFVLAIVTVLALAAKNLVRSATGRAWMSVRDMDVAA
                     EVIGIPLMRTKLLAFAVSSFYCGVAGALYAFCYLGSVEPDGFSLDLSFRVLFMIIIGG
                     VGSILGSFLGAAFILLLPIFLDNVLPPLAALLHLPFTNATVSHIQLMVFGGLIIFFLI
                     VEPHGLARLWQIAKEKLRLWPFPH"
     misc_feature    298907..299764
                     /gene="livM2"
                     /locus_tag="CNE_1c03000"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    299387..299443
                     /gene="livM2"
                     /locus_tag="CNE_1c03000"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            299910..301247
                     /locus_tag="CNE_1c03010"
                     /db_xref="GeneID:10916692"
     CDS             299910..301247
                     /locus_tag="CNE_1c03010"
                     /codon_start=1
                     /transl_table=11
                     /product="HAAT family ABC transporter permease"
                     /protein_id="YP_004684149.1"
                     /db_xref="GI:339324456"
                     /db_xref="GeneID:10916692"
                     /translation="MTNLIRNVQRAALVVSAAAALLAPAAPAMAQSNEQFVALPSYRV
                     GPYGANGQSWYGGFIDYLNYVNLKEGGVNGVKLSWEECETEYNNAKGVECYERLKSKN
                     ATTKGTAYHAMSTGISYALVDKTAADKVPLVMMGYGRTDAVDGSVFPYAFPLVTTYQM
                     QVSAIVKYLASKNGGSLAGKKIVYLYHDSAYGKEPIVALQAEAKLGKFNLVEIPVAHP
                     GNEQGAQWLKIRQENPDYVIFWGWGVMNQTALKAAQKVGFARDKIIGSWWAGSEEDTV
                     PAGDASKGYMSATWNVAGRNVPLIADIDKVVYGAGKGNMQDKNKVGSVLYNRGVSAAV
                     VTVEAVRVAQAKFGKGKPMTGEQMRWAFENLNLTNARLQQLGATGLLPEIKTSCDNHE
                     GSGKVKIQQWDGTKWVVVSDWIEGNKSLIHPLFKATAAQYAKEKGITPACSKS"
     misc_feature    300015..301094
                     /locus_tag="CNE_1c03010"
                     /note="Type I periplasmic ligand-binding domain of
                     uncharacterized ABC (ATPase Binding Cassette)-type active
                     transport systems that are predicted to be involved in
                     transport of amino acids, peptides, or inorganic ions;
                     Region: PBP1_ABC_ligand_binding_like_1; cd06334"
                     /db_xref="CDD:107329"
     misc_feature    order(300246..300254,300315..300323,300480..300482,
                     300633..300635,300708..300710)
                     /locus_tag="CNE_1c03010"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107329"
     gene            301441..302259
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /db_xref="GeneID:10916693"
     CDS             301441..302259
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid
                     transport system ATP-binding protein LivF"
                     /protein_id="YP_004684150.1"
                     /db_xref="GI:339324457"
                     /db_xref="GeneID:10916693"
                     /translation="MSLLSVNNIEVIYDHVILVLKGVSLEVPEGKIVALLGANGAGKT
                     TTLKAISNLLQAERGDVTKGSIEYRGDRVDQLTPNDLVRRGVIQVMEGRHCFAHLTIE
                     ENLLTGAYTRGLSRGQTRDELEKIYEYFPRLKTRRKSQAGYTSGGEQQMCAIGRAMMA
                     KPAMILLDEPSMGLAPQIVEEIFEIVRGLNSRENVSFLLAEQNTMVALRYADYGYILE
                     NGRVVMDGDAESLRTNEDVKEFYLGVAANDADDGAGRKSFRDVKSYRRRKRWLA"
     misc_feature    301441..302166
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    301450..302142
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    301549..301572
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(301558..301563,301567..301575,301711..301713,
                     301942..301947,302044..302046)
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    301702..301713
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    301870..301899
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    301930..301947
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    301954..301965
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    302032..302052
                     /gene="livF2"
                     /locus_tag="CNE_1c03020"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            302352..303602
                     /locus_tag="CNE_1c03030"
                     /db_xref="GeneID:10916694"
     CDS             302352..303602
                     /locus_tag="CNE_1c03030"
                     /EC_number="6.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F390 synthetase"
                     /protein_id="YP_004684151.1"
                     /db_xref="GI:339324458"
                     /db_xref="GeneID:10916694"
                     /translation="MPEHFDSLETRAPEVREQALLAALARQVAHARDNAPYFAEMLSG
                     VDPRLLTSRAALAALPVTRKSDLTARQRLLPPLGGLNATPLGKLRHVFQSPGPIHEPD
                     GHDADWWRVARAMHAAGFRAGELVYNTFSYHFTPAGMMMETGAHRLGCCVFPAGVGQT
                     DSQVQALASLQPTAYAGTPSFLKLLLERGDELGTPCTSLAKALVSGEALPPSLRAWFQ
                     ARGVRVQQMYGTADVGLIAYETEGGDGWVVDEGVLVEIVEPGGSRPMPEGETGEVVVT
                     VLGNGDYPLIRFGTGDLSAIVAESSQRPSPCGRTNIRLKGWLGRADQATKVKGMFVHP
                     GQVADVLRRHPEIRVARLVVTGDPGADVMTLRCEATREDGDLQRAVAESLREVMRLRG
                     EVAFVAAGSLPQDGKLIEDARSYD"
     misc_feature    302367..303572
                     /locus_tag="CNE_1c03030"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    302370..303575
                     /locus_tag="CNE_1c03030"
                     /note="Coenzyme F390 synthetase [Coenzyme metabolism];
                     Region: PaaK; COG1541"
                     /db_xref="CDD:224458"
     misc_feature    order(302622..302624,302631..302648,302652..302654)
                     /locus_tag="CNE_1c03030"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(302631..302633,302967..302969,303027..303044,
                     303225..303227,303300..303302,303309..303311,
                     303342..303344,303570..303572)
                     /locus_tag="CNE_1c03030"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(302631..302633,302739..302744,302883..302885,
                     302889..302894,302898..302900,302967..302969,
                     303027..303044,303225..303227,303300..303302,
                     303309..303311,303333..303344,303513..303515)
                     /locus_tag="CNE_1c03030"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(302739..302741,302889..302894,302898..302900,
                     302967..302969,303333..303341,303492..303494,
                     303513..303515)
                     /locus_tag="CNE_1c03030"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(303734..304102)
                     /locus_tag="CNE_1c03040"
                     /db_xref="GeneID:10916695"
     CDS             complement(303734..304102)
                     /locus_tag="CNE_1c03040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684152.1"
                     /db_xref="GI:339324459"
                     /db_xref="GeneID:10916695"
                     /translation="MWVVLGAAFLLLGVIGIFLPVLPTTPFVLLAAACFARGSQRFHE
                     WLLGHPRFGPLVSDWQRYRSIPLRAKCLALSMMWASMGTTAWLLRARPIASAALLACA
                     VGVSVWMVRLPTRPVEGGKS"
     misc_feature    complement(303758..304102)
                     /locus_tag="CNE_1c03040"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2832"
                     /db_xref="CDD:225388"
     gene            complement(304235..305212)
                     /gene="nppD"
                     /locus_tag="CNE_1c03050"
                     /db_xref="GeneID:10916696"
     CDS             complement(304235..305212)
                     /gene="nppD"
                     /locus_tag="CNE_1c03050"
                     /EC_number="1.13.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="YP_004684153.1"
                     /db_xref="GI:339324460"
                     /db_xref="GeneID:10916696"
                     /translation="MPAAKQLPQALQNLALPVIASPMFIVSYPELVLAQCKAGIVGSF
                     PALNARPAELLDEWLTQIEGELATFKAANPGAQVGPVAVNQIVHTSNARLEHDVKVCV
                     DHKVPIFITSLRAPVKEMIDAVHSYGGIVLHDVISLRHAEKAIEAGVDGLILVAAGAG
                     GHAGMLSPFALVGEVRKIFDGPIALSGSIATGEAVLAAQAMGADFAYVGTRFIASQEA
                     HAAETYKQSITSSAAADIIYTNLFTGVHGNYIRESISNVGLDPDNLPVADKSKMDFSS
                     GASKAKAWKDVWGAGQGVGQIHDIPTAGEIVVRMKAEYDAAKARLGIAH"
     misc_feature    complement(304244..305194)
                     /gene="nppD"
                     /locus_tag="CNE_1c03050"
                     /note="Dioxygenases related to 2-nitropropane dioxygenase
                     [General function prediction only]; Region: COG2070"
                     /db_xref="CDD:224981"
     misc_feature    complement(304463..305173)
                     /gene="nppD"
                     /locus_tag="CNE_1c03050"
                     /note="2-Nitropropane dioxygenase (NPD), one of the
                     nitroalkane oxidizing enzyme families, catalyzes oxidative
                     denitrification of nitroalkanes to their corresponding
                     carbonyl compounds and nitrites. NDP is a member of the
                     NAD(P)H-dependent flavin oxidoreductase...; Region:
                     NPD_like; cd04730"
                     /db_xref="CDD:240081"
     misc_feature    complement(order(304583..304594,304649..304657,
                     304733..304738,304748..304750,304811..304813,
                     304877..304879,304955..304957,305144..305149))
                     /gene="nppD"
                     /locus_tag="CNE_1c03050"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240081"
     gene            complement(305338..306774)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /db_xref="GeneID:10916697"
     CDS             complement(305338..306774)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein CreC"
                     /protein_id="YP_004684154.1"
                     /db_xref="GI:339324461"
                     /db_xref="GeneID:10916697"
                     /translation="MHIGLRIFFGFFLIVGLATVLTLRVFVQEVKPGVRQAMEDTLID
                     TAHVLAALAADDMKAGRIADGEFARHMAALRDLPVDADVSGLHKDSIGYRIYVTDARG
                     IVRFDSTGTDVGRDYSRWNDVYLTLRGKYGARSTRTDPDDEASTVMHVAAPIRDGDGE
                     RIIGVLTVAKPNAAMAPFIERSQRKILLYGGLLIGAACVIGLACTLWLAHGLSRLRGY
                     ARAVAAGERAEMPLRGGSELAELGRAVQGMRERLEDKQYVEHYIHTLTHEMKSPLAAI
                     GGAAELLQEEMPAADRQRFVANIRAQSGRLETMIRKLLALADVEQRQRLEVREPVRLA
                     PLLAQLGSELEPRARQRGVTLRLAADASPDLVAGDPFLLRQAIANLLENAIDFAPPDS
                     EVTVRLERRGGALAIAVADQGPGIPDYALPRVFERFYSLPRPHGADKSTGLGLCFARE
                     VATLHHGDVTLANRPGGGALAELTLPAA"
     misc_feature    complement(305341..306774)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="sensory histidine kinase CreC; Provisional; Region:
                     PRK11100"
                     /db_xref="CDD:236846"
     misc_feature    complement(306013..306153)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(306019..306024,306031..306036,
                     306040..306045,306052..306057,306061..306066,
                     306109..306111,306115..306120,306127..306132,
                     306136..306141,306148..306153))
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(305824..305991)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(305836..305838,305848..305850,
                     305857..305859,305869..305871,305878..305880,
                     305890..305892,305938..305940,305947..305949,
                     305959..305961,305968..305970,305980..305982))
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(305974..305976)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(305350..305658)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(305362..305364,305368..305373,
                     305386..305388,305392..305394,305440..305451,
                     305527..305532,305536..305538,305542..305544,
                     305548..305550,305617..305619,305626..305628,
                     305638..305640))
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(305626..305628)
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(305443..305445,305449..305451,
                     305530..305532,305536..305538))
                     /gene="creC"
                     /locus_tag="CNE_1c03060"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(306784..307476)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /db_xref="GeneID:10916698"
     CDS             complement(306784..307476)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein CreB"
                     /protein_id="YP_004684155.1"
                     /db_xref="GI:339324462"
                     /db_xref="GeneID:10916698"
                     /translation="MPGMEQPRILVVEDEQAIADTILYALRTDGMLAEHCTLGGAALE
                     RMRAGAADLVILDVGLPDLSGFEVCRTLRTFSNAPVVFLTARHEEIDRIVGLEIGADD
                     YVVKPFSPRELAARVRAILRRARGGSTAKGDEVAGFTHDKDGARLAYRGRWLELTRYE
                     YLLLAWLVAHPGRIYSRAQLMEGVWEDALDTSDRTVDTHIKTLRAKLREASPDGADRI
                     RTHRGMGYSLEP"
     misc_feature    complement(306787..307467)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="DNA-binding response regulator CreB; Provisional;
                     Region: PRK11083"
                     /db_xref="CDD:236838"
     misc_feature    complement(307114..307449)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(307156..307161,307168..307170,
                     307225..307227,307282..307284,307306..307308,
                     307435..307440))
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(307306..307308)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(307282..307290,307294..307299))
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(307153..307161)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(306793..307077)
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(306802..306804,306817..306819,
                     306856..306861,306883..306885,306892..306894,
                     306946..306951,307006..307008))
                     /gene="creB"
                     /locus_tag="CNE_1c03070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(307486..308613)
                     /locus_tag="CNE_1c03080"
                     /db_xref="GeneID:10916699"
     CDS             complement(307486..308613)
                     /locus_tag="CNE_1c03080"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_004684156.1"
                     /db_xref="GI:339324463"
                     /db_xref="GeneID:10916699"
                     /translation="MPSFDYDIVIAGASFAGAACALAAARAGLRVLVLERKTDPGDKL
                     HTTGILVKEAIEQTWLGRAPADCVHRVEQVRLYSPKLRSIDLSAPGYYFHTTDTPRLM
                     RWLAAELVCHRVELRLGQAFVGAVPRHGGWHVTGVGNTRYLVGADGAKSRVAQCAGLG
                     RVHSFLYGVEYEFPGLALPEPGALHCFITRRFAPGYIGWIAQNPTGVQAGLALRYLPR
                     HGRAPDLDGLLAHVRERAGLPQLAQPAATRAGLIPCGGPVFPLARDGVILTGDAAGIV
                     SPVTAGGIHYAFAHGESVGQAVAAHLLRGGPAPEAVATASAPRFRAKRALRWMFDRFQ
                     CDWPFDLMMYSPPLRWAAEQIYFHKRQGDEPAPPARTAASA"
     misc_feature    complement(307753..308598)
                     /locus_tag="CNE_1c03080"
                     /note="geranylgeranyl reductase family; Region: GG-red-SF;
                     TIGR02032"
                     /db_xref="CDD:233693"
     misc_feature    complement(307630..>308388)
                     /locus_tag="CNE_1c03080"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(308852..310189)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /db_xref="GeneID:10916700"
     CDS             complement(308852..310189)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transport transcriptional
                     regulator"
                     /protein_id="YP_004684157.1"
                     /db_xref="GI:339324464"
                     /db_xref="GeneID:10916700"
                     /translation="MSIAMQDGLRVLFVEDEPLVRQATAQSLELAGFAVLALPSAEAA
                     IPHLHGAFAGVVVTDVRLPGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREG
                     AYDFIEKPFGADRLTDTVRRALERRALELENQALRRELAGPAAGTRIIGRSPAIGQVR
                     ALVANVAPTDVPVMINGETGTGKELVARSLHALSGRAEGPFIALNCGAVPEAIFESEM
                     FGHEAGAFTGAGKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGSLERLGSN
                     ASVKIDVRIVAAAKGDMDALVAQGSFREDLYYRLNVVTIALPPLRERREDIVPLFEHF
                     SLVSAVRYQRPAPILSEAQRQALAQRPWPGNVRELRNAADRMVLGVPEGGQAGAQAAG
                     PDEAAPLRERMEHFERAVIADALARTGGAVSQAADLLQVGKATLYDKIKRYGL"
     misc_feature    complement(308855..310177)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(309818..310156)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(309860..309865,309872..309874,
                     309929..309931,309989..309991,310013..310015,
                     310142..310147))
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(310013..310015)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(309989..309997,310001..310006))
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(309857..309865)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(309251..309742)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(309638..309661)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(309320..309322,309446..309448,
                     309635..309658))
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(309443..309460)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(309263..309265)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(308861..308986)
                     /gene="dctD"
                     /locus_tag="CNE_1c03090"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(310186..312192)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /db_xref="GeneID:10916701"
     CDS             complement(310186..312192)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transport sensor protein DctB"
                     /protein_id="YP_004684158.1"
                     /db_xref="GI:339324465"
                     /db_xref="GeneID:10916701"
                     /translation="MPHSDDFLAVHDPAAPSAAHPAHAPDSGNGRWWGFAVALAAGLL
                     LLCALTWLVSVQRGLATLQQSTATRADRYAATLESTLDRYEFLPALVALHPFVRGLLD
                     SPNDPQRVAAANQYLAEVNRRAHASATYVIAANGIALAASNHGQPGSFVGTDYRFRPY
                     FQAAAGGKMGRFYAIGITSEEPGYYLAQPVESGGKVIGVTVVKLNLEWFQRAGSGAEP
                     LMVSDDHGVIFLSSVSAWQYRTLRPLPPALQAEMENTRQYHGRAVTPLPLEPLTSPVT
                     RWLADTTLTDGARLVRVRDESPATRTTFAPDGAERADRYLELGRTVGPAGWTMQVMAP
                     LEPVLANARNATVAAALAYACICLLLVNWRQRRQRARDMQYSRRLLEAAYDQLERRVE
                     ARTVDLMAINEKLEDEVAERTRAESELRAAQDELVQASKLAALGQMAAGITHELNQPL
                     AALRTFSDNTRVLLERGQLAAAEGNLTAIADLTERMGKITSQLKLFAGKARPVRRPVA
                     LRAAVDHVLALLAPRLGAVTVSVTGLDALPGLAVRADELKLEQVLLNLLGNALDAIAA
                     AAPARGQIDLDVQAEDHAVTVVVRDNGTGIAPEALPRLFEPFFTTKETGQGLGLGLAI
                     SSSIVREFGGQLSVANVPGGGAQFTLVLARAPAIDPAPSVSASQ"
     misc_feature    complement(310225..312036)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="Signal transduction histidine kinase regulating
                     C4-dicarboxylate transport system [Signal transduction
                     mechanisms]; Region: COG4191"
                     /db_xref="CDD:226654"
     misc_feature    complement(310960..>311097)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="basic leucine zipper DNA-binding and
                     multimerization region of GCN4 and related proteins;
                     Region: B_zip1; cd12193"
                     /db_xref="CDD:213400"
     misc_feature    complement(310702..310899)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(310714..310716,310726..310728,
                     310735..310737,310747..310749,310756..310758,
                     310768..310770,310825..310827,310834..310836,
                     310846..310848,310855..310857,310867..310869,
                     310879..310881))
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(310861..310863)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(310237..310548)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(310249..310251,310255..310260,
                     310273..310275,310279..310281,310327..310338,
                     310405..310410,310414..310416,310420..310422,
                     310426..310428,310507..310509,310516..310518,
                     310528..310530))
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(310516..310518)
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(310330..310332,310336..310338,
                     310408..310410,310414..310416))
                     /gene="dctB"
                     /locus_tag="CNE_1c03100"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(312263..313558)
                     /gene="dctA1"
                     /locus_tag="CNE_1c03110"
                     /db_xref="GeneID:10916702"
     CDS             complement(312263..313558)
                     /gene="dctA1"
                     /locus_tag="CNE_1c03110"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transport protein DctA"
                     /protein_id="YP_004684159.1"
                     /db_xref="GI:339324466"
                     /db_xref="GeneID:10916702"
                     /translation="MRKPFYKILYVQVLFAIFVGILLGHYWPDTGVAMKPLGDGFIKL
                     IKMIIGPIIFCTVVTGIAGMSDMKKVGRVGGKALLYFEVVSTFALLIGLGAAHLLKPG
                     VGFNIDPATLDTKAIAQYVSKAHGQSTVEFLMHIIPDTVFSAFANGDILQILLVSLFF
                     GAALAVLGERARIVVQLIEQVSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVP
                     LLKLIGTFYFTAIVFVVFVLGTVARLTGFSILRFISYIKEELLIVLGTSSSEAALPHM
                     MEKLEKLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVIFIAQATGIELTLMQQLTILT
                     VAMITSKGASGVTGSGFITLAATLAVVPTIPVAGMVLILGIDRFMSECRALTNIIGNG
                     VATVVVSAWERELDRKKLNSVLQHGGRDAEVLADAGQNV"
     misc_feature    complement(312275..313558)
                     /gene="dctA1"
                     /locus_tag="CNE_1c03110"
                     /note="C4-dicarboxylate transporter DctA; Reviewed;
                     Region: PRK01663"
                     /db_xref="CDD:234968"
     gene            313950..314270
                     /locus_tag="CNE_1c03120"
                     /db_xref="GeneID:10916703"
     CDS             313950..314270
                     /locus_tag="CNE_1c03120"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_004684160.1"
                     /db_xref="GI:339324467"
                     /db_xref="GeneID:10916703"
                     /translation="MSSYYQHHVFFCLNQREAGENCCANHNAQAMQEYAKKRCKELGI
                     AGGEGRVRINKAGCLNRCELGPVLVVYPEAIWYTFVDEHDIDEIIDSHLMKGKPVERL
                     MVDR"
     misc_feature    313968..314189
                     /locus_tag="CNE_1c03120"
                     /note="Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd)
                     family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like
                     Fds) and proteins containing domains similar to TRX-like
                     Fd including formate dehydrogenases, NAD-reducing
                     hydrogenases and the subunit E of NADH:...; Region:
                     TRX_Fd_family; cd02980"
                     /db_xref="CDD:239278"
     misc_feature    order(313971..313973,313977..313979,314112..314120)
                     /locus_tag="CNE_1c03120"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239278"
     misc_feature    order(313983..313985,314016..314018,314121..314123,
                     314133..314135)
                     /locus_tag="CNE_1c03120"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239278"
     gene            314419..315060
                     /locus_tag="CNE_1c03130"
                     /db_xref="GeneID:10916704"
     CDS             314419..315060
                     /locus_tag="CNE_1c03130"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase alpha/beta superfamily protein"
                     /protein_id="YP_004684161.1"
                     /db_xref="GI:339324468"
                     /db_xref="GeneID:10916704"
                     /translation="MNAHTQVLSIAGPAGAIDLSVDLPQGEPRGLALVAHPHPLFGGT
                     KDNKVAQTLARSFVQLGYATVRPNFRGVGGSAGEHDNGIAEQDDLLAVVAWMRQQTAW
                     SAQAATLPLAMGGFSFGSFVTTHVARRLAEAGTPAQRLVLVGTAASRWQVAEVPADTI
                     VIHGEQDDTVPLASVFDWARPQELPVIVIPGADHFFHRKLHLIKQLVVNAWDR"
     misc_feature    314422..315051
                     /locus_tag="CNE_1c03130"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2945"
                     /db_xref="CDD:225496"
     misc_feature    314587..315006
                     /locus_tag="CNE_1c03130"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:215859"
     gene            315123..316322
                     /gene="dacC"
                     /locus_tag="CNE_1c03140"
                     /db_xref="GeneID:10916705"
     CDS             315123..316322
                     /gene="dacC"
                     /locus_tag="CNE_1c03140"
                     /EC_number="3.4.16.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="YP_004684162.1"
                     /db_xref="GI:339324469"
                     /db_xref="GeneID:10916705"
                     /translation="MLNRATTRLSSAFAPAAIAAAVVLAAAPAAVLAQGVPMPQVAAK
                     SWMLYDVTSGQALASQNADARIEPASLTKLMTAYLAFEALKEKRLTLDQSVVPTSLVL
                     KVKSDESRMFIEPNKPVTVQDLLLGLIVQSGNDAALALAEAVGGSEEGFVAMMNREAQ
                     RMGMKNTHFTNTDGIPDPNHYTTAVDLATLTTRLIKDFPEYYAMYSQKEFTYNKIRQP
                     NRNRLLYIDPTVDGVKTGHTKSAGYCLISSAKRPLANVPDGSRRLISIVIGTTTEQVR
                     TQESLKILNYGFQFFDTLRLYDKGQVLATPDIYKGKSGTVKIGVQNETFVTVPKGTGG
                     RLKPVLERQELLIAPISAGQQVGMVKLMDGTNKVAEFPVVALEEVPEAGFFGRLWDTI
                     RLWFKRK"
     misc_feature    315237..316319
                     /gene="dacC"
                     /locus_tag="CNE_1c03140"
                     /note="D-alanyl-D-alanine carboxypeptidase [Cell envelope
                     biogenesis, outer membrane]; Region: DacC; COG1686"
                     /db_xref="CDD:224600"
     misc_feature    315237..315938
                     /gene="dacC"
                     /locus_tag="CNE_1c03140"
                     /note="D-alanyl-D-alanine carboxypeptidase; Region:
                     Peptidase_S11; pfam00768"
                     /db_xref="CDD:250118"
     misc_feature    315993..316265
                     /gene="dacC"
                     /locus_tag="CNE_1c03140"
                     /note="Penicillin-binding protein 5, C-terminal domain;
                     Region: PBP5_C; smart00936"
                     /db_xref="CDD:198004"
     gene            316384..316692
                     /locus_tag="CNE_1c03150"
                     /db_xref="GeneID:10916706"
     CDS             316384..316692
                     /locus_tag="CNE_1c03150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684163.1"
                     /db_xref="GI:339324470"
                     /db_xref="GeneID:10916706"
                     /translation="MTTDNQGSGNKPGDIPPEQSLIEYPSHFPIKVMGAMQDGFAEAI
                     VELVQGFDPDFHAGKMEMRPSSGGNYLGLTVTVWVTSREQLDDLYRALTSHPMVKVVL
                     "
     misc_feature    316417..316689
                     /locus_tag="CNE_1c03150"
                     /note="hypothetical protein; Provisional; Region:
                     PRK02047"
                     /db_xref="CDD:179360"
     gene            316901..318097
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /db_xref="GeneID:10916707"
     CDS             316901..318097
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /EC_number="2.1.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylserotonin O-methyltransferase AsmT"
                     /protein_id="YP_004684164.1"
                     /db_xref="GI:339324471"
                     /db_xref="GeneID:10916707"
                     /translation="MNTITLKPGKEKSLLRRHPWIYATGIATTEGRCEPGATVIVRAA
                     DGRFLAKAAYSPESQIRARAWTFDENEPVDHALFKRRVAAAIAYRRQWVKDSDAVRLI
                     FGESDRLPGLIVDYYGNGEKGQLVCQFNSAGVEHWKTAIVQALVKETGCPNVYERSDA
                     AVRQREGLELVTGVLAGAEPDPALSVTEHGVRYYVDVRNGHKTGFYVDQRDNRKLVGD
                     LAVGREVLNCFCYTGGFSLAALRGGATSVTSIDSSGEALKIAAGNVTLNGFEPERATW
                     LDADVFKTLREFRAEGRQFDLIVLDPPKFAPSAQHIDRAARAYKEINLVGMQLLRPGG
                     LLFTYSCSGAISMELFQKIVAGAVTDARADARILRRLSAGTDHPMLAAFPEGEYLKGL
                     LLEKVA"
     misc_feature    316904..317098
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="Putative RNA-binding Domain in PseudoUridine
                     synthase and Archaeosine transglycosylase; Region: PUA;
                     smart00359"
                     /db_xref="CDD:214635"
     misc_feature    316910..318091
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="Predicted SAM-dependent methyltransferases [General
                     function prediction only]; Region: COG1092"
                     /db_xref="CDD:224017"
     misc_feature    317126..317431
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="Middle domain of the SAM-dependent
                     methyltransferase RlmI and related proteins; Region:
                     RlmI_M_like; cd11572"
                     /db_xref="CDD:211413"
     misc_feature    order(317198..317200,317282..317284)
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:211413"
     misc_feature    317573..317914
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(317582..317602,317651..317656,317735..317743,
                     317801..317803)
                     /gene="asmT"
                     /locus_tag="CNE_1c03160"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            318416..318835
                     /locus_tag="CNE_1c03170"
                     /db_xref="GeneID:10916708"
     CDS             318416..318835
                     /locus_tag="CNE_1c03170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684165.1"
                     /db_xref="GI:339324472"
                     /db_xref="GeneID:10916708"
                     /translation="MVPAKLRYYAGLALTEYGRAAEPRPGRLSLVLREPMGVAGIIAP
                     WNSPVVLMVRSLAPALAAGCTAVIKMPGQTALTNALVARIMARALEAGTVWINNWASV
                     YDEFEEGGYKQSGQGRLNGVAAIDDFVEYKHIALAPG"
     misc_feature    318416..>318697
                     /locus_tag="CNE_1c03170"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     misc_feature    <318668..318823
                     /locus_tag="CNE_1c03170"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     gene            complement(318845..321013)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /db_xref="GeneID:10916709"
     CDS             complement(318845..321013)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /EC_number="3.6.4.12"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="YP_004684166.1"
                     /db_xref="GI:339324473"
                     /db_xref="GeneID:10916709"
                     /translation="MRDIPVWIYSWRQPFLSLPRAPPVTLDLAPAADLAAPDADDVPA
                     YLSRLNPEQRAAVEHGSDAPLLIIAGAGSGKTNTLAHRVAHLVLAGADPRRILLLTFS
                     RRAAAEMGRRVERIVDQALGTQTGAGRAALQWSGTFHAIGARLLREYAETLGLSPAFT
                     ISDRGDAADLMHVVRHDLGLSETASRFPKKETCLSIYSRVVNTQALLEDVLRQQFPRY
                     AMWADALRTLFAGYVEAKQKQHVLDYDDLLLYWAQAMAEPTIAQDMGARFDHVLVDEY
                     QDTNALQASILLAMRPDGRGLTVVGDDAQSIYAFRGATVRNILDFPAQFTPAAQQVTL
                     SQNYRSTQPILQAANAVIGLAAERYTKDLWSERASAEKPGVIVVNDEADQARYVVEQV
                     LARREAGLTLMAQAVLFRAADHSAQVEIELARRNIPFVKFGGLKFLESTHVKDVLAVV
                     RWLENPRDRMAGFRTLQLLPGIGPKTAARVLDAMALATEPLFSLEEFEPPPAAAPAWA
                     DLLALARALMAPTSPWPSEFEQVLAWYAPHLERLHDDAAARQADLQQLERIAATYGAR
                     ERFLTELTLDPPSASSDESGVPSRDEDYLILSTIHSAKGQEWKAVYVLNAVDGCMPSD
                     LATGTTEEIEEERRLLYVAMTRAKDHLDIVVPQRFYVHQQVGFGDRHVYASRTRFLPN
                     RVMPNFHSRAWPPPPMPGEAPARPALAPVDLASRMRNMWR"
     misc_feature    complement(318968..320875)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(320654..320854)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(319565..319645)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /note="Helix-hairpin-helix motif; Region: HHH; pfam00633"
                     /db_xref="CDD:250016"
     misc_feature    complement(319052..319402)
                     /gene="pcrA"
                     /locus_tag="CNE_1c03180"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(321095..321631)
                     /gene="bcp"
                     /locus_tag="CNE_1c03190"
                     /db_xref="GeneID:10916710"
     CDS             complement(321095..321631)
                     /gene="bcp"
                     /locus_tag="CNE_1c03190"
                     /EC_number="1.11.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="YP_004684167.1"
                     /db_xref="GI:339324474"
                     /db_xref="GeneID:10916710"
                     /translation="MTTAAPAIKTSRKPWPIVVAVVVLALLGWFGYRALSPANTAPAA
                     TFTLLSGEKVSTADLKGKVYMINFWATSCATCVKEMPDMVRTYEQFKGKGLEFVAVAM
                     NYDPPMYVMNYAKTRGLPFKVAMDSDGAAAKAFGNVQLTPTTFVVDKDGRILKRYVGE
                     PEWDALHKLLDGALAKSA"
     misc_feature    complement(321155..321499)
                     /gene="bcp"
                     /locus_tag="CNE_1c03190"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    complement(order(321404..321406,321413..321415))
                     /gene="bcp"
                     /locus_tag="CNE_1c03190"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            complement(321744..322250)
                     /locus_tag="CNE_1c03200"
                     /db_xref="GeneID:10916711"
     CDS             complement(321744..322250)
                     /locus_tag="CNE_1c03200"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-like protein"
                     /protein_id="YP_004684168.1"
                     /db_xref="GI:339324475"
                     /db_xref="GeneID:10916711"
                     /translation="MPAARIARHVFATTSLRWVAASALLAAATSMPAAASPAHLPPAT
                     DLAAHGTEAARRGEPLVVLVSMPGCSYCDAVRRNYLGPQAAAGEIAVRELDMTSDTPL
                     RDADGSLTTARAWARAHQVQVAPTVLFLDRQGRAAAGPLRGMQPDFYGAYLEQALDQA
                     RAAIATRR"
     misc_feature    complement(321762..322118)
                     /locus_tag="CNE_1c03200"
                     /note="SoxW family; SoxW is a bacterial periplasmic TRX,
                     containing a redox active CXXC motif, encoded by a genetic
                     locus (sox operon) involved in thiosulfate oxidation.
                     Sulfur bacteria oxidize sulfur compounds to provide
                     reducing equivalents for carbon dioxide...; Region: SoxW;
                     cd02951"
                     /db_xref="CDD:239249"
     misc_feature    complement(order(322035..322037,322044..322046))
                     /locus_tag="CNE_1c03200"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239249"
     gene            322342..322998
                     /locus_tag="CNE_1c03210"
                     /db_xref="GeneID:10916712"
     CDS             322342..322998
                     /locus_tag="CNE_1c03210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684169.1"
                     /db_xref="GI:339324476"
                     /db_xref="GeneID:10916712"
                     /translation="MAPASAARSLCAPSPHGFPMRLVPPPPSFPAAVRRPLLCCAAVL
                     AFALCACSPRYDWRTIQSGEGAYAALYPGKPTSAARDVTIAGRKLPMTMEAARVDDTL
                     FAVGVVTLPADDEALRREALAAMQAGLLANLGTPSGEPRARPVTMMSADRPGRPLAGV
                     EVQASGVSPQDQSPRRLTARLVAVGTRAYQAVVLESGDAARARQAEQVEQFLGGFHPF
                     "
     gene            323082..323729
                     /gene="rhtB"
                     /locus_tag="CNE_1c03220"
                     /db_xref="GeneID:10916713"
     CDS             323082..323729
                     /gene="rhtB"
                     /locus_tag="CNE_1c03220"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine/homoserine lactone efflux protein
                     RhtB"
                     /protein_id="YP_004684170.1"
                     /db_xref="GI:339324477"
                     /db_xref="GeneID:10916713"
                     /translation="MRWEVWLAYFAACWVIAVSPGSGAVLSMSHGLSYGLRRTTTTIF
                     GLQAGLVIVLLVAGGGLGALLLASEQAFMVVKTIGALYLIYLGVQQWRAKMESGADQG
                     GGAAPVRVAVMSRRRRFATGLLTNVTNPKGIIFMVAVLPQFIDPNRPLALQLAILAAT
                     MCCVDLVVMHGYALLASRMQGLFRNARAVRWQNRFFGSVLMAVGAALFFVRRQHA"
     misc_feature    323082..323717
                     /gene="rhtB"
                     /locus_tag="CNE_1c03220"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            323808..323996
                     /locus_tag="CNE_1c03230"
                     /db_xref="GeneID:10916714"
     CDS             323808..323996
                     /locus_tag="CNE_1c03230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684171.1"
                     /db_xref="GI:339324478"
                     /db_xref="GeneID:10916714"
                     /translation="MPALPNPRAVARLQPRHTVPPVEEPGPPGIPPDLPLPPEEDPTP
                     PPVEPPVAGHAGRYGVSS"
     gene            complement(324388..324391)
                     /locus_tag="CNE_1c03240"
                     /note="transcriptional regulator GntR family"
                     /pseudo
                     /db_xref="GeneID:10916715"
     gene            324749..324868
                     /locus_tag="CNE_1c03250"
                     /db_xref="GeneID:10916716"
     CDS             324749..324868
                     /locus_tag="CNE_1c03250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684172.1"
                     /db_xref="GI:339324479"
                     /db_xref="GeneID:10916716"
                     /translation="MIMKRIALTALLAASAGGACAQSAGTGITLYGRAVAGLD"
     gene            324899..325861
                     /gene="nagC"
                     /locus_tag="CNE_1c03260"
                     /db_xref="GeneID:10916717"
     CDS             324899..325861
                     /gene="nagC"
                     /locus_tag="CNE_1c03260"
                     /note="porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_004684173.1"
                     /db_xref="GI:339324480"
                     /db_xref="GeneID:10916717"
                     /translation="MGTFRFGSNQYGVSFWGMRGAEDLGGGLRRVFNLEGMITSGTGR
                     YDPLFNRRAQVGLASNDWGTQLLGRAMSLTDDESGAIDPMGLQASSVATLVYGRNWGS
                     RLNAATYNSPVWGGLSVRAQAGSDGMAGSFNSGKQLSAAIKYAQGNLNLTGIYEELRD
                     AQSRMDNLYASSRQYTLGGSYALNNLRLFAGYNLTVSSGDTVATPENSYAATRSQMAW
                     VGANYRLLPALTRLSGVYYATLNKSGGHGTLVTLGAKYDLSKRTSPYGTVASVFNSRM
                     PPSRWRRRRTPCRAPGRTSRAMPASSTGSDGGWPVIEMYWRALP"
     misc_feature    324938..325720
                     /gene="nagC"
                     /locus_tag="CNE_1c03260"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(324941..324943,325049..325051,325142..325144,
                     325205..325207)
                     /gene="nagC"
                     /locus_tag="CNE_1c03260"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(324956..324970,324986..324988,324992..325000,
                     325004..325006,325010..325021,325046..325051,
                     325055..325069,325097..325105,325205..325207,
                     325211..325213,325670..325675,325682..325684)
                     /gene="nagC"
                     /locus_tag="CNE_1c03260"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     gene            325858..326961
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /db_xref="GeneID:10916718"
     CDS             325858..326961
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /EC_number="3.5.1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase
                     NagA"
                     /protein_id="YP_004684174.1"
                     /db_xref="GI:339324481"
                     /db_xref="GeneID:10916718"
                     /translation="MKGNILTPAGWIFGEIHAGPDGRIARIEGVPASPEHNDAPYVLP
                     GFVDLLNHGGGGKDFMDGEAAVPVILRAHVRFGTSSLLGSTMTSPHDVLLPALQALGR
                     ACAQRPPGAARMLGVHLEGPYINPGKLGAQPDTSATATPEELEQYLGAAPLKVVTLAP
                     ELPGHLDIIRLLAARGVRVQLGHTLGTYEDAVAALDAGASGFTHLFNAMTPLQHRAPG
                     VVAAALAHAEFAELIPDLLHVHPGAIRAALRAIPRLYAVTDATAAAGMPDGVYHLGSQ
                     TVYKAHGSVRLADGTLAGSVLTMDQALRNFVSIGLDLADASRRVSLYPAQYLGMSDRG
                     MLAQRCWADVVVLDRALSVRTVYVEGECCVENA"
     misc_feature    325858..326940
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /note="N-acetylglucosamine-6-phosphate deacetylase
                     [Carbohydrate transport and metabolism]; Region: NagA;
                     COG1820"
                     /db_xref="CDD:224733"
     misc_feature    325864..326937
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
                     catalyzes the hydrolysis of the N-acetyl group of
                     N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
                     glucosamine 6-phosphate and acetate. This is the first
                     committed step in the biosynthetic pathway to...; Region:
                     NagA; cd00854"
                     /db_xref="CDD:238434"
     misc_feature    order(326005..326007,326011..326013,326215..326217,
                     326248..326250,326404..326406,326467..326469,
                     326476..326481,326569..326571,326632..326634,
                     326731..326733)
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /note="active site"
                     /db_xref="CDD:238434"
     misc_feature    order(326473..326475,326491..326493,326497..326502,
                     326506..326508,326524..326529,326566..326577,
                     326581..326586,326590..326595,326602..326604)
                     /gene="nagA"
                     /locus_tag="CNE_1c03270"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238434"
     gene            326954..327985
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /db_xref="GeneID:10916719"
     CDS             326954..327985
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /EC_number="3.5.99.6"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="YP_004684175.1"
                     /db_xref="GI:339324482"
                     /db_xref="GeneID:10916719"
                     /translation="MLEEALSAPAVVAAQLAQAPRVAALAAQLAAQAWPAALTVARGS
                     SDHAASYFATLVTRRLGVPVASLPMSTVTLHDSALRVAGQLAVAFSQSGRSPDLVETM
                     QALRDGGAATVALVNAPDSPLAQACAYELPLLAGPEQSVAATKSYIAMLSMSALLVGH
                     LEAARSGERELVDACAGLPAALEQAAAQDWSALVPALRDVERMIVLGRGAGLAIAQEA
                     ALKLKETSGIQAEAFSGAEVRHGPMEIIGDGYPLLVFAPRGPEQAGLLALAAEMRKRG
                     ARVLLAAPPGTVDAELPPELPLVPAGHPLLDPICAIQSFYVAAQALALARGRNPDQPQ
                     YLRKVTETR"
     misc_feature    327068..327979
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="Predicted phosphosugar isomerases [Cell envelope
                     biogenesis, outer membrane]; Region: AgaS; COG2222"
                     /db_xref="CDD:225132"
     misc_feature    327068..327436
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    order(327077..327082,327110..327115,327122..327127,
                     327146..327148,327152..327154,327167..327169,
                     327176..327178,327242..327244)
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    order(327083..327088,327221..327229)
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    327515..327976
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    order(327578..327580,327620..327622,327632..327634,
                     327638..327640,327644..327646,327650..327652,
                     327662..327664,327668..327676,327680..327691,
                     327740..327745,327755..327757,327761..327766,
                     327953..327958,327971..327973)
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    order(327614..327616,327623..327625)
                     /gene="nagB"
                     /locus_tag="CNE_1c03280"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            328044..329531
                     /gene="zwf"
                     /locus_tag="CNE_1c03290"
                     /db_xref="GeneID:10916720"
     CDS             328044..329531
                     /gene="zwf"
                     /locus_tag="CNE_1c03290"
                     /EC_number="1.1.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="YP_004684176.1"
                     /db_xref="GI:339324483"
                     /db_xref="GeneID:10916720"
                     /translation="MQTTRTASSSGTADARPLDLVIFGGAGDLSARKLLPSLYMCHRD
                     GNLPDGTRIIGVGRHRWDREAFVNFADESAQPFVEARYLEPAKWQTFLQRLDFVHVDA
                     SQSGDYPALAAQLRQDALRIYYMAMPPGLFAATCDNLASHGLIANDTRLVLEKPLGVD
                     LASAIGIGEVVSRYFSEDRTYRIDHYLGKETVQNLMALRFGNSIFEPLWRTPFVRSVQ
                     ITVAETVGVGTRGGFYDEAGAMRDMVQNHLLQLVSILAMEPPASLTSDAVRDEKLKVL
                     RSLRPMSPEDVRRNTVRGQYTAGAIAGELVRGYLQEEGIPPDSRTETFVAMRAELGTW
                     RWNKVPFYLRTGKRMQERVTEVVINFAEVPHSIFDAGSTLQPNRMVIRLQPEESVRLT
                     LMVKQPGEGMKLKPLSLALNLDSAFTTRRAEAYERLLLDVIRGRLALFVRRDELQAAW
                     TWVDPILEAWRQQDEGPRPYTAGTWGPAASSAFMAREGVQWSEEA"
     misc_feature    328092..329525
                     /gene="zwf"
                     /locus_tag="CNE_1c03290"
                     /note="glucose-6-phosphate 1-dehydrogenase; Validated;
                     Region: PRK05722"
                     /db_xref="CDD:235579"
     misc_feature    328104..328625
                     /gene="zwf"
                     /locus_tag="CNE_1c03290"
                     /note="Glucose-6-phosphate dehydrogenase, NAD binding
                     domain; Region: G6PD_N; pfam00479"
                     /db_xref="CDD:249890"
     misc_feature    328629..329522
                     /gene="zwf"
                     /locus_tag="CNE_1c03290"
                     /note="Glucose-6-phosphate dehydrogenase, C-terminal
                     domain; Region: G6PD_C; pfam02781"
                     /db_xref="CDD:251528"
     gene            329531..329845
                     /locus_tag="CNE_1c03300"
                     /db_xref="GeneID:10916721"
     CDS             329531..329845
                     /locus_tag="CNE_1c03300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684177.1"
                     /db_xref="GI:339324484"
                     /db_xref="GeneID:10916721"
                     /translation="MRLTERPAWRALAALAVQPLPHLRELVLEPGRGDYARLSAAGIE
                     LDFTRQRINGTVHEALLAPAQDAGIEAQRDAMLAGEPVNATEGRAVLHVALRGGADAH
                     PP"
     misc_feature    329531..>329833
                     /locus_tag="CNE_1c03300"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     gene            329909..330838
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /db_xref="GeneID:10916722"
     CDS             329909..330838
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /EC_number="5.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_004684178.1"
                     /db_xref="GI:339324485"
                     /db_xref="GeneID:10916722"
                     /translation="MRDGHVRGFGGAPVRHVVSLGIGGSDLGPRMACEALAAHASDAV
                     QLHFVSNPDPAQLCAVLRQADAATTLFLVSSKTFTTHDTLINAASARQWLLDHGCPAQ
                     QVPAQFAAITANAACAVAEGYLPQQVFRFWGWVRGRYSLWSAIGLPVMIAAGPRQFRA
                     LLDGAHAMDTHFRSAPLAQNLPVAMALCGIWNRNFLGAPTQLVAPYAAPLARQPAYLQ
                     QQDMESCGKRVDAAGRVVEHDTGFIVWGGLRLDGSTPTSSCCTRARTWCAGRPDRHAP
                     LRGAAAAGAEASPAGAGQSAGAGQRAVLRTQPR"
     misc_feature    329939..330364
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    order(329972..329974,329978..329983,330131..330139,
                     330146..330148,330317..330319)
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    order(330056..330067,330152..330154,330164..330166,
                     330173..330175)
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    330503..>330652
                     /gene="pgi1"
                     /locus_tag="CNE_1c03310"
                     /note="SIS domain. SIS (Sugar ISomerase) domains are found
                     in many phosphosugar isomerases and phosphosugar binding
                     proteins. SIS domains are also found in proteins that
                     regulate the expression of genes involved in synthesis of
                     phosphosugars; Region: SIS; cl00389"
                     /db_xref="CDD:260399"
     gene            330780..331163
                     /gene="pgi2"
                     /locus_tag="CNE_1c03320"
                     /db_xref="GeneID:10916723"
     CDS             330780..331163
                     /gene="pgi2"
                     /locus_tag="CNE_1c03320"
                     /EC_number="5.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_004684179.1"
                     /db_xref="GI:339324486"
                     /db_xref="GeneID:10916723"
                     /translation="MLANLLAQASALSCGRNHDETLAALSASGLPPQEAARLAPHRTF
                     TGNVPVSLLWLDMLDAASLGALIALYEHKVFVQAAIWGIHAYDQWGVELGKAIASAMQ
                     ACLARREVPKEMDPAGAATLASLVG"
     misc_feature    <330822..331079
                     /gene="pgi2"
                     /locus_tag="CNE_1c03320"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     gene            complement(331174..332379)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /db_xref="GeneID:10916724"
     CDS             complement(331174..332379)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComM"
                     /protein_id="YP_004684180.1"
                     /db_xref="GI:339324487"
                     /db_xref="GeneID:10916724"
                     /translation="MSLAVLRSRALTGIAAPPVRVETHLANGLPAFTIVGLADTGVSE
                     SRERVRAAILNSGYEFPNHRITVNLAPADLPKESGRFDLASRGPDMRDVRGQAQARRA
                     IEVAGAGQHSALLVGPPGTGKSMLAQRLPGLLPPMTLQEALESAAVMSLTPGGFRTAL
                     WGQRPCRSPHHTASGPAMGGGGGNPRPGEISLAHHGVLFLDELPEFDRRVPEVLREPL
                     ESGRITVTRAAGHADFPACFQFVAAMNPCPCGYLGHPDRPCRCTPDQVRRYQSRISGP
                     MLDRIDLQVEVPAQDQGEMLDGPPGEPSAVVRTRVLAARECQLARQGKPNNELGGREI
                     ELHCTMEPQAQALLRGAMTRLAWSARSYYRVLKVARTIADLEGAEVLTAAHVGEAIQY
                     RRALRMAGG"
     misc_feature    complement(331186..332334)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="Predicted ATPase with chaperone activity
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0606"
                     /db_xref="CDD:223679"
     misc_feature    complement(<332128..332319)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     misc_feature    complement(<331732..332097)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(332008..332031)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(331777..331779,332005..332028))
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(331774..331791)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(331201..331482)
                     /gene="comM"
                     /locus_tag="CNE_1c03330"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase_2; pfam13335"
                     /db_xref="CDD:257665"
     gene            complement(332461..332739)
                     /locus_tag="CNE_1c03340"
                     /db_xref="GeneID:10916725"
     CDS             complement(332461..332739)
                     /locus_tag="CNE_1c03340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684181.1"
                     /db_xref="GI:339324488"
                     /db_xref="GeneID:10916725"
                     /translation="MKPTDLFNDLQNKVSEALRNSPARDIEKNVRSMMTQGFARLDLV
                     TREEFDVQSQVLARTRARLEELEGRVAELERRAGIPPGAGAVDSTGGA"
     misc_feature    complement(332512..332736)
                     /locus_tag="CNE_1c03340"
                     /note="Membrane fusogenic activity; Region: BMFP;
                     pfam04380"
                     /db_xref="CDD:252554"
     gene            333141..333938
                     /locus_tag="CNE_1c03350"
                     /db_xref="GeneID:10916726"
     CDS             333141..333938
                     /locus_tag="CNE_1c03350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684182.1"
                     /db_xref="GI:339324489"
                     /db_xref="GeneID:10916726"
                     /translation="MKKLALAVSAVVLTSAAATAYAQSTDAAAPAPAAAAAEPASPHT
                     FTANVSLVSDYRYRGISQTNLRPAIQGGFDYAHESGFYVGNWNSSISWLEDANPAVSA
                     PVEMDFYGGFKNTFKVAGTEFNYDVGVLQYYYPGGYNNPRPYTTELYAGIGWGPVFLK
                     YSHAVTNLFGWADSKNSGYIDLSANVPLNFWDLTLNAHVGYQDVKHNSDASYTDWKIG
                     LTKDLGKGFALAVAYVDTNAKQAAYTSANRGRYLGKAAAWASITKTF"
     misc_feature    333261..333935
                     /locus_tag="CNE_1c03350"
                     /note="Bacterial protein of unknown function (Gcw_chp);
                     Region: Gcw_chp; pfam09694"
                     /db_xref="CDD:255490"
     gene            333988..334326
                     /gene="glnK"
                     /locus_tag="CNE_1c03360"
                     /db_xref="GeneID:10916727"
     CDS             333988..334326
                     /gene="glnK"
                     /locus_tag="CNE_1c03360"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein GlnK"
                     /protein_id="YP_004684183.1"
                     /db_xref="GI:339324490"
                     /db_xref="GeneID:10916727"
                     /translation="MKLIIAVIKPFKLDEVREALSDVGVSGITVTEVKGFGRQKGHTE
                     LYRGAEYIVDFLPKVKIEVAVPDDVVERAIEAVEKSARTGKIGDGKIFVAPIEQVIRI
                     RTGETGGDAL"
     misc_feature    333988..334323
                     /gene="glnK"
                     /locus_tag="CNE_1c03360"
                     /note="Nitrogen regulatory protein PII [Amino acid
                     transport and metabolism]; Region: GlnK; COG0347"
                     /db_xref="CDD:223424"
     misc_feature    333997..334302
                     /gene="glnK"
                     /locus_tag="CNE_1c03360"
                     /note="Nitrogen regulatory protein P-II; Region: P-II;
                     smart00938"
                     /db_xref="CDD:198006"
     gene            334664..335926
                     /gene="amtB"
                     /locus_tag="CNE_1c03370"
                     /db_xref="GeneID:10916728"
     CDS             334664..335926
                     /gene="amtB"
                     /locus_tag="CNE_1c03370"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonia channel"
                     /protein_id="YP_004684184.1"
                     /db_xref="GI:339324491"
                     /db_xref="GeneID:10916728"
                     /translation="MILMTLPGLALFYGGLVRSKNMLSVLMQCLVIFSLVALLWAIYG
                     YSFAFTEGNAFFGGTDRLFMKGLTVEAVAATFSKGVVVPELGYFAFQCAFACITCGLI
                     IGAFAERAKFSAVLVFVVLWFTFSYIPMAHMVWFWPGPDAYTDAAAGAAATAKSGWLF
                     QKGALDFAGGTVVHINAAVAGLVGAYMFGKRIGFGREAIRPHSLTFTMVGASLLWFGW
                     FGFNAGSALEANGSAALAFVNTLLATCAAVLAWTFGEWIGKGKPSMLGGASGAVAGLV
                     AITPAAGFVGPMGSIVIGLLAGLLCLWGVTGLKRMLGMDDSLDVFGVHGVGGILGALL
                     TGVFASPSLGGTGIYDYVTNKVADDYSIAGQLWIQFEGVLTTVVWSGVVAFVAYKLVD
                     MLIGLRVPEDEEREGLDITSHGETAYEV"
     misc_feature    334664..335920
                     /gene="amtB"
                     /locus_tag="CNE_1c03370"
                     /note="Ammonium Transporter Family; Region:
                     Ammonium_transp; cl03012"
                     /db_xref="CDD:261545"
     gene            336476..337771
                     /gene="gshA"
                     /locus_tag="CNE_1c03380"
                     /db_xref="GeneID:10916729"
     CDS             336476..337771
                     /gene="gshA"
                     /locus_tag="CNE_1c03380"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamate-cysteine ligase GshA"
                     /protein_id="YP_004684185.1"
                     /db_xref="GI:339324492"
                     /db_xref="GeneID:10916729"
                     /translation="MVPHLITALNGPLLELEKKILDATPSIERWFRLEWQEHTPPFYC
                     SVDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPER
                     HTRNMFYLQNVARLSLIMRQAGLNVRLGSLSEEITEPTPIELPDGQTLVVEPLARLGT
                     KGRRLGLKDFDPCSILLNNDLSAGIPPILENINEQYLLPPLHAGWSTRRKSSHFAAYD
                     EVAKKFAKLIDIDQWMVNPYFARCSGVDFHERVGEEELADAVEGVLKKIAKKYREYGI
                     KETPYVVVKADAGTYGMGIMTVRDPSEVKGLNRKERNKMSVVKEGLEVSDVIIQEGVH
                     TFEKVNEAVAEPVVYMIDRYVVGGFYRVHTGRGNDENLNAPGMHFVPLAFAPNGIPDS
                     HAKPGAAVPNRFYMYGVVARLALLAASLELEKTDPNPIL"
     misc_feature    336524..337705
                     /gene="gshA"
                     /locus_tag="CNE_1c03380"
                     /note="Glutamate-cysteine ligase; Region: GshA; pfam08886"
                     /db_xref="CDD:149827"
     gene            337780..338748
                     /gene="gshB"
                     /locus_tag="CNE_1c03390"
                     /db_xref="GeneID:10916730"
     CDS             337780..338748
                     /gene="gshB"
                     /locus_tag="CNE_1c03390"
                     /EC_number="6.3.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase GshB"
                     /protein_id="YP_004684186.1"
                     /db_xref="GI:339324493"
                     /db_xref="GeneID:10916730"
                     /translation="MRILFITDPLETFKTYKDSTYAMMTEAAARGHELYWCLQPQLAL
                     SGRTVEAVATRLHLTGETSDADHSAWYREGNSALEPLSAFDAVLMRKDPPFDMEYVTS
                     TWLLELAESQGARVFNKPRAIRDHSEKLAIAQYPEYITPTLVTRDLARIRDFHAEHRD
                     IIVKPLDGMGGMGVFRVGADGMNLAAIVETLGHDGARTLMVQRYIPAIKDGDKRILLI
                     GGVPVPYSLARVPMAGEVRGNLAAGGTGRAQELSTRDREIAEALAPGLWEQGLLLVGL
                     DVIGDYLTEVNVTSPTCFQEITQQTGFHVAAMFIDALEHAVDAAGR"
     misc_feature    337780..338739
                     /gene="gshB"
                     /locus_tag="CNE_1c03390"
                     /note="glutathione synthetase; Provisional; Region:
                     PRK05246"
                     /db_xref="CDD:235371"
     misc_feature    337780..338151
                     /gene="gshB"
                     /locus_tag="CNE_1c03390"
                     /note="Prokaryotic glutathione synthetase, N-terminal
                     domain; Region: GSH-S_N; pfam02951"
                     /db_xref="CDD:190485"
     misc_feature    338161..338685
                     /gene="gshB"
                     /locus_tag="CNE_1c03390"
                     /note="Prokaryotic glutathione synthetase, ATP-grasp
                     domain; Region: GSH-S_ATP; pfam02955"
                     /db_xref="CDD:251641"
     gene            338816..339271
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /db_xref="GeneID:10916731"
     CDS             338816..339271
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /EC_number="2.7.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system, fructose-specific
                     component IIA"
                     /protein_id="YP_004684187.1"
                     /db_xref="GI:339324494"
                     /db_xref="GeneID:10916731"
                     /translation="MAGILIIAHTPLASALRDCAAHVYCGQPQRLEAIDVLPDADPAV
                     VLAEARRRLAAICEDNGALVLTDIFGATPANIAARLAEPGRVRVLAGVNLPMLVRAIC
                     YRGEKLDQLATKALAGGSQGVLQVGTTTVQNQTANHPDKYAAEGHHHHQ"
     misc_feature    338822..339178
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIA_man; cd00006"
                     /db_xref="CDD:237978"
     misc_feature    order(338840..338842,338882..338887,338921..338923,
                     339029..339031,339119..339121)
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(338840..338842,339014..339016,339029..339031)
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    338840..338842
                     /gene="fruA"
                     /locus_tag="CNE_1c03400"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            339240..339509
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /db_xref="GeneID:10916732"
     CDS             339240..339509
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidinoprotein-hexose
                     phosphotransferase PtsH"
                     /protein_id="YP_004684188.1"
                     /db_xref="GI:339324495"
                     /db_xref="GeneID:10916732"
                     /translation="MLQRDTTIINKLGLHARASAKLTQLAGNFVSQVKMSRNGRQVDA
                     KSIMGVMMLAAGIGSTVTLETDGPDEQEAMDALLALIANRFGEGE"
     misc_feature    339258..339482
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    339258..339263
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(339279..339281,339285..339290,339294..339299,
                     339309..339311,339318..339320,339372..339383,
                     339390..339395)
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    339282..339284
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    339375..339377
                     /gene="ptsH"
                     /locus_tag="CNE_1c03410"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            339559..341331
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /db_xref="GeneID:10916733"
     CDS             339559..341331
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase PtsI"
                     /protein_id="YP_004684189.1"
                     /db_xref="GI:339324496"
                     /db_xref="GeneID:10916733"
                     /translation="MPFALHGIPVSRGVAIGRAHLLAPAALDVSHYLVDEDQLDAEVE
                     RLRAARAAVRAELVALKRDLPRDAPEELGAFLDVHAMILDDEALAREPEALIRGRRYN
                     AEWALTTRLEELMRQFDEIEDEYLRERKTDIRQVVERILKALAGAPVLVPAPVPALAA
                     DGEAATGVIVVAHDISPADMLQFRHTIFHGFVTDMGGRTSHTAIVARSLDIPAAVGVQ
                     SASELIRQDDWIIIDGDAGLVIVDPTAIILEEYRHRQSERALEKKRLQRLRHTPAVTL
                     DGLEIDLLANIEMAEDAGAALSAGAVGVGLFRSEFLFMNRRDELPGEDEQFQAYRGAV
                     DAMHGLPVTIRTIDIGADKPLDARGDGRSDDFETALNPALGLRAIRWSLSEPGMFLTQ
                     LRALLRASAFGPVRLLVPMLAHASEIDQTLALIAKAKRQLDERGEAYDPGMKVGAMIE
                     IPAAVLLLPLFLRKMDFLSIGTNDLIQYTLAIDRADNAVAHLFDPLHPAVLQLVARTI
                     REANRAGVPVAVCGEMAGDPSMTRLLLGMGLREFSMHPAQLLRVKQEILHAHCERLEP
                     LVDQVLQAYDPDEQATALRQLARP"
     misc_feature    339571..341316
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    339571..339945
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    340057..340266
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    340342..341241
                     /gene="ptsI"
                     /locus_tag="CNE_1c03420"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            341513..341851
                     /gene="bfd"
                     /locus_tag="CNE_1c03430"
                     /db_xref="GeneID:10916734"
     CDS             341513..341851
                     /gene="bfd"
                     /locus_tag="CNE_1c03430"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin-like ferredoxin"
                     /protein_id="YP_004684190.1"
                     /db_xref="GI:339324497"
                     /db_xref="GeneID:10916734"
                     /translation="MPVPRAPQEGVVYVCICNQITDREIHGAAHLGIETLDELAETLG
                     VGTCCGRCRDCAQQVLQEGVAAVRNVTVATLANIQVVEISSCSASGPCTIMDTRDPAV
                     ANDQRKALVA"
     misc_feature    341546..341710
                     /gene="bfd"
                     /locus_tag="CNE_1c03430"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     cl01093"
                     /db_xref="CDD:260786"
     gene            341978..342457
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /db_xref="GeneID:10916735"
     CDS             341978..342457
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="cytochrome b1"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="YP_004684191.1"
                     /db_xref="GI:339324498"
                     /db_xref="GeneID:10916735"
                     /translation="MKGDKKVIQHLNAQLKNELTAINQYFLHARMYRHWGLKKLGEVE
                     YKESIGEMKHADRLIERILMLDGLPNLQDLHKLLLGEDTPEMLKCDLKLEQTAHATVK
                     EGIAYCESVGDYVSREILVDILTDTEEHIEYLETQLDLIDKVGLQNYLQSQLEPGEQ"
     misc_feature    341981..342439
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="Bacterioferritin, ferritin-like diiron-binding
                     domain; Region: Bacterioferritin; cd00907"
                     /db_xref="CDD:153099"
     misc_feature    341999..342409
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    order(342020..342022,342044..342046,342065..342067,
                     342110..342112,342131..342133,342143..342145)
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(342026..342031,342035..342040,342050..342052,
                     342128..342130,342137..342139,342254..342259,
                     342266..342268,342278..342280,342353..342358)
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="ferroxidase pore; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(342029..342031,342050..342052,342128..342130,
                     342137..342139,342257..342259,342278..342280,
                     342356..342358,342365..342367)
                     /gene="bfr2"
                     /locus_tag="CNE_1c03440"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153099"
     gene            342649..343752
                     /gene="selU"
                     /locus_tag="CNE_1c03450"
                     /db_xref="GeneID:10916736"
     CDS             342649..343752
                     /gene="selU"
                     /locus_tag="CNE_1c03450"
                     /EC_number="2.9.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA 2-selenouridine synthase SelU"
                     /protein_id="YP_004684192.1"
                     /db_xref="GI:339324499"
                     /db_xref="GeneID:10916736"
                     /translation="MRPDTADFRTLFLSGVAMLDVRAPLEFARGAFPGAVNLPLMDDA
                     ERHEVGLCYAQKGQQAAIELGHQLVSGLRKAARIAAWAEFARAHPDGYLYCFRGGLRS
                     QLVQQWLHAAGVDYPRVTGGYKAMRGFLIETTDAAAAEQQWFVLGGLTGSGKTDVLAD
                     VPAAIDLEGHARHRGSAFGRRALAQPPQIDFENALAIDVLRHIDAGWRALVVEDEGRY
                     IGSRDVPQALTQRMQASPLVWLDASFDERVERVLRDYVQGLSAEFIAEKGSTEGFEAY
                     ATRLREAMAGISPRLGGARYGKLSALLDQALAQQAERGEVDLHRDWIAVLLREYYDPM
                     YAFQREQREARIVFRGDRAAVTDWLRAHTAQRD"
     misc_feature    342649..343737
                     /gene="selU"
                     /locus_tag="CNE_1c03450"
                     /note="tRNA 2-selenouridine synthase; Provisional; Region:
                     PRK11784"
                     /db_xref="CDD:236982"
     misc_feature    342655..343038
                     /gene="selU"
                     /locus_tag="CNE_1c03450"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    342931..342933
                     /gene="selU"
                     /locus_tag="CNE_1c03450"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(343762..344535)
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /db_xref="GeneID:10916737"
     CDS             complement(343762..344535)
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /EC_number="2.7.7.n4"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein MoeB"
                     /protein_id="YP_004684193.1"
                     /db_xref="GI:339324500"
                     /db_xref="GeneID:10916737"
                     /translation="MNDDQNDGLNDEQLLRYSRHILLDELGIEGQRRLLAGHALVIGA
                     GGLGAAALPFLASAGVGRITVVDNDQVDLTNLQRQIIHTTANVGRPKVDSAREGMLRI
                     NPGLEIVTVPARVGDAELDQLVATADVVLDCCDNFATRQAVNRACVGHKVPLVSGAAL
                     RFDGQISVFDRRQPDAPCYACLFPPAEPAPEVACATMGVFAPLVGMVGTVQAAEALKL
                     LAGVGESLAGRLLMVNALSMEWTTMRLARTPDCPVCAGH"
     misc_feature    complement(343783..344511)
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    complement(343801..344490)
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(344119..344121,344137..344139,
                     344263..344265,344302..344304,344329..344331,
                     344335..344337,344395..344397,344401..344403,
                     344407..344409))
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(343804..343809,343813..343815,
                     343834..343836,343846..343848,344041..344043,
                     344047..344049,344059..344064,344116..344118,
                     344128..344136,344395..344397))
                     /gene="moeB"
                     /locus_tag="CNE_1c03460"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(344702..346309)
                     /gene="ctpA"
                     /locus_tag="CNE_1c03470"
                     /db_xref="GeneID:10916738"
     CDS             complement(344702..346309)
                     /gene="ctpA"
                     /locus_tag="CNE_1c03470"
                     /EC_number="3.4.21.102"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxy-terminal-processing protease CtpA"
                     /protein_id="YP_004684194.1"
                     /db_xref="GI:339324501"
                     /db_xref="GeneID:10916738"
                     /translation="MRKTLKNISLVSVGLVAGVLATLQISATAQNSSGPLPLDQLRLM
                     ADIFGQIKREYVEPVDDKKLLTEAIKGMVASLDPHSSYLDEKDFKELQEGTRGRFAGL
                     GIEISQEEGLVKVINPIEDTPAFRAGIQPGDLITRIDDKPVRGLPLEQAVKRMRGEPG
                     TKVTLTIYRKSEERTFPVSITRAEIRVQSVKAKMLDNNIGWIRLTSFQERTISDLSRK
                     LAELAQKNPNMKGLVLDLRNNGGGVLQGAVGVAAAFLPEDATVVSTNGQVPDAKRVYK
                     ASYNNYRLSSLEDDPLKGLPALYKKIPMVVLTNAYSASASEIVAGALQDHHRAQIMGK
                     TTFGKGSVQTVRPLTNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPEGDPDDAL
                     ITREIDTERHLHNKQESEEPEMTEREQRRVDELRRLEEENAKKSPEEREKDRRKKPVE
                     FGSAEDFMLQQAIAQLNGQPVKRSKSKLETNPPADNGKAAKPSGKSGAKGASAPAAKP
                     AAPAPAKQPPASAPIGEPLGTPTGKAP"
     misc_feature    complement(345068..346288)
                     /gene="ctpA"
                     /locus_tag="CNE_1c03470"
                     /note="Periplasmic protease [Cell envelope biogenesis,
                     outer membrane]; Region: Prc; COG0793"
                     /db_xref="CDD:223864"
     misc_feature    complement(345167..346195)
                     /gene="ctpA"
                     /locus_tag="CNE_1c03470"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    complement(order(345293..345295,345368..345370))
                     /gene="ctpA"
                     /locus_tag="CNE_1c03470"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     gene            complement(346489..347235)
                     /gene="gpmA"
                     /locus_tag="CNE_1c03480"
                     /db_xref="GeneID:10916739"
     CDS             complement(346489..347235)
                     /gene="gpmA"
                     /locus_tag="CNE_1c03480"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="YP_004684195.1"
                     /db_xref="GI:339324502"
                     /db_xref="GeneID:10916739"
                     /translation="MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLK
                     DAGLGFDVAYTSVLKRAIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETA
                     AKFGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVM
                     PLWNESIAPDIQSGKRVVIAAHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDA
                     DLRPLRHYYLGDQDAIAASLAAVASQGKAR"
     misc_feature    complement(<346900..347229)
                     /gene="gpmA"
                     /locus_tag="CNE_1c03480"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    complement(order(347056..347058,347209..347214))
                     /gene="gpmA"
                     /locus_tag="CNE_1c03480"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     misc_feature    complement(346552..>346767)
                     /gene="gpmA"
                     /locus_tag="CNE_1c03480"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     gene            347319..347837
                     /locus_tag="CNE_1c03490"
                     /db_xref="GeneID:10916740"
     CDS             347319..347837
                     /locus_tag="CNE_1c03490"
                     /EC_number="2.8.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like sulfurtransferase"
                     /protein_id="YP_004684196.1"
                     /db_xref="GI:339324503"
                     /db_xref="GeneID:10916740"
                     /translation="MSQTGDNGGWPCDGRAWTPNRVFYNAADPTYRNANVNFFADYNN
                     LALIALAVVSGGLLAWPAISRSTRGKTVNTAAATQLINKRGAVVVDIREPAEYAKGHL
                     PQAKSAPLADLPSRAAGLAKDKAAPIIVVCQTGQRSGKAQAALKEAGYSEIYALEGGI
                     AAWQQAGLPLVK"
     misc_feature    347547..347810
                     /locus_tag="CNE_1c03490"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    347712..347714
                     /locus_tag="CNE_1c03490"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            347921..348178
                     /locus_tag="CNE_1c03500"
                     /db_xref="GeneID:10916741"
     CDS             347921..348178
                     /locus_tag="CNE_1c03500"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-like protein"
                     /protein_id="YP_004684197.1"
                     /db_xref="GI:339324504"
                     /db_xref="GeneID:10916741"
                     /translation="MARVVMYSTVVCPYCLMAERLLKSKGVEMIEKILIDREPGKREE
                     MMARTGRRTVPQIYIDETHVGGFDDLSALDRQGGLVPLLAA"
     misc_feature    347930..348151
                     /locus_tag="CNE_1c03500"
                     /note="Glutaredoxin (GRX) family, GRX bacterial class 1
                     and 3 (b_1_3)-like subfamily; composed of bacterial GRXs,
                     approximately 10 kDa in size, and proteins containing a
                     GRX or GRX-like domain. GRX is a glutathione (GSH)
                     dependent reductase, catalyzing the...; Region:
                     GRX_GRXb_1_3_like; cd03418"
                     /db_xref="CDD:239510"
     misc_feature    order(347945..347947,347954..347962,348071..348073,
                     348077..348082)
                     /locus_tag="CNE_1c03500"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239510"
     misc_feature    order(347954..347956,347963..347965)
                     /locus_tag="CNE_1c03500"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239510"
     gene            348380..348898
                     /gene="secB"
                     /locus_tag="CNE_1c03510"
                     /db_xref="GeneID:10916742"
     CDS             348380..348898
                     /gene="secB"
                     /locus_tag="CNE_1c03510"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export protein SecB"
                     /protein_id="YP_004684198.1"
                     /db_xref="GI:339324505"
                     /db_xref="GeneID:10916742"
                     /translation="MSDQQNTQQDDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPSV
                     EVQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLL
                     GIACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGAEGGNS
                     GIVMPDGSQARH"
     misc_feature    348380..348814
                     /gene="secB"
                     /locus_tag="CNE_1c03510"
                     /note="preprotein translocase subunit SecB; Validated;
                     Region: PRK05751"
                     /db_xref="CDD:180234"
     misc_feature    order(348449..348451,348461..348463,348614..348616,
                     348620..348622)
                     /gene="secB"
                     /locus_tag="CNE_1c03510"
                     /note="SecA binding site; other site"
                     /db_xref="CDD:238312"
     misc_feature    order(348611..348613,348617..348619,348623..348625,
                     348629..348631)
                     /gene="secB"
                     /locus_tag="CNE_1c03510"
                     /note="Preprotein binding site; other site"
                     /db_xref="CDD:238312"
     gene            349003..350019
                     /gene="gpsA"
                     /locus_tag="CNE_1c03520"
                     /db_xref="GeneID:10916743"
     CDS             349003..350019
                     /gene="gpsA"
                     /locus_tag="CNE_1c03520"
                     /EC_number="1.1.1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_004684199.1"
                     /db_xref="GI:339324506"
                     /db_xref="GeneID:10916743"
                     /translation="MKLTFLGAGAWGTALASHAAATNDVVLWGRDPAQLAAIAATREN
                     AAYLPGVTLSGRLAVQADFEQAVAHAADDADGIVVVATPVAGLREMTRRLAARSARPV
                     SMLWLCKGFESGTHLLPHQMVRAELDAAGRTEGFAYGVLTGPSFAREVALGLPCALTV
                     AGNEPSLAERAQAAFHHHAMRIYGSDDLTGVEVGGAVKNVLAIATGASDGLGLGLNAR
                     AALVTRGLAEMTRLGLALGGRVETFMGLAGVGDLILTATGDLSRNRKVGQQLAAGQSL
                     EQILAGLGHVAERRALRPGGGRAGRHARRRDADRPRGLRGAVHGLSAADAVAQLLQRD
                     ARDE"
     misc_feature    349003..349866
                     /gene="gpsA"
                     /locus_tag="CNE_1c03520"
                     /note="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase; Validated; Region: gpsA; PRK00094"
                     /db_xref="CDD:234629"
     misc_feature    349006..349506
                     /gene="gpsA"
                     /locus_tag="CNE_1c03520"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     N-terminus; Region: NAD_Gly3P_dh_N; pfam01210"
                     /db_xref="CDD:250446"
     misc_feature    349558..>349866
                     /gene="gpsA"
                     /locus_tag="CNE_1c03520"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     C-terminus; Region: NAD_Gly3P_dh_C; pfam07479"
                     /db_xref="CDD:254224"
     gene            350056..351033
                     /locus_tag="CNE_1c03530"
                     /db_xref="GeneID:10916744"
     CDS             350056..351033
                     /locus_tag="CNE_1c03530"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004684200.1"
                     /db_xref="GI:339324507"
                     /db_xref="GeneID:10916744"
                     /translation="MPTRRQALIALAAACAAGTSGSVFAQPWPARPIRMVVPFPPGSS
                     PDLIARIVTEKLAAALGQPVVVENRPGAGGNIGTGMVARAAPDGYTLLFTINGPLVTA
                     PTLSRNLNYDPFRQLAPVTLVATSPNVLVVDARLPVHNLREFVALARSKPAELNYGSP
                     GNGSASHLAMEQLKAMAGIDLQHVPYPGFPQITTAMVGGQVQAGFMVPAIAMPQVNAG
                     KLRVLAVTTTGRTAVLPSVPTVAESGYPGFEAISWQAVLAPAGTPQAVIDRLYRELVA
                     IIGSADVRDKMRAQYFVPAGTAPASLRQTMVSEKARWDKVIRAAGVQPE"
     misc_feature    350197..351018
                     /locus_tag="CNE_1c03530"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(351050..351520)
                     /gene="trmL"
                     /locus_tag="CNE_1c03540"
                     /db_xref="GeneID:10916745"
     CDS             complement(351050..351520)
                     /gene="trmL"
                     /locus_tag="CNE_1c03540"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (cytidine/uridine-2'-O-)-methyltransferase
                     TrmL"
                     /protein_id="YP_004684201.1"
                     /db_xref="GI:339324508"
                     /db_xref="GeneID:10916745"
                     /translation="MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARM
                     RRAGLDYHEYATMRVHESWDALMASEQPDPARMFALTTRGSTPFGQVAFRPGDWFVFG
                     PETRGLSPERRDWFPPAQRIRLPMRPDNRSLNLSNTVAVVVFEAWRQNGFEGGS"
     misc_feature    complement(351053..351520)
                     /gene="trmL"
                     /locus_tag="CNE_1c03540"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            complement(351604..351783)
                     /locus_tag="CNE_1c03550"
                     /db_xref="GeneID:10916746"
     CDS             complement(351604..351783)
                     /locus_tag="CNE_1c03550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684202.1"
                     /db_xref="GI:339324509"
                     /db_xref="GeneID:10916746"
                     /translation="MNLRGAFRLARAVRLDGLHVALVDDVMTSGATMHEAASVLKAHG
                     AARVSVSVIVALRTP"
     misc_feature    complement(351607..>351741)
                     /locus_tag="CNE_1c03550"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(351616..351618,351688..351702,
                     351706..351714))
                     /locus_tag="CNE_1c03550"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(351780..352253)
                     /locus_tag="CNE_1c03560"
                     /db_xref="GeneID:10916747"
     CDS             complement(351780..352253)
                     /locus_tag="CNE_1c03560"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_004684203.1"
                     /db_xref="GI:339324510"
                     /db_xref="GeneID:10916747"
                     /translation="MNAAAAPDGLRPDGKYTRAPRWLPAPPARCWPACALALGRHFHC
                     PAITPTRWGDYASPQDQLVLALKFGHALPLAGWLAARLAAGLPGAWAGARPAPPDLIA
                     PIPLSPQRLAARGFNQAWEIARPLARHLGLRPTRCCCSASATPAASARWTWPPGR"
     misc_feature    complement(<351858..352193)
                     /locus_tag="CNE_1c03560"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    complement(<351864..352160)
                     /locus_tag="CNE_1c03560"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cl00309"
                     /db_xref="CDD:260342"
     gene            352210..353277
                     /locus_tag="CNE_1c03570"
                     /db_xref="GeneID:10916749"
     CDS             352210..353277
                     /locus_tag="CNE_1c03570"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="YP_004684204.1"
                     /db_xref="GI:339324511"
                     /db_xref="GeneID:10916749"
                     /translation="MPSGRSPSGAAAAFIRRPGLILYLSPRRFLIFLLPCLPVSLHAA
                     DSPDAFLPPARLTRLAFDRRSRGFGQLDFLLGEIGRRMQERMEVIRLAPQRALDIGCG
                     HGQGLAGLRDRFPDAQIAGLDISGAMLAEAGQRDPQRRPGWIGRMLGKRPLFDLVQGD
                     LATLPFAPASFDLLWSNLALHWHPEPHRVFPEWHRVARDEGLVLFSLFGPDTLKELRA
                     AFAEVDEAPHTLRFVDMHDIGDMLVHSGWSTPVMDMETLTVTYESPATLLREVQAFGG
                     LRGPAAALPQGLRGRGWYQALAQALERRRNADGVIPLTFEIVYGHAWKLAPRGGQAVD
                     DQGRAVVPLDQIGRARPRRTS"
     misc_feature    352438..353181
                     /locus_tag="CNE_1c03570"
                     /note="biotin biosynthesis protein BioC; Region: BioC;
                     TIGR02072"
                     /db_xref="CDD:233708"
     misc_feature    352492..352833
                     /locus_tag="CNE_1c03570"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(352504..352524,352576..352581,352684..352692,
                     352738..352740)
                     /locus_tag="CNE_1c03570"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            353550..354059
                     /locus_tag="CNE_1c03580"
                     /db_xref="GeneID:10916748"
     CDS             353550..354059
                     /locus_tag="CNE_1c03580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684205.1"
                     /db_xref="GI:339324512"
                     /db_xref="GeneID:10916748"
                     /translation="MQDLGIALQTAGGDSGGNLDGPLPAPHDWLMKRNCSLSPRQVGW
                     FYLSILTVSLAIALFFAWQGSWLVLPFASIELIGLGIALLVYARHATDYERVSITDGM
                     LVVETASGTKVTRREFNPRWVRVELGESFRALVTLRSGGREVQVGCYVDPYRRRKFAQ
                     ELAAALRRL"
     misc_feature    353640..354047
                     /locus_tag="CNE_1c03580"
                     /note="Integral membrane protein (DUF2244); Region:
                     DUF2244; pfam10003"
                     /db_xref="CDD:255688"
     gene            354118..355380
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /db_xref="GeneID:10916750"
     CDS             354118..355380
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Aa3-type cytochrome oxidase subunit II"
                     /protein_id="YP_004684206.1"
                     /db_xref="GI:339324513"
                     /db_xref="GeneID:10916750"
                     /translation="MKMWKKASAVCLAGASLLASQTASAVSDMPGGPAVRQLNLTEPV
                     TKIAEQIHWLNWMMLIMCTVIFIAVFSVMFYSVFKHRKSKGAKPAAFHESITVEVIWT
                     IVPFIIVIAMALPATKTVVAMKDTTNSDVTIKATGYQWKWGYDYLKGEGEGISFVSTL
                     TTPREQINNEQPKSNTYLMEVDNELVVPVNKKIRIVTTANDVIHAWMIPAFGVKQDAI
                     PGFVRDTWFKAEKIGVYRGQCAELCGKEHAFMPIVVRVVSDADYTKWVDGKKKELAAK
                     ADDPNKTWTLDEAKVRGEKIYAANCAVCHQPNGKGGGAFPALDGSKVVNGPKAGQMHI
                     LLEGKGGMPSWKQLSDTELAMVMTYTRNAWSNKTGEVIQPSDFVGARAGKFPEGGGAA
                     GGEAPKAEAKPADKADKQASLAGNRVAG"
     misc_feature    354136..354954
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 2 [Energy production and conversion]; Region:
                     CyoA; COG1622"
                     /db_xref="CDD:224537"
     misc_feature    354226..354462
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    354502..354912
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="C-terminal domain of Cytochrome c Oxidase subunit
                     II; Region: CcO_II_C; cd13912"
                     /db_xref="CDD:259979"
     misc_feature    order(354502..354507,354511..354513,354517..354519,
                     354550..354552,354697..354699,354715..354717,
                     354778..354789)
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="subunit II/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(354661..354663,354667..354669,354682..354687,
                     354811..354813)
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="subunit II/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(354727..354729,354832..354834,354838..354840,
                     354844..354846,354856..354858,354865..354867)
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="CuA binding site [ion binding]; other site"
                     /db_xref="CDD:259979"
     misc_feature    order(354757..354759,354763..354765,354772..354774,
                     354778..354780,354784..354786,354829..354840,
                     354850..354852,354856..354861)
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259979"
     misc_feature    order(354817..354819,354823..354825)
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="subunit II/IV interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    <354934..355230
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    354991..355194
                     /gene="ctaC"
                     /locus_tag="CNE_1c03590"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            355419..357026
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /db_xref="GeneID:10916751"
     CDS             355419..357026
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Aa3-type cytochrome oxidase subunit I"
                     /protein_id="YP_004684207.1"
                     /db_xref="GI:339324514"
                     /db_xref="GeneID:10916751"
                     /translation="MSTATPDALAHPHDHAHDDHAHDHPHGWRRWLFATNHKDIGTLY
                     LLFSFIMLLSGGLLALLIRLELFEPGLQFFRPELFNQFTTMHGLVMVFGAIMPAFVGF
                     ANWMIPLQIGASDMAFARMNNFSFWLMPPAALLLAGSFLVPGGATAAGWTLYAPLSVQ
                     MGPGMDMAIFAMHIMGASSIMGSINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLI
                     AVMPVLAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIV
                     SQVVPAFARKRLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLIA
                     VPTAVKIFNWIATMWRGSMTFETPMLFSIGFIFVFTIGGFTGLMPAVAPIDIQLQDTY
                     FIVAHFHYVLVAGSLFALFAGFYYWGPKWSGFMYNETRGQIHFWGSIIFFNVTFFPMH
                     FLGLAGMPRRYADYPTQFADFNAIASIGALGFGLMQVYFFFFVVLPSYRGGEKAADKP
                     WDGAEGLEWTVPSPAPFHTFEVPPQVR"
     misc_feature    355497..357020
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    355521..356975
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Cytochrome C oxidase subunit I.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(355521..355523,355758..355760,355770..355772,
                     355776..355778,355797..355799,355914..355916,
                     355926..355928,355980..355982,355992..355994,
                     356052..356054,356073..356075,356082..356084,
                     356106..356108,356133..356141,356154..356159,
                     356163..356165,356193..356195,356304..356306,
                     356313..356315,356322..356327,356337..356339)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(355548..355550,355728..355730,355761..355763,
                     355782..355784,355791..355793,355950..355955,
                     355971..355973,355983..355985)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(355566..355568,355578..355580,355587..355589,
                     355599..355601,355836..355841,356679..356681,
                     356901..356903,356910..356912)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(355608..355610,355617..355622,356703..356705,
                     356712..356717,356814..356816,356868..356870)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(355656..355658,356163..356165,356274..356276,
                     356283..356288,356361..356369,356376..356378,
                     356385..356387,356409..356411,356433..356435,
                     356442..356444,356463..356471,356505..356507,
                     356559..356564,356568..356570,356574..356588,
                     356778..356783,356793..356801,356826..356831)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(355674..355676,356613..356615,356625..356627,
                     356751..356753,356862..356864)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(355830..355832,355839..355841)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(355896..355898,356121..356132)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356052..356054,356073..356075,356193..356195,
                     356304..356306,356313..356315,356322..356327,
                     356337..356339)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356163..356165,356178..356183,356571..356573,
                     356583..356588,356793..356795)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356202..356204,356349..356354,356607..356609)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(356202..356204,356214..356216,356247..356249,
                     356349..356354,356427..356429,356436..356438)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356277..356279,356289..356291,356970..356972)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(356352..356354,356583..356588,356793..356798)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    356367..356369
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    356466..356468
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356610..356612,356793..356798)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356706..356708,356877..356879)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(356814..356816,356826..356828)
                     /gene="ctaD"
                     /locus_tag="CNE_1c03600"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            357101..357232
                     /locus_tag="CNE_1c03610"
                     /db_xref="GeneID:10916752"
     CDS             357101..357232
                     /locus_tag="CNE_1c03610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684208.1"
                     /db_xref="GI:339324515"
                     /db_xref="GeneID:10916752"
                     /translation="MQSPDKSPSRPDQKAANRRLGLILLSIVVVFFLGFFAKMMFLG"
     gene            357250..357861
                     /gene="ctaG"
                     /locus_tag="CNE_1c03620"
                     /db_xref="GeneID:10916753"
     CDS             357250..357861
                     /gene="ctaG"
                     /locus_tag="CNE_1c03620"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein CtaG"
                     /protein_id="YP_004684209.1"
                     /db_xref="GI:339324516"
                     /db_xref="GeneID:10916753"
                     /translation="MSNDQQAGREADKRFNRGMMLRLVVIVAVMFGFGYALVPLYKKI
                     CEITGINVITTRELHGAVKNTQVDKSRTITVEFDSNARGPFAFRPVKNSMEVHPGEMA
                     TIVYEVANGQPRDISAQAIPSYAPKQATQYFMKLECFCFKQQTLKAKEAREMPVVFVI
                     DPALPKDVKNITLSYTFFEVGAPVAQAPEGQVAPQPAPAGKGI"
     misc_feature    357277..357831
                     /gene="ctaG"
                     /locus_tag="CNE_1c03620"
                     /note="cytochrome C oxidase assembly protein; Provisional;
                     Region: PRK05089"
                     /db_xref="CDD:235341"
     gene            357901..358125
                     /locus_tag="CNE_1c03630"
                     /db_xref="GeneID:10916754"
     CDS             357901..358125
                     /locus_tag="CNE_1c03630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684210.1"
                     /db_xref="GI:339324517"
                     /db_xref="GeneID:10916754"
                     /translation="MDEMKDAVKRKMSFAQTMRAVLWSFIGLRKGAEHERDMARLNPV
                     HVVIAGVIAAAIFIAVLVVIVRIVVGQAAG"
     misc_feature    357940..>358071
                     /locus_tag="CNE_1c03630"
                     /note="Protein of unknown function (DUF2970); Region:
                     DUF2970; pfam11174"
                     /db_xref="CDD:204604"
     gene            358270..359130
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /db_xref="GeneID:10916755"
     CDS             358270..359130
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Aa3-type cytochrome oxidase subunit III"
                     /protein_id="YP_004684211.1"
                     /db_xref="GI:339324518"
                     /db_xref="GeneID:10916755"
                     /translation="MSANRANAPYYFVPGPSRHPITASFGLLMTGAGAAGWVNGQPWA
                     PYLCGFGLLWFLFVLKSWFGDAISESEGGMYGKNIDLSFRWSMGWFIFSEVMFFAAFF
                     GALFYARTIAMPWLGDLNNKILWPDFAAVWPNTGPAGVVESFQTMGPWPIPTINTALL
                     LMSGLTLTWAHHALLAGKRSQLIQGLSLTILLGAVFMCFQVYEYMHAYSELNLKLSSG
                     IYGSTFFLLTGFHGFHVTMGAIMLTVVLIRVLKGHFTPDHHFAFEGAAWYWHFVDVVW
                     LFLYVVVYWL"
     misc_feature    358330..359124
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Cytochrome c oxidase subunit III.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_III; cd01665"
                     /db_xref="CDD:238834"
     misc_feature    order(358450..358452,358459..358464,358471..358473,
                     358480..358482,358483..358485)
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(358453..358458,358465..358470,358477..358479,
                     358492..358494,358525..358530,358537..358539,
                     358990..358992,359011..359013,359047..359052)
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(358501..358503,358510..358515,358546..358548,
                     358555..358557,358567..358572,358588..358590,
                     358921..358926,358933..358935,358945..358947)
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    358672..358674
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(358717..358725,358774..358776,358852..358854,
                     358882..358890,358915..358923)
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    358810..358812
                     /gene="ctaE"
                     /locus_tag="CNE_1c03640"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            complement(359260..359469)
                     /locus_tag="CNE_1c03650"
                     /db_xref="GeneID:10916756"
     CDS             complement(359260..359469)
                     /locus_tag="CNE_1c03650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684212.1"
                     /db_xref="GI:339324519"
                     /db_xref="GeneID:10916756"
                     /translation="MRIVIIVAFILIIASLASALFFMMRDRGTTPNMMRSLMLRVGFS
                     VALFLFILFSNWMGWIHSTGIRMAP"
     misc_feature    complement(359284..359469)
                     /locus_tag="CNE_1c03650"
                     /note="Protein of unknown function (DUF2909); Region:
                     DUF2909; pfam11137"
                     /db_xref="CDD:256309"
     gene            359545..360309
                     /gene="surf"
                     /locus_tag="CNE_1c03660"
                     /db_xref="GeneID:10916757"
     CDS             359545..360309
                     /gene="surf"
                     /locus_tag="CNE_1c03660"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase assembly protein, SurF"
                     /protein_id="YP_004684213.1"
                     /db_xref="GI:339324520"
                     /db_xref="GeneID:10916757"
                     /translation="MTVRRWFSPLPLAAALVVIAVTCALGNWQLNRAHDKEARAARLQ
                     ALSAQPPVLLGTAPLPQVVTDRTVRVTGRFDTARTVLLDNRPHGNGSSPGDSRAGFLV
                     LTPLRISAASPAPAGAGAMQAVLVLRGWLPRDAQDRTRIAPFPTPEGEVTIEGTALAA
                     VPRVYSLGQDAAGSKIRQNLDIAAYAAETGLALHPLVLEQRSDTGDGLARDWAPADLG
                     ADRHYGYAFQWFGLAALTVVLVAVLGWRRARRVAAP"
     misc_feature    359608..360261
                     /gene="surf"
                     /locus_tag="CNE_1c03660"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cd06662"
                     /db_xref="CDD:119401"
     gene            360315..361013
                     /gene="sco1"
                     /locus_tag="CNE_1c03670"
                     /db_xref="GeneID:10916758"
     CDS             360315..361013
                     /gene="sco1"
                     /locus_tag="CNE_1c03670"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase assembly protein, Sco1/SenC
                     family"
                     /protein_id="YP_004684214.1"
                     /db_xref="GI:339324521"
                     /db_xref="GeneID:10916758"
                     /translation="MNRAHALAEDKGQTYSMAQQDSAPAAAASPPDTRIDARTRRGRL
                     QMLMLLLVCASPVIASYFTYYVIKPRGGATNYGALVDPQRPMPPVRVTDEQGRAVPLE
                     QFRGKWLLVTADPSACDEACAKKLFTIRQIRAGQGQDRERIVPVWLVTDDGKLDERLT
                     AAYNEPYAGVRFLRIDRQAAQQWLPAEPGKRAEDTLFLVDPLGNLMMRFPQDPDPKKM
                     SGDLKKLLKVSRIG"
     misc_feature    360567..360944
                     /gene="sco1"
                     /locus_tag="CNE_1c03670"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            361024..362136
                     /gene="ctaA"
                     /locus_tag="CNE_1c03680"
                     /db_xref="GeneID:10916759"
     CDS             361024..362136
                     /gene="ctaA"
                     /locus_tag="CNE_1c03680"
                     /codon_start=1
                     /transl_table=11
                     /product="hemeA synthase CtaA"
                     /protein_id="YP_004684215.1"
                     /db_xref="GI:339324522"
                     /db_xref="GeneID:10916759"
                     /translation="MLLQLAIIGILIALFPLSYVLVKGDRNKYRKLAWITAFLTLDLI
                     MFGSFTRLTDSGLGCPDWPGCYGHSNPHAAMEPIRAAETALPSGPVTLAKAWIEMIHR
                     YFAMAVGVLIITLMVLAWVKRRELKQSPWFATGVLLLVCVQGAFGAFTVTLKLQPVIV
                     VTHLMLGMALLAVLIQLGSRNDPPHPVAAQAARLRWPVRIGLLLLVIQIFLGGWVSTN
                     YAVLACTDFPLCNGQLVPEMDFRHGFTLWRQLGMTADGDYIPHAALVAIHWVHRGFAF
                     VVLGYLAWLGLRARRLEGLARAAGWLLGTLVLQLATGMSNIVFDWPLVAAVAHNGGAA
                     LLLLLLVRLHYNTGLAGLTMRAAGAPAAVPNAARAT"
     misc_feature    361111..362025
                     /gene="ctaA"
                     /locus_tag="CNE_1c03680"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; pfam02628"
                     /db_xref="CDD:251431"
     gene            362133..363077
                     /gene="sco2"
                     /locus_tag="CNE_1c03690"
                     /db_xref="GeneID:10916760"
     CDS             362133..363077
                     /gene="sco2"
                     /locus_tag="CNE_1c03690"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase assembly protein, Sco1/SenC
                     family"
                     /protein_id="YP_004684216.1"
                     /db_xref="GI:339324523"
                     /db_xref="GeneID:10916760"
                     /translation="MKDKTPSVVTATHPHSLGKLSRIRHLARQYAALTKPRVTQLAVF
                     CAIIGMFLATPGMVPWRVLIGGAAGIWLLAGAAFAINCLVEQKIDALMRRTAWRPSAT
                     GEITTPQTLVFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVVYTILLKPATPQNI
                     VIGGLSGAMPPALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALYRRADYAKSGLP
                     MLPVTHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAGFLAYAWKMY
                     RNYSDELAQRTFRFSILYLSLLFAALLVDHYFKFVPQV"
     misc_feature    362226..363035
                     /gene="sco2"
                     /locus_tag="CNE_1c03690"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    order(362385..362387,362397..362399,362763..362765)
                     /gene="sco2"
                     /locus_tag="CNE_1c03690"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            363206..363826
                     /gene="ctaB"
                     /locus_tag="CNE_1c03700"
                     /db_xref="GeneID:10916761"
     CDS             363206..363826
                     /gene="ctaB"
                     /locus_tag="CNE_1c03700"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="YP_004684217.1"
                     /db_xref="GI:339324524"
                     /db_xref="GeneID:10916761"
                     /translation="MPRLSPASGLFAAFRRFSLLAALALAVAACGQQKASFRNVDITG
                     AADFGKDFSLTDHHGKVRTIADFKGKAVVMFFGYTHCPDVCPTTMAELKAVMEKLGPD
                     ADRVQVLFVTVDPERDTQALLAQYVPAFDARFLGLRPADEAALQKVTKDFKVFYAKVP
                     GSSPSNYTVDHSAGSYVFDPEGKLRLFIRHGQGPDPIAHDLKQLLS"
     misc_feature    363350..363775
                     /gene="ctaB"
                     /locus_tag="CNE_1c03700"
                     /note="SCO (an acronym for Synthesis of Cytochrome c
                     Oxidase) family; composed of proteins similar to Sco1, a
                     membrane-anchored protein possessing a soluble domain with
                     a TRX fold. Members of this family are required for the
                     proper assembly of cytochrome c...; Region: SCO; cd02968"
                     /db_xref="CDD:239266"
     misc_feature    order(363446..363448,363458..363460,363716..363718)
                     /gene="ctaB"
                     /locus_tag="CNE_1c03700"
                     /note="Cu(I) binding site [ion binding]; other site"
                     /db_xref="CDD:239266"
     gene            complement(363933..364859)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /db_xref="GeneID:10916762"
     CDS             complement(363933..364859)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase sigma subunit RpoH"
                     /protein_id="YP_004684218.1"
                     /db_xref="GI:339324525"
                     /db_xref="GeneID:10916762"
                     /translation="MNAVLSADQTLNNRLPTAPRSTGSFALAFPATVGNLDSYIQAVH
                     RIPLLTAEEEQRLARELRDHDSVDAARQMVMSHLRLVVSIARQYLGYGLPHADLIQEG
                     NIGLMKAVKRFDPDQGVRLVSYAMHWIKAEIHEYVLKNWRMVKVATTKAQRKLFFNLR
                     SHKQGAHTFTPEQVEAVARELNVKPEEVMEMETRLSGGDLALEGQIDDGEEEFAPIAY
                     LADNHNEPTRVLEAKRHDRMQVEGLEEALAKLDERSRRIIEARWLHVEDDGSGGSTLH
                     ELADEFGVSAERIRQIEAAAMKKMKGALQAFA"
     misc_feature    complement(363936..364799)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /note="RNA polymerase factor sigma-32; Reviewed; Region:
                     PRK06596"
                     /db_xref="CDD:235838"
     misc_feature    complement(364665..364754)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /note="Sigma-70 factor, region 1.2; Region: Sigma70_r1_2;
                     pfam00140"
                     /db_xref="CDD:249622"
     misc_feature    complement(364431..364643)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(363957..364133)
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(363969..363971,363975..363980,
                     363984..363992,363996..364001,364005..364007,
                     364035..364040,364077..364079,364107..364109))
                     /gene="rpoH"
                     /locus_tag="CNE_1c03710"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            365200..366075
                     /locus_tag="CNE_1c03720"
                     /db_xref="GeneID:10916763"
     CDS             365200..366075
                     /locus_tag="CNE_1c03720"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="YP_004684219.1"
                     /db_xref="GI:339324526"
                     /db_xref="GeneID:10916763"
                     /translation="MSAIEHLLKPHVRDLGDFTVRRLLPAAATQTVGPFIFFDHMGPV
                     QLPPGAGADVRPHPHIGLATVTYLFEGEIIHRDSLGSDQAIRPGDVNWMTAGRGIVHS
                     ERSPEHVRPAGARLHGIQTWVALPQEHEGAEPSFFHHPAATLPRIERPGVRMVVIAGD
                     AFGQISPVKVFSRTLYVAIELDAGASVEIPADHAERGIYPVDGAVALDGEPLPAEHMV
                     VLTPGQPATLTATAPSRVMLLGGDPTDGHRFIYWNFVASSKVAIEAAAQRWEDDQFPH
                     VPGETERIPLPPRKA"
     misc_feature    365200..366024
                     /locus_tag="CNE_1c03720"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    365251..365568
                     /locus_tag="CNE_1c03720"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    365725..366024
                     /locus_tag="CNE_1c03720"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            complement(366095..367087)
                     /gene="trpD1"
                     /locus_tag="CNE_1c03730"
                     /db_xref="GeneID:10916764"
     CDS             complement(366095..367087)
                     /gene="trpD1"
                     /locus_tag="CNE_1c03730"
                     /EC_number="2.4.2.18"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase TrpD"
                     /protein_id="YP_004684220.1"
                     /db_xref="GI:339324527"
                     /db_xref="GeneID:10916764"
                     /translation="MTTPATSFPAARYIKEIGRGVNGARALPRDDAQALFDAMLAGRV
                     SDLELGAILMAYRIKGEAPHELAGMLEAAHAHCQPLPAPPDRQVVVIPSYNGARKQPN
                     LVPLLALLLAREDVPVLVHGTRLFNGRVTSMTLFEALGVPLCATTDEASARLREGSDL
                     GPLAVLPVDVLSPGLSQLLERRTVIGLRNSAHTVAKMLQPVGEHSPAEGLRLYSYTHP
                     EYRETLTDYFSHEPANVLLARGTEGEVVADARRTSRIDWLHEGHQQTLVDPAVGSLAE
                     VPELPPGSDAGQTVAWIRRVLDGAAPVPAPIAIQVDAIRECLRQGTHVTWASPV"
     misc_feature    complement(366098..367066)
                     /gene="trpD1"
                     /locus_tag="CNE_1c03730"
                     /note="glycosyl transferase family protein; Provisional;
                     Region: PRK08136"
                     /db_xref="CDD:236160"
     misc_feature    complement(366872..367051)
                     /gene="trpD1"
                     /locus_tag="CNE_1c03730"
                     /note="Glycosyl transferase family, helical bundle domain;
                     Region: Glycos_trans_3N; pfam02885"
                     /db_xref="CDD:251593"
     gene            complement(367183..367986)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /db_xref="GeneID:10916765"
     CDS             complement(367183..367986)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate transport protein NasD"
                     /protein_id="YP_004684221.1"
                     /db_xref="GI:339324528"
                     /db_xref="GeneID:10916765"
                     /translation="MDKFVSIENVGQTFKTRKGPFVALRDINLQIAEGEFITLIGHSG
                     CGKSTLLNLVAGLATPTTGALICAGREIAGPGPERAVVFQNHSLLPWLTCFENVYLGV
                     ERVFAANESKPQLKARTHDTLALVGLTHAENKYPHEISGGMKQRVGIARALAMAPKVL
                     LMDEPFGALDALTRAHLQDELIKIVARTRSTVVMVTHDVDEAVLLADRIVMMTNGPAA
                     TIGEILKVGLPRPRDRVALADDKAYHACRTAVLDFLYRKQRNPALQEAA"
     misc_feature    complement(367204..367977)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    complement(367303..367974)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(367843..367866)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(367396..367398,367495..367500,
                     367735..367737,367840..367848,367852..367857))
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(367735..367746)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(367543..367572)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(367495..367512)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(367477..367488)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(367390..367410)
                     /gene="nasD"
                     /locus_tag="CNE_1c03740"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(368005..368910)
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /db_xref="GeneID:10916766"
     CDS             complement(368005..368910)
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate transport permease NrtB"
                     /protein_id="YP_004684222.1"
                     /db_xref="GI:339324529"
                     /db_xref="GeneID:10916766"
                     /translation="MNAIAHTTPDGATVAASADPDTKERARRREQEIAAQARRAQRRE
                     AVAAPVLKAVPPVLGFALFVLAWHGIATMIPAIPTPQATWNAAVPLFADPFYRNGPND
                     QGIGWNVLASLARVAAGFGLAALVGIPAGFLIGRFAFLNAMTAPVISLLRPVSPLAWL
                     PIGLLLFKAANPAAIWAIFICSIWPMVINTAVGVTRVPQDYLNVARVLDLSEWKVFTR
                     VLFPAVLPYMLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNNLKVEHIVIAIF
                     VIGIIGLLLEHALLALARRFSYGAN"
     misc_feature    complement(368065..368763)
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(368068..368577)
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(368068..368070,368077..368082,
                     368086..368091,368098..368103,368131..368136,
                     368167..368172,368179..368190,368209..368211,
                     368218..368223,368263..368265,368314..368316,
                     368323..368328,368338..368340,368344..368349,
                     368356..368358,368359..368364,368419..368421,
                     368425..368430,368437..368466,368470..368481,
                     368506..368508,368521..368526,368533..368538))
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(368173..368190,368419..368463))
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(368101..368103,368131..368133,
                     368140..368142,368170..368172,368377..368379,
                     368419..368421))
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(368242..368244,368254..368259,
                     368275..368313))
                     /gene="nrtB"
                     /locus_tag="CNE_1c03750"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(368962..370272)
                     /gene="nrtA"
                     /locus_tag="CNE_1c03760"
                     /db_xref="GeneID:10916767"
     CDS             complement(368962..370272)
                     /gene="nrtA"
                     /locus_tag="CNE_1c03760"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate transport protein NrtA"
                     /protein_id="YP_004684223.1"
                     /db_xref="GI:339324530"
                     /db_xref="GeneID:10916767"
                     /translation="MPSRLRIAKPLHAAVHVSDAAADAVPASSGRRRVLATIAGASVM
                     TLVDPLVRAGAWAAGSDAPEKTDVRIGFIPLTDCASVVMAATLGLDKKYGIKITPTKE
                     ASWAGVRDKLVNGELDAAHVLYGLIYGVQLGIGGPKKDMAVLMNLNHNGQAITLSSKL
                     AEKGVKDGASLKALMMKEKRDYTFAQTFPTGTHAMWLYYWLAANGINPMQDAKAITVP
                     PPQMVANMRVGNMDGFCVGEPWGARAIADKIGFTAETTQAIWKSHPEKTLGTTAEFVQ
                     KYPNTARAMVAAVLEASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYTNG
                     LGKTWDDPDAMKFYQDGSANYPYLSDGMWFLTQHKRWGLLKEHPDYLAVARQVNRIDV
                     YKQAAAAAQVPLPKSDMRSAKLIDGVVWDGKDPKAYADGFKIKA"
     misc_feature    complement(369139..370191)
                     /gene="nrtA"
                     /locus_tag="CNE_1c03760"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(369340..370092)
                     /gene="nrtA"
                     /locus_tag="CNE_1c03760"
                     /note="NMT1-like family; Region: NMT1_2; pfam13379"
                     /db_xref="CDD:257706"
     gene            complement(370638..371285)
                     /locus_tag="CNE_1c03770"
                     /db_xref="GeneID:10916768"
     CDS             complement(370638..371285)
                     /locus_tag="CNE_1c03770"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_004684224.1"
                     /db_xref="GI:339324531"
                     /db_xref="GeneID:10916768"
                     /translation="MTRRNPPPSPPPAAPAPPTAGGRVLRILLVRDPHDADPLNVEII
                     RGGLVSAGFTEIQIVDADLRLPDVITATQPDMLIIASESAARDTIEHVCVSTQHAPRP
                     IVLFTDNDDSQRIKAALTAGITAYIVDGLRAERVKTVLDVAYARFELDQQLRAELDAT
                     RLKLAERKVVERAKGLLMQARGLSEDEAYKRLRSMAMERGLKLVDAAQRVIDVMG"
     misc_feature    complement(370641..371225)
                     /locus_tag="CNE_1c03770"
                     /note="Response regulator with putative antiterminator
                     output domain [Signal transduction mechanisms]; Region:
                     AmiR; COG3707"
                     /db_xref="CDD:226230"
     misc_feature    complement(370653..370820)
                     /locus_tag="CNE_1c03770"
                     /note="ANTAR domain; Region: ANTAR; pfam03861"
                     /db_xref="CDD:252210"
     gene            371541..372242
                     /locus_tag="CNE_1c03780"
                     /db_xref="GeneID:10916769"
     CDS             371541..372242
                     /locus_tag="CNE_1c03780"
                     /EC_number="3.7.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetat hydroxylase"
                     /protein_id="YP_004684225.1"
                     /db_xref="GI:339324532"
                     /db_xref="GeneID:10916769"
                     /translation="MTEFVFAPPAPVGVPVRGSNASFPVRRVYCVGRNYAAHAREMGS
                     DPDREPPFFFCKPSDAVSYVADGTEGAFPYPPGTSNCHYEVELVVAIGKGGRDIPVDQ
                     AAGHVFGYAVGLDMTRRDLQNESKKTGRPWETGKAFDQSAPIGPIVPVSAIGHPEKGA
                     VTLAVNGVEKQRGDLSDLIWSVPEMVSYLSKLFELQPGDLIFSGTPEGVGPVVKGDVM
                     QCHVGGVGDLTIKVV"
     misc_feature    371541..372239
                     /locus_tag="CNE_1c03780"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    371619..372239
                     /locus_tag="CNE_1c03780"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            372247..372894
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /db_xref="GeneID:10916770"
     CDS             372247..372894
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /EC_number="5.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetoacetate isomerase MaiA"
                     /protein_id="YP_004684226.1"
                     /db_xref="GI:339324533"
                     /db_xref="GeneID:10916770"
                     /translation="MLKLYSYFRSSASFRVRIALELKGLSYDYVPVHLLKEGGQQLKP
                     EFRAVNPDGLVPAFVDGEHVLQQSLAIVEYLDEIHPEPKLLPGTALDRAYVRGLAQEI
                     ACEIHPLNNLRVLKYLKHTVGVTDEVKDAWYHHWIELGFASLQTNLERGGKAGRFCFG
                     DTPTLADICLVPQVFNAQRFNIDLARYPAIARIYETCMELPAFQKAQPKSQPDAE"
     misc_feature    372250..372474
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="GST_N family, Class Zeta subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Zeta; cd03042"
                     /db_xref="CDD:239340"
     misc_feature    372253..372891
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="maleylacetoacetate isomerase; Region: maiA;
                     TIGR01262"
                     /db_xref="CDD:233333"
     misc_feature    order(372268..372270,372286..372291,372295..372297,
                     372331..372333,372451..372453,372463..372465)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239340"
     misc_feature    order(372274..372276,372280..372282,372289..372291,
                     372367..372369,372406..372411,372445..372450)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239340"
     misc_feature    order(372406..372408,372442..372447,372451..372456,
                     372463..372465)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239340"
     misc_feature    372511..372879
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="C-terminal, alpha helical domain of Class Zeta
                     Glutathione S-transferases; Region: GST_C_Zeta; cd03191"
                     /db_xref="CDD:198300"
     misc_feature    order(372511..372516,372520..372528,372532..372537,
                     372544..372549,372553..372561,372568..372573,
                     372583..372588,372595..372600,372637..372642,
                     372649..372654,372685..372687)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198300"
     misc_feature    order(372532..372534,372544..372546,372580..372582,
                     372748..372750,372757..372759,372772..372774,
                     372781..372783)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198300"
     misc_feature    order(372565..372567,372574..372576,372580..372582,
                     372772..372774,372781..372783)
                     /gene="maiA1"
                     /locus_tag="CNE_1c03790"
                     /note="maleylacetoacetate (MAA) substrate binding site (H
                     site) [chemical binding]; other site"
                     /db_xref="CDD:198300"
     gene            complement(372967..374127)
                     /gene="ftsY"
                     /locus_tag="CNE_1c03800"
                     /db_xref="GeneID:10916771"
     CDS             complement(372967..374127)
                     /gene="ftsY"
                     /locus_tag="CNE_1c03800"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="YP_004684227.1"
                     /db_xref="GI:339324534"
                     /db_xref="GeneID:10916771"
                     /translation="MFSFWKKRKAEPAPVEAPAPAPAPVEVPAPVPAPAPTPAPVPAP
                     APAPVPAQVPPPAPAPVAAPVPVPAPAPAEALELVPPPAQTAEAKLGWMHRLRTGLSK
                     TSRNIGTLFVGVKVDEALFEELETALLMADAGVEATEYLLGELRKRVKAERIETAEGV
                     KAALRELLTQLLRPLEKTMALGREQPMVMMIAGVNGAGKTTSIGKLCKHFQRYDQKVL
                     LAAGDTFRAAAREQLTIWGERNNVTVVAQESGDPAAVIFDAVNAAKARGIDIVMADTA
                     GRLPTQLHLMEELKKVKRVISKAMPSAPHEVLLVIDANTGQNALQQTRAFDDALGLTG
                     LIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKADEFADALLG"
     misc_feature    complement(372970..373869)
                     /gene="ftsY"
                     /locus_tag="CNE_1c03800"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    complement(373624..373842)
                     /gene="ftsY"
                     /locus_tag="CNE_1c03800"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    complement(372970..373572)
                     /gene="ftsY"
                     /locus_tag="CNE_1c03800"
                     /note="SRP54-type protein, GTPase domain; Region: SRP54;
                     smart00962"
                     /db_xref="CDD:214940"
     gene            374345..375892
                     /locus_tag="CNE_1c03810"
                     /db_xref="GeneID:10916772"
     CDS             374345..375892
                     /locus_tag="CNE_1c03810"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent peptidase, M16B subfamily"
                     /protein_id="YP_004684228.1"
                     /db_xref="GI:339324535"
                     /db_xref="GeneID:10916772"
                     /translation="MNHCAVLTAAGAQGTKACVQTRIQRLSQPSNPLPARAARLARRV
                     IPTLLLALLPWSMPAGAQEAVPSPRPGTQTALAGATAQGTTEYRLSNGLRLIVKEDHR
                     APTVAHQIWYRVGGIDEVSGTTGVAHMLEHMMFKGTPKVGVGEFSKQVAALGGRENAM
                     TNRDFTMYYQQIGKQYLPRMMELEADRMANLIITKDEFEREMKVVMEERRLRTDDSAR
                     GTVYEQLLATVYTAAAYRHPVIGWMDDLVNMRVDDVKEWYRHWYVPNNAMVIVTGDVK
                     AEEVRALAERYYGKVKPRTLPLRKDQEEPAQKGIKRIWVKAPAENQYMVMAYKVPRLR
                     DIEKDVDPYALEVLSAVLNGYDNARLTRELVREQRLADDVNVGYDSINRGESLFVLDG
                     TPATGHNTDEIERALRAEVQRIAKEGVSPEELKRVKAQVVAGQIYKRDSVFGQGMEIG
                     VSEISDISWRQIDRMLDKIKAVTPAQVQAVAAKYFNDDNLTVATLVPQPIDPNKPKPQ
                     APSGLRH"
     misc_feature    374558..375853
                     /locus_tag="CNE_1c03810"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    374624..375067
                     /locus_tag="CNE_1c03810"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    375086..375637
                     /locus_tag="CNE_1c03810"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            375902..377284
                     /locus_tag="CNE_1c03820"
                     /db_xref="GeneID:10916773"
     CDS             375902..377284
                     /locus_tag="CNE_1c03820"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent peptidase"
                     /protein_id="YP_004684229.1"
                     /db_xref="GI:339324536"
                     /db_xref="GeneID:10916773"
                     /translation="MTQYVTTPQRALRKLAGAALGAVVLLAAQLAQAAIPIEHWTAST
                     GAKVFFVHSPSIPMLDVNIDFDAGSRYDPPGKAGLATLTAALLDKGAAALEGQPARDE
                     AKIADGFADTGAAFGGAAGGDRGGIGLRTLTEQPELDQSVALAAQLIKAPTYPDAVVG
                     REKQRLITAIREADAKPGVIADKALAKAMYPDHPYGVAATPDSVASITRDDIVTFWRD
                     NYGAQRAVVTLIGAVDRKQAEAIAEQLTRGLPPGSAAPAMPQVRLNIAPSEQRMPHPA
                     QQSSVAIGQPAIARGDPDYFALLVGNYVLGGGGFSSRLTDEVREKRGLTYGVDSYFAP
                     SKQPGPFGISLQTKKAQTDEALALVRQVLARFVAEGPTEKELRAAKDNLINGFPLRID
                     NNRKLLTNVANIGWYGLPLDYLDTWTAQIGKVTREQVRAAFQRHVRPDNMATVIVGGP
                     VAAPATAARQ"
     misc_feature    376004..377245
                     /locus_tag="CNE_1c03820"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    376517..377050
                     /locus_tag="CNE_1c03820"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            377367..378071
                     /gene="rsmD"
                     /locus_tag="CNE_1c03830"
                     /db_xref="GeneID:10916774"
     CDS             377367..378071
                     /gene="rsmD"
                     /locus_tag="CNE_1c03830"
                     /EC_number="2.1.1.171"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase D"
                     /protein_id="YP_004684230.1"
                     /db_xref="GI:339324537"
                     /db_xref="GeneID:10916774"
                     /translation="MNSRSRLPTPATGGRPASPAAASGGRSPVSAAPRQAPRQAPRQE
                     PSQVRIIGGRWKRTLLPVPDAQGLRPTPDRVRETLFNWLGQDLSGLECLDLFAGSGAL
                     GFEAASRGAAAVTLVESNARVAKQLRDNQYRLDAAQVRVMQGDAFAIAAQLPDASFDV
                     VFLDPPFAEDWIGPALEHAARLSRPGGAVYVETDHALTGADAPVPASLEIVRHARAGA
                     VHFHLLQHRVPGNGAA"
     misc_feature    377628..378053
                     /gene="rsmD"
                     /locus_tag="CNE_1c03830"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    377643..377954
                     /gene="rsmD"
                     /locus_tag="CNE_1c03830"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(377649..377669,377718..377723,377796..377804,
                     377856..377858)
                     /gene="rsmD"
                     /locus_tag="CNE_1c03830"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            378312..378797
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /db_xref="GeneID:10916775"
     CDS             378312..378797
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /EC_number="2.7.7.3"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase CoaD"
                     /protein_id="YP_004684231.1"
                     /db_xref="GI:339324538"
                     /db_xref="GeneID:10916775"
                     /translation="MVIAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPF
                     FSLEERIGIAREVLGHYPNVRVEGFSGLLKDFVRNNNARVIVRGLRAVSDFEYEFQMA
                     GMNRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIGKP
                     E"
     misc_feature    378312..378788
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /note="phosphopantetheine adenylyltransferase;
                     Provisional; Region: coaD; PRK00168"
                     /db_xref="CDD:234674"
     misc_feature    378318..378776
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /note="Phosphopantetheine adenylyltransferase; Region:
                     PPAT; cd02163"
                     /db_xref="CDD:173914"
     misc_feature    order(378327..378341,378357..378362,378369..378371,
                     378417..378419,378432..378434,378522..378530,
                     378570..378575,378579..378581,378600..378605,
                     378612..378614,378624..378626,378666..378668,
                     378678..378680,378687..378689)
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /note="active site"
                     /db_xref="CDD:173914"
     misc_feature    378351..378362
                     /gene="coaD"
                     /locus_tag="CNE_1c03840"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:173914"
     gene            378866..379126
                     /gene="fdx1"
                     /locus_tag="CNE_1c03850"
                     /db_xref="GeneID:10916776"
     CDS             378866..379126
                     /gene="fdx1"
                     /locus_tag="CNE_1c03850"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_004684232.1"
                     /db_xref="GI:339324539"
                     /db_xref="GeneID:10916776"
                     /translation="MALMITDDCINCDVCEPECPNEAISMGPEIYEIDPNKCTECVGH
                     FDEPQCQQVCPVACIPKDPNRVETHEVLMQRYRLLTAAKHAA"
     misc_feature    378890..379033
                     /gene="fdx1"
                     /locus_tag="CNE_1c03850"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:221801"
     gene            complement(379228..381081)
                     /gene="rfbB1"
                     /locus_tag="CNE_1c03860"
                     /db_xref="GeneID:10916777"
     CDS             complement(379228..381081)
                     /gene="rfbB1"
                     /locus_tag="CNE_1c03860"
                     /EC_number="4.2.1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-D-glucose 4,6-dehydratase RfbB"
                     /protein_id="YP_004684233.1"
                     /db_xref="GI:339324540"
                     /db_xref="GeneID:10916777"
                     /translation="MSYLTDEARAASRAAKPDVEVPGQMLEDIVAANPARRRVLRGGL
                     GLSLASAFGSGLLAACGGDADPAPAPAPAPAPAPAPAPAAVAPSYDVTFEPIAKSTAD
                     TVVVPNGYSVDVLFSAGDPVEAGATGYAGAFQSSAETERQAGGNHDGMHYFALPGVDP
                     QKGGLLAINHELPDYNILFPTAYNAATASAEQKRIALSAVGISVIEVELAVSGKWQVK
                     RDSIYNKRYTGNTLYRVGGPAASVVGSTVVGMLNNCSSGYTPWGTYLTCEESTDNYID
                     PTQAENGYGWVVEIDPYGTLGAPAKRTAMGRFDHENVAFLTDASNNVAFYMGDDGTPG
                     CIYKFIPSKAFDPNNRAANANLLDSGTLYVARFNADGSGQWIELTQGKNGLTVGASDP
                     GNWTQSAVSPAPSTVDFTSQADVLINTKSAARVAGGTLMDRPEWITAAPDKTLYCTLT
                     NNSGRQQTDAANPRKNNLHGHIVKWNEAGNSPLATTFTWSILLQAGDPSLATDNLKGN
                     INGDTFSSPDGLRVDPKGRLWVQTDSSTSATYTGTFGNNSMYYISPTGQSRRFLAGPT
                     GCEITGIAYTPDLTTCFINIQHPTGKWPDAAKPPRSSTIVVRRSDGKPMGA"
     misc_feature    complement(379231..381000)
                     /gene="rfbB1"
                     /locus_tag="CNE_1c03860"
                     /note="Predicted phosphatase [General function prediction
                     only]; Region: PhoX; COG3211"
                     /db_xref="CDD:225752"
     misc_feature    complement(379315..380805)
                     /gene="rfbB1"
                     /locus_tag="CNE_1c03860"
                     /note="Bacterial protein of unknown function (DUF839);
                     Region: DUF839; pfam05787"
                     /db_xref="CDD:253386"
     gene            complement(381277..381873)
                     /gene="pth1"
                     /locus_tag="CNE_1c03870"
                     /db_xref="GeneID:10916778"
     CDS             complement(381277..381873)
                     /gene="pth1"
                     /locus_tag="CNE_1c03870"
                     /EC_number="3.1.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase Pth"
                     /protein_id="YP_004684234.1"
                     /db_xref="GI:339324541"
                     /db_xref="GeneID:10916778"
                     /translation="MIKLIVGLGNPGAEYEATRHNAGFWLVDQLARMGGATMRVEGRF
                     HGLAARARLWDQDIWLLKPSTFMNRSGLAVVSLARFYKVLPDEIVVAHDEMDLPAGAA
                     KLKRGGGAGGHNGLKDISAHLSTQDYWRLRLGVGHPRNAPGGAGAGREDVVNFVLKPP
                     RREEQEAIDAAIDRCIDPLGLLARGDAERAMAQLHTTR"
     misc_feature    complement(381343..381864)
                     /gene="pth1"
                     /locus_tag="CNE_1c03870"
                     /note="Peptidyl-tRNA hydrolase (PTH) is a monomeric
                     protein that cleaves the ester bond linking the nascent
                     peptide and tRNA when peptidyl-tRNA is released
                     prematurely from the ribosome. This ensures the recycling
                     of peptidyl-tRNAs into tRNAs produced through...; Region:
                     PTH; cd00462"
                     /db_xref="CDD:238259"
     misc_feature    complement(order(381535..381537,381595..381597,
                     381673..381678,381814..381816,381844..381846))
                     /gene="pth1"
                     /locus_tag="CNE_1c03870"
                     /note="putative active site [active]"
                     /db_xref="CDD:238259"
     misc_feature    complement(381814..381816)
                     /gene="pth1"
                     /locus_tag="CNE_1c03870"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238259"
     gene            complement(382025..382642)
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /db_xref="GeneID:10916779"
     CDS             complement(382025..382642)
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="YP_004684235.1"
                     /db_xref="GI:339324542"
                     /db_xref="GeneID:10916779"
                     /translation="MKVVAFERSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHN
                     ALWHALKKEAFHSSILELEVAGKSEQALLRAFQMHPFKPLVLHVDFQRVSANDKIHVK
                     VPLHFMNQETAPGVKLGHGIVNHIVNDLEVSCLPADLPEFIEVDLAAAELNQTLHLSD
                     IKLPKGVTVITHGDDNPAIASISQPAGAVSEAAEGGEAAGETPAA"
     misc_feature    complement(382073..382642)
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="50S ribosomal protein L25/general stress protein
                     Ctc; Reviewed; Region: PRK05618"
                     /db_xref="CDD:235534"
     misc_feature    complement(382367..382639)
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding
                     domain; Region: Ribosomal_L25_TL5_CTC; cd00495"
                     /db_xref="CDD:198379"
     misc_feature    complement(order(382370..382372,382376..382378,
                     382382..382384,382412..382414,382418..382423,
                     382535..382537,382547..382555,382583..382585,
                     382589..382597,382619..382621))
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:198379"
     misc_feature    complement(order(382367..382372,382421..382423,
                     382433..382435,382469..382471,382547..382549))
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="CTC domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198379"
     misc_feature    complement(order(382370..382372,382394..382396,
                     382415..382417,382424..382429))
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="L16 interface [polypeptide binding]; other site"
                     /db_xref="CDD:198379"
     misc_feature    complement(382079..382351)
                     /gene="rplY"
                     /locus_tag="CNE_1c03880"
                     /note="Ribosomal protein TL5, C-terminal domain; Region:
                     Ribosomal_TL5_C; pfam14693"
                     /db_xref="CDD:258831"
     gene            complement(382775..383728)
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /db_xref="GeneID:10916780"
     CDS             complement(382775..383728)
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase Prs"
                     /protein_id="YP_004684236.1"
                     /db_xref="GI:339324543"
                     /db_xref="GeneID:10916780"
                     /translation="MSSEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQV
                     DIQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALKRASARSITAAMPYFGYARQDRR
                     PRSARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRE
                     KNYGDLLVVSPDVGGVVRARALAKELNCDLAIIDKRRPKANVAEVMNIIGEVDGRNCV
                     IMDDMIDTGGTLCKAAQVLKERGALKVFAYCTHPVLSGGAAARIADSALDEVVVCDTI
                     PLSEEAAKCTKIRQLSTAPLLAETFTRIVKGDSIMSLFAGS"
     misc_feature    complement(382784..383713)
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK01259"
                     /db_xref="CDD:234929"
     misc_feature    complement(383360..383713)
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:222383"
     misc_feature    complement(382904..383281)
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(382970..382972,383042..383056,
                     383060..383068,383207..383209,383213..383215))
                     /gene="prs"
                     /locus_tag="CNE_1c03890"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(383823..383899)
                     /gene="trnQ"
                     /locus_tag="CNE_1c03900"
                     /note="tRNA-Gln-TTG"
                     /db_xref="GeneID:10916781"
     tRNA            complement(383823..383899)
                     /gene="trnQ"
                     /locus_tag="CNE_1c03900"
                     /product="tRNA-Gln"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:10916781"
     gene            complement(383959..384837)
                     /gene="ispE"
                     /locus_tag="CNE_1c03910"
                     /db_xref="GeneID:10916782"
     CDS             complement(383959..384837)
                     /gene="ispE"
                     /locus_tag="CNE_1c03910"
                     /EC_number="2.7.1.148"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="YP_004684237.1"
                     /db_xref="GI:339324544"
                     /db_xref="GeneID:10916782"
                     /translation="MHRSQPLPPPELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQL
                     VDWCDTLHFRRRDDGLIARVTDVPGVPADTDLTVRAARALQAASGTAFGADIAIDKVL
                     PMGGGIGGGSSDAATTLLALNHLWGLGLARAELMRIGLALGADVPVFVLGQNAFAQGI
                     GEDLTPVELPDSWFVVIHPKQHVPTAEIFSDECLTRDTPLSIIAVFAARTNKFDFGRN
                     DLEPIATAKFGEVARALAWLKQHNQHARMTGSGACVFARFPDAATAQQVLERLPPEWD
                     GRCVRSLARHPLAALA"
     misc_feature    complement(383989..384816)
                     /gene="ispE"
                     /locus_tag="CNE_1c03910"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Provisional; Region: ipk; PRK00343"
                     /db_xref="CDD:234731"
     misc_feature    complement(384382..384555)
                     /gene="ispE"
                     /locus_tag="CNE_1c03910"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     misc_feature    complement(384022..>384150)
                     /gene="ispE"
                     /locus_tag="CNE_1c03910"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:254869"
     gene            complement(384846..385439)
                     /gene="lolB"
                     /locus_tag="CNE_1c03920"
                     /db_xref="GeneID:10916783"
     CDS             complement(384846..385439)
                     /gene="lolB"
                     /locus_tag="CNE_1c03920"
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoprotein LolB"
                     /protein_id="YP_004684238.1"
                     /db_xref="GI:339324545"
                     /db_xref="GeneID:10916783"
                     /translation="MNRSRRLALLCLGAPLLLQACASVAPSRSFDGDQAAASQQYTGR
                     FSANYVRYGRDEGVQGSFRWEEQGRNVRLDLVSPLGQTLAVVTATPSGATLDLPNQPP
                     RNAPEVDTLMEEALGFALPVSGMRDWLHGRATKGAPARTTRDEQGRLATLAQNGWTVR
                     YVAWQEAAAQVPRRIDLARDAGSNPLSVRLVIDPQTP"
     misc_feature    complement(384849..>385340)
                     /gene="lolB"
                     /locus_tag="CNE_1c03920"
                     /note="outer membrane lipoprotein LolB; Provisional;
                     Region: lolB; PRK00022"
                     /db_xref="CDD:234578"
     gene            complement(385532..387490)
                     /locus_tag="CNE_1c03930"
                     /db_xref="GeneID:10916784"
     CDS             complement(385532..387490)
                     /locus_tag="CNE_1c03930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684239.1"
                     /db_xref="GI:339324546"
                     /db_xref="GeneID:10916784"
                     /translation="MSDLMPDLMPDSTLQATAGGLPIAFPGAVPRTARTAGALARFFQ
                     APRRHARALAASALLALAAGASHAAPPAGAMPLPSALQLAAAESERPAAASKPARSAL
                     PSLELTDDIVYMVLAAEISMQRGLVGPAYRTYMELARQTRDPRFAQRATEIAFNARIP
                     QQALDSARLWKEISPTSPAANQVLSTLLVLNGRWDDARPLLQQQLAAVPATHRGEAIL
                     QLQQQLSRTSDPAGAATLLQDLTKNDTKLPETQLALARAREVAGDEPGALAALDQALR
                     LRPDYEAAALMAAELRAEKQPDEAVAILKRFLDKSPDSVNGHITLARLYLLRNDMQSA
                     RQEFETLRKVAPGDPRVPLALGLTSLQAKNYGEAEQYLKEYLQLVEKQPTANPDIAYQ
                     YLAQIAEERKDYAGAIQWLDRIEDIRLAPAATAKRAQLLARMGKLDDAQALFGEMLTD
                     AEDIPDPGQRTQRVTAIRQAEVATLMESKAYDRARKLLNDRVTAEPDNADWIYELAML
                     DERQKRYDSMEKGLRKVIALQPQQKQGYNALGYSLADRNERLPEALKLLERASELGPD
                     DPYIMDSLAWVKFRMGDLRPAADLLRNAYSKAPEAEIGAHLGEVLWQLGEHDEARKTW
                     TEAVRTDPENETLVDTLRRYKVNMQLSK"
     misc_feature    complement(<386648..>387073)
                     /locus_tag="CNE_1c03930"
                     /note="Uncharacterized protein conserved in bacteria
                     containing a divergent form of TPR repeats [Function
                     unknown]; Region: COG4700"
                     /db_xref="CDD:227044"
     misc_feature    complement(385793..386611)
                     /locus_tag="CNE_1c03930"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    complement(386357..386611)
                     /locus_tag="CNE_1c03930"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(386366..386368,386375..386377,
                     386387..386389,386423..386425,386468..386470,
                     386477..386479,386489..386491,386525..386527,
                     386570..386572,386579..386581,386591..386593))
                     /locus_tag="CNE_1c03930"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(386405..386410,386417..386422,
                     386429..386434,386510..386515,386522..386527,
                     386531..386536))
                     /locus_tag="CNE_1c03930"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(386153..386434)
                     /locus_tag="CNE_1c03930"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(386189..386194,386201..386206,
                     386213..386218,386291..386296,386303..386308,
                     386312..386317,386417..386422,386429..386434))
                     /locus_tag="CNE_1c03930"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(386159..386161,386171..386173,
                     386207..386209,386249..386251,386258..386260,
                     386270..386272,386306..386308,386366..386368,
                     386375..386377,386387..386389,386423..386425))
                     /locus_tag="CNE_1c03930"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(385793..386071)
                     /locus_tag="CNE_1c03930"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(385853..385858,385865..385870,
                     385877..385882,385958..385963,385970..385975,
                     385979..385984,386069..386071))
                     /locus_tag="CNE_1c03930"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(385811..385813,385820..385822,
                     385832..385834,385871..385873,385916..385918,
                     385925..385927,385937..385939,385973..385975,
                     386018..386020,386027..386029,386039..386041))
                     /locus_tag="CNE_1c03930"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(385592..385885)
                     /locus_tag="CNE_1c03930"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(385649..385654,385661..385666,
                     385673..385678,385751..385756,385763..385768,
                     385772..385777,385865..385870,385877..385882))
                     /locus_tag="CNE_1c03930"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(385610..385612,385619..385621,
                     385631..385633,385667..385669,385709..385711,
                     385718..385720,385730..385732,385766..385768,
                     385811..385813,385820..385822,385832..385834,
                     385871..385873))
                     /locus_tag="CNE_1c03930"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(385622..385852)
                     /locus_tag="CNE_1c03930"
                     /note="Anaphase-promoting complex, cyclosome, subunit 3;
                     Region: Apc3; pfam12895"
                     /db_xref="CDD:257383"
     gene            387644..388522
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /db_xref="GeneID:10916785"
     CDS             387644..388522
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /EC_number="3.2.2.23"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase MutM"
                     /protein_id="YP_004684240.1"
                     /db_xref="GI:339324547"
                     /db_xref="GeneID:10916785"
                     /translation="MPELPEVEVTRRGLLPHVVGRRIAAVTVRHRGLRWPVDPELEMR
                     LAQRVVRRIERRGKYLLLECVSEAAGESAGWLLVHLGMTGTLRVLPDAPPPGAHDHLD
                     LLLAPAPGAALGTQPGTIVLRFRDPRRFGAILWSTLPEAELPSHPLLRTLGIEPFDPA
                     FDGAWLHRHTRGRSAAIKTVLLAGGIVVGVGNIYASESLFRAGIRPTTPAGRLSRARC
                     DRLAQAVRETLAQAIERGGSTLRDFVGSDGASGYFQLDCLVYDRAGQPCRVCATPVRQ
                     IVQGQRSTFYCPNCQH"
     misc_feature    387644..388519
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase; Validated; Region:
                     PRK01103"
                     /db_xref="CDD:234899"
     misc_feature    387647..388054
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="N-terminal domain of Escherichia coli Fpg1/MutM and
                     related bacterial DNA glycosylases; Region: EcFpg-like_N;
                     cd08966"
                     /db_xref="CDD:176800"
     misc_feature    order(387647..387652,387815..387817,387878..387880,
                     387884..387892,387932..387937,388022..388033)
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176800"
     misc_feature    387647..387649
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176800"
     misc_feature    order(387650..387661,387665..387670,387677..387679,
                     387806..387817,387890..387892)
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="H2TH interface [polypeptide binding]; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(387650..387652,387815..387817)
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176800"
     misc_feature    387878..387880
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="turnover-facilitating residue; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(387887..387889,388025..388027,388031..388033)
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="intercalation triad [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    387890..387892
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="8OG recognition residue [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    order(387935..387937,388028..388030)
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="putative reading head residues; other site"
                     /db_xref="CDD:176800"
     misc_feature    388097..388375
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="Formamidopyrimidine-DNA glycosylase H2TH domain;
                     Region: H2TH; pfam06831"
                     /db_xref="CDD:115485"
     misc_feature    388433..388519
                     /gene="mutM"
                     /locus_tag="CNE_1c03940"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            388805..390757
                     /locus_tag="CNE_1c03950"
                     /db_xref="GeneID:10916786"
     CDS             388805..390757
                     /locus_tag="CNE_1c03950"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="YP_004684241.1"
                     /db_xref="GI:339324548"
                     /db_xref="GeneID:10916786"
                     /translation="MTTLAHQFEQYGAWRTGVLQSLAEFQSWLQQHDLYDAQADDRVQ
                     RIQSVLRSDRLKVAFIAEFSRGKSELINAIFFADYGRRILPSSAGRTTMCPTELRYDE
                     AEPPCIRLLPIETRLQEASTADFLEAGTSASHWHSVPLDPSSPEGMLAAFQHVVQTVR
                     VPPAQAEALGLYHENDPDAAYAVDAEGMVEISRWRHAVINFPHPLLRQGLVILDTPGL
                     NAIGTEPELTLRLIPDAHVVVFVLAADAGVTKSDLELWRSHVGAGHRRGCLAVLNKID
                     GLWDPLREPGEIAQEIARQVSTTGQVLGIEQSRVYPVSAQKGLVAKVTHDDELLARSG
                     LPEFEHVLSDQLIPRRREIVSDQAHRLVQDMARAAQQLLQTRRRDIVEQLFELRGLRG
                     KNHAMVKHMLMRVQGEKEEFEQSISKFQALRLVFGRHSADIIKSLQLRDVRLTMRSAR
                     EQMKERFFSRGLREDMDALFAQLTRLVTDADNKISQLHQLIESMYRRFNAEHGFTLPA
                     PMQFTAERYVAELEETLRLVHAHFGTVSMLTRSRPQLVQSAFSTMASRVLENFRDLNR
                     DIEVWLKSVMTPLEAQVREHQKQLRRRVDSIERIHEATDTLESRIAELEEVLNGLDER
                     SGRIEGYAQRLLRPTAAADSASLAVA"
     misc_feature    388967..389842
                     /locus_tag="CNE_1c03950"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cl17170"
                     /db_xref="CDD:266525"
     misc_feature    388985..389008
                     /locus_tag="CNE_1c03950"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(388991..389011,389453..389455,389621..389626,
                     389630..389632,389744..389752)
                     /locus_tag="CNE_1c03950"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    389078..389080
                     /locus_tag="CNE_1c03950"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    389090..389098
                     /locus_tag="CNE_1c03950"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    389444..389455
                     /locus_tag="CNE_1c03950"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(389450..389455,389510..389515)
                     /locus_tag="CNE_1c03950"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    389621..389632
                     /locus_tag="CNE_1c03950"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    389744..389752
                     /locus_tag="CNE_1c03950"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     gene            390857..392035
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /db_xref="GeneID:10916787"
     CDS             390857..392035
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /EC_number="3.2.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="YP_004684242.1"
                     /db_xref="GI:339324549"
                     /db_xref="GeneID:10916787"
                     /translation="MPRKPAPRAVPAIPDDIRVPPDFGARVVDWQRQHGRHDLPWQNT
                     RDPYRIWLSEIMLQQTQVSAVIDYFQRFVSQLPTVQALAAAPADQVMALWAGLGYYSR
                     ARNLHRCAMQVVSEHGGRFPTDPALLATLPGIGRSTAAAIAAFSAGVRSPILDGNVKR
                     VFARCFGIHGHPGERVVETRMWQLAELALPAAGPRQAEDMIAYTQGLMDLGATVCSRG
                     KPACLADAGACPLSADCVARRDGLTGVLPTPKPRAAIPERSTVMLLVRRQREVLLRLR
                     PGSGIWGGLWSLPEMPVDSVPFDAEVAEAAALDYARAFGKPARAALTGELTHVFTHFR
                     LLIRAIRVDVSADGASLMAQDSAAEAAQRWISLDDLDAVGTPAPVRRLLEDQARGGLF
                     "
     misc_feature    390920..392008
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="A/G-specific DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: MutY; COG1194"
                     /db_xref="CDD:224115"
     misc_feature    390998..391489
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(391031..391039,391046..391048,391160..391162)
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    391247..391270
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(391277..391279,391466..391468,391478..391480)
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    391319..391321
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    391625..392008
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="DNA glycosylase (MutY in bacteria and hMYH in
                     humans) is responsible for repairing misread  A*oxoG
                     residues to C*G by removing the inappropriately paired
                     adenine base from the DNA backbone. It belongs to the
                     Nudix hydrolase superfamily and is important...; Region:
                     DNA_Glycosylase_C; cd03431"
                     /db_xref="CDD:239523"
     misc_feature    order(391694..391702,391838..391840,391847..391852)
                     /gene="mutY"
                     /locus_tag="CNE_1c03960"
                     /note="DNA binding and oxoG recognition site [nucleotide
                     binding]"
                     /db_xref="CDD:239523"
     gene            complement(392059..392718)
                     /locus_tag="CNE_1c03970"
                     /db_xref="GeneID:10916788"
     CDS             complement(392059..392718)
                     /locus_tag="CNE_1c03970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684243.1"
                     /db_xref="GI:339324550"
                     /db_xref="GeneID:10916788"
                     /translation="MSSTDLYRPTGSEVPPRTLDNLPLFPLHTVLFPGGRLPLRVFEA
                     RYVDMVRNCLRDNTPFGVCLIESGEEVARPDQPTVPELVGCLAEIVDCNMEQLGVLLI
                     RARGRERFHIVSHDTRDDGLLVARAEVLPPDIIDCKLELLGECLDALRRIVTRLHAEH
                     PDRLPFDEPYLWDDPSWVANRLCELLPVPLKAKQMLMALPDAGMRIEIVHRYMRQNHM
                     L"
     misc_feature    complement(392074..392655)
                     /locus_tag="CNE_1c03970"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; cl19481"
                     /db_xref="CDD:267834"
     gene            complement(392810..393694)
                     /locus_tag="CNE_1c03980"
                     /db_xref="GeneID:10916789"
     CDS             complement(392810..393694)
                     /locus_tag="CNE_1c03980"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="P-loop-containing kinase"
                     /protein_id="YP_004684244.1"
                     /db_xref="GI:339324551"
                     /db_xref="GeneID:10916789"
                     /translation="MRIILITGISGSGKSVALNVLEDAGYYCVDNLPAQFIPELTRYL
                     DSQGYTHLGVATDIRSRESLDQLPDTVRALAAEHQVEVVFLTASTDALVQRYSETRRR
                     HPLSVRTDGMPGPGVEPAFNDTALMEAIEMERALLSPLAEAAHRIDTSNVRTNTLRSW
                     IKELIRDDSQRLTLLFESFGFKHGVPSDADMVFDVRSLPNPYYDLALRPLTGRDTPVI
                     DFLQAQPMVLAMAEDIRAYVEKWLPSFIADNRSYLTVAIGCTGGQHRSVYITERLANY
                     FRAHGNVLVRHRELAPAG"
     misc_feature    complement(392822..393694)
                     /locus_tag="CNE_1c03980"
                     /note="glmZ(sRNA)-inactivating NTPase; Provisional;
                     Region: PRK05416"
                     /db_xref="CDD:235450"
     gene            complement(393812..394204)
                     /locus_tag="CNE_1c03990"
                     /db_xref="GeneID:10916790"
     CDS             complement(393812..394204)
                     /locus_tag="CNE_1c03990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684245.1"
                     /db_xref="GI:339324552"
                     /db_xref="GeneID:10916790"
                     /translation="MKKLIAMCALVTPMIAASAFAQTTATPATPATPAKPAATAPATP
                     AMPATPATPATPDKPAANAQQDKMKACNTQAAGKKGDERKAFMKECLSKGASKTQQEK
                     MASCSKSGKGKKGDEYKAYMKECLSKAA"
     misc_feature    complement(393929..394027)
                     /locus_tag="CNE_1c03990"
                     /note="psiF repeat; Region: PsiF_repeat; pfam07769"
                     /db_xref="CDD:254417"
     misc_feature    complement(393824..393922)
                     /locus_tag="CNE_1c03990"
                     /note="psiF repeat; Region: PsiF_repeat; pfam07769"
                     /db_xref="CDD:254417"
     gene            complement(394367..395338)
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /db_xref="GeneID:10916791"
     CDS             complement(394367..395338)
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /EC_number="2.7.11.-"
                     /EC_number="2.7.4.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase/phosphorylase 4"
                     /protein_id="YP_004684246.1"
                     /db_xref="GI:339324553"
                     /db_xref="GeneID:10916791"
                     /translation="MELTGVTSQSIFDDNAADIKLSWVAGLEGADRAFDVEFAREATS
                     AADLVGHLNLIHPNRIQVLGKPEITYYQRLDDETRKRQMGELILLEPPFLVIADGMEP
                     PPDLELRCTRSSTPLFTTPVSSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIM
                     GESGLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLD
                     IKTIFGETAVRRKMKIKLVVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGR
                     NLAVLVEAAVRNTILRLRGIDTLRDFMDRQRAAMQADAVSRGQGRLL"
     misc_feature    complement(394406..395329)
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="HPr kinase/phosphorylase; Provisional; Region:
                     PRK05428"
                     /db_xref="CDD:235459"
     misc_feature    complement(394931..395287)
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="HPr Serine kinase N terminus; Region: Hpr_kinase_N;
                     pfam02603"
                     /db_xref="CDD:190362"
     misc_feature    complement(394475..394918)
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="HprK/P, the bifunctional histidine-containing
                     protein kinase/phosphatase, controls the phosphorylation
                     state of the phosphocarrier protein HPr and regulates the
                     utilization of carbon sources by gram-positive bacteria.
                     It catalyzes both the ATP-dependent...; Region: HprK_C;
                     cd01918"
                     /db_xref="CDD:238899"
     misc_feature    complement(order(394490..394492,394499..394501,
                     394532..394534,394583..394591,394676..394678,
                     394691..394699,394709..394711,394727..394729,
                     394775..394777,394781..394786,394811..394813,
                     394823..394825,394838..394840,394847..394852,
                     394901..394903,394907..394909))
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="Hpr binding site; other site"
                     /db_xref="CDD:238899"
     misc_feature    complement(order(394703..394705,394709..394711,
                     394784..394789,394835..394843,394847..394849,
                     394901..394903))
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="active site"
                     /db_xref="CDD:238899"
     misc_feature    complement(order(394478..394480,394484..394489,
                     394535..394537,394670..394678,394685..394693,
                     394697..394699,394715..394717,394727..394729,
                     394799..394801,394808..394813,394823..394825,
                     394829..394831))
                     /gene="hprK"
                     /locus_tag="CNE_1c04000"
                     /note="homohexamer subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238899"
     gene            complement(395419..395874)
                     /locus_tag="CNE_1c04010"
                     /db_xref="GeneID:10916792"
     CDS             complement(395419..395874)
                     /locus_tag="CNE_1c04010"
                     /EC_number="2.7.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system
                     mannitol/fructose-specific IIA protein"
                     /protein_id="YP_004684247.1"
                     /db_xref="GI:339324554"
                     /db_xref="GeneID:10916792"
                     /translation="MNRLAKLLPPGNITLDVSVTSKKRVFEQAGLLFENNHGVARAIV
                     TDNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLAEPIPFESPDGKPVSLLIF
                     LLVPEQATQQHLEILSEIAQLLSDRDMREGLATLPTPDAVHQLLIAWHP"
     misc_feature    complement(395437..395853)
                     /locus_tag="CNE_1c04010"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(395674..395676,395722..395724))
                     /locus_tag="CNE_1c04010"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(395674..395676)
                     /locus_tag="CNE_1c04010"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(396330..396680)
                     /locus_tag="CNE_1c04020"
                     /db_xref="GeneID:10916793"
     CDS             complement(396330..396680)
                     /locus_tag="CNE_1c04020"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma(54) modulation protein"
                     /protein_id="YP_004684248.1"
                     /db_xref="GI:339324555"
                     /db_xref="GeneID:10916793"
                     /translation="MNFKISGHHLDITPPLREYVETKLERIVRHFDQVIGVSVLLSVD
                     NHKEKDRRQYAEINLHLKGKDIFVEAHHEDLYAAIDALVDKLDRQVIRYKDRVQGHDR
                     EAVKYQMAAAQMQQ"
     misc_feature    complement(396393..396677)
                     /locus_tag="CNE_1c04020"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    complement(order(396393..396395,396405..396410,
                     396450..396452,396459..396461,396465..396467,
                     396474..396476,396480..396482,396489..396500,
                     396507..396509,396549..396551,396561..396563,
                     396573..396578,396594..396596,396603..396605,
                     396657..396659,396663..396665,396669..396671))
                     /locus_tag="CNE_1c04020"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            complement(396729..398210)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /db_xref="GeneID:10916794"
     CDS             complement(396729..398210)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor RpoN"
                     /protein_id="YP_004684249.1"
                     /db_xref="GI:339324556"
                     /db_xref="GeneID:10916794"
                     /translation="MKPSLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVEQALTEN
                     PLLERENDWIESPLRVAADGSVNLQSAPAPAPAEPQGNGEARADGAGDDDSYGDSGNG
                     DDYGSGDWSLDDFARRPQGDEDEKTPMQLREAEPTLREYLMEQLTPLKISARDKGLAI
                     FLIESLDDDGYLSASLEEICTELPEELEFEIDEVHAILTLLQSFDPPGVGARNAAECL
                     ALQLRRLTHPQRELALNIVSNHLELLAVRDYTRLKKALQVDEVALKSAHELIRSLAPY
                     PGHAYSRPEADFVVPDVFVRKGGGGWIAQLNPDVMPRLRINDMYAQILRGAKGESGTA
                     GLQQKLQEARWLIKNIQQRFDTILRVSQAIVERQKNFFSHGEIAMRPLVLREIADTLG
                     LHESTISRVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLIGAEDP
                     RNPLSDSRIAELLGEQGFVVARRTVAKYREALKIPAVNLRKSL"
     misc_feature    complement(396732..398210)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /note="RNA polymerase factor sigma-54; Reviewed; Region:
                     PRK05932"
                     /db_xref="CDD:235648"
     misc_feature    complement(398061..398204)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /note="Sigma-54 factor, Activator interacting domain
                     (AID); Region: Sigma54_AID; pfam00309"
                     /db_xref="CDD:249760"
     misc_feature    complement(397248..397847)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /note="Sigma-54 factor, core binding domain; Region:
                     Sigma54_CBD; pfam04963"
                     /db_xref="CDD:252909"
     misc_feature    complement(396735..397214)
                     /gene="rpoN"
                     /locus_tag="CNE_1c04030"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:252667"
     gene            complement(398346..399146)
                     /locus_tag="CNE_1c04040"
                     /db_xref="GeneID:10916795"
     CDS             complement(398346..399146)
                     /locus_tag="CNE_1c04040"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004684250.1"
                     /db_xref="GI:339324557"
                     /db_xref="GeneID:10916795"
                     /translation="MTDTATIADKPSVEASTVLPGGSTLVVRHLKKRYGSRTVVKDVS
                     LDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDEGDIVLDGDHISGLPIHERARMGLS
                     YLPQEASVFRKLNVEENIRAVLELQVSNGKPLPKTEIERRLDSLLDDLQIAHLRNNPA
                     LSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQRIVSFLKARNIGVLIT
                     DHNVRETLGICDHAYIISEGTVLAAGQPEEIIANDAVRRVYLGENFRM"
     misc_feature    complement(398349..399080)
                     /locus_tag="CNE_1c04040"
                     /note="ABC-type (unclassified) transport system, ATPase
                     component [General function prediction only]; Region:
                     YhbG; COG1137"
                     /db_xref="CDD:224060"
     misc_feature    complement(398364..399074)
                     /locus_tag="CNE_1c04040"
                     /note="ATP-binding cassette component of YhbG transport
                     system; Region: ABC_YhbG; cd03218"
                     /db_xref="CDD:213185"
     misc_feature    complement(398955..398978)
                     /locus_tag="CNE_1c04040"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(order(398487..398489,398583..398588,
                     398829..398831,398952..398960,398964..398969))
                     /locus_tag="CNE_1c04040"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(398829..398840)
                     /locus_tag="CNE_1c04040"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(398631..398660)
                     /locus_tag="CNE_1c04040"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(398583..398600)
                     /locus_tag="CNE_1c04040"
                     /note="Walker B; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(398565..398576)
                     /locus_tag="CNE_1c04040"
                     /note="D-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(398481..398501)
                     /locus_tag="CNE_1c04040"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213185"
     gene            complement(399204..399854)
                     /locus_tag="CNE_1c04050"
                     /db_xref="GeneID:10916796"
     CDS             complement(399204..399854)
                     /locus_tag="CNE_1c04050"
                     /codon_start=1
                     /transl_table=11
                     /product="OstA-like protein"
                     /protein_id="YP_004684251.1"
                     /db_xref="GI:339324558"
                     /db_xref="GeneID:10916796"
                     /translation="MTASLTTSSRRRTAPALLALAMAFGLLAQPALAERADRDKPMVL
                     EADNASYDDVKQIYTLTGNVVLTKGTMILKSDAAELRTDPEGYQFAVATAKPGKQAYI
                     RQKREGVDEYIDGWGDRIEYDGKQEYSKLIGNARMARLQGAKQVDEIRGAVLTYDSRK
                     EFYTAAGGGSGDAAAANPSGRVRAVLSPRQDQKAGATGNGGSPLDLKTAPAPANKP"
     misc_feature    complement(399291..399758)
                     /locus_tag="CNE_1c04050"
                     /note="lipopolysaccharide transport periplasmic protein
                     LptA; Region: outer_YhbN_LptA; TIGR03002"
                     /db_xref="CDD:234083"
     misc_feature    complement(399369..399725)
                     /locus_tag="CNE_1c04050"
                     /note="OstA-like protein; Region: OstA; pfam03968"
                     /db_xref="CDD:252284"
     gene            complement(399923..400552)
                     /locus_tag="CNE_1c04060"
                     /db_xref="GeneID:10916797"
     CDS             complement(399923..400552)
                     /locus_tag="CNE_1c04060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684252.1"
                     /db_xref="GI:339324559"
                     /db_xref="GeneID:10916797"
                     /translation="MQALLASLSGIVMRLLPLLLMAFVAGSTFWLVQINSPKEDLAAQ
                     STKKHEPDYFMDRFSATELAPDGSTKIRFTGERMVHFEDDQTYEVTRPAMRAYEPDRP
                     PVTARADMGRMNAEGSVIDLYGNGFVMRQQGVDVSKDPQLTAASSYFQLLINDDIVKT
                     DKPVKLTRGPSVMTANGLIFNNVTREVQLLGNVRGTIITGPSPGRAPGS"
     misc_feature    complement(399962..400471)
                     /locus_tag="CNE_1c04060"
                     /note="Lipopolysaccharide-assembly, LptC-related; Region:
                     LptC; pfam06835"
                     /db_xref="CDD:253937"
     gene            complement(400596..401579)
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /db_xref="GeneID:10916798"
     CDS             complement(400596..401579)
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-like potassium-efflux system protein
                     KefB"
                     /protein_id="YP_004684253.1"
                     /db_xref="GI:339324560"
                     /db_xref="GeneID:10916798"
                     /translation="MIANFDADRALRLARDTLQTEADAVSALSGRLNGDFARAVLLIL
                     QCTGRVVVSGIGKSGHIGRKVAATLASTGTPAFFVHPAEASHGDLGMVTRDDVLIAFS
                     NSGETGELLSIIPIVKRIGARLISVTGNPDSNLAKLADVHLDAAVEKEACPLNLAPTA
                     STTAALALGDALAVAVLDARGFGEEDFARSHPGGALGRKLLTHVRDVMRTGNAVPEVR
                     ENTPLAQALMEITRKGMAMTAVVDPDGHAIGVFTDGDLRRLLETPRDWKTVPIGEVMH
                     HNPHVVNENQLAVEAVQVMEANRINQLLVVDDDGRLTGALHIHDLTRAKVI"
     misc_feature    complement(400599..401540)
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    complement(401091..401438)
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    complement(order(401274..401276,401406..401408))
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    complement(400608..400949)
                     /gene="kefB1"
                     /locus_tag="CNE_1c04070"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            401721..403700
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /db_xref="GeneID:10916799"
     CDS             401721..403700
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /EC_number="5.3.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose 5-phosphate isomerase KdsD"
                     /protein_id="YP_004684254.1"
                     /db_xref="GI:339324561"
                     /db_xref="GeneID:10916799"
                     /translation="MHSPLELTLVLLAAAVFGVVAFRMLQLPPMLGYLAVGILIGPHA
                     LGLASDTAQTKYLAEFGVVFLMFSIGLEFNLTKLRSMKRLVFGLGGSQVVLSMLAVVP
                     ASWAFNWLFPLSWQASVALGGALAMSSTAIVSKMLSERMELESEHGRNIISILLFQDL
                     AVVPLLIVIPALSRDPGDLMVALGLATVKIVVALGAIFFLGQRLMSRWFHVVAARRSQ
                     ELFMLNLLLVTLGMAALTERLGLSMALGAFMAGMLISETPYRHQVEEDIKPFRDVLLG
                     LFFVTIGMLLNIRVVLDHVWLVLALLVVPVLFKLVLIALLARVFGSRQGVAIRTGLGL
                     AQAGEFGFVLLNQIDGLNLVDPVLIQVILASMLLSMLAAPFLIQYSDAIVLRFTANEW
                     LMQSLNMTRIAAQSLQTEKHAIICGFGRSGQNLAHMLEREGINYVALDLDPDRVREAA
                     AAGDTVVYGDAGRREALIAAGIHRAAALIVTYANTPSALKVLHHVQELAPALPVIVRT
                     VDDSELDTLQKAGATEVVPEIIEGSLMLASHALVLLGVPMRRVVRGVQQARDARYSLL
                     RGYFHGRDDDEDMVERDSVRLHSVSLGPQSTAVGRRLGVLGLERIGVEVTAVRRRGIR
                     AFDPEPETVLEPGDIVVLRGPPEALEAAETRILNG"
     misc_feature    401721..403298
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /note="putative cation:proton antiport protein;
                     Provisional; Region: PRK10669"
                     /db_xref="CDD:182633"
     misc_feature    401721..402848
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    402960..403679
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    402960..403298
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    403479..403676
                     /gene="kdsD"
                     /locus_tag="CNE_1c04080"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(403719..404093)
                     /locus_tag="CNE_1c04090"
                     /db_xref="GeneID:10916800"
     CDS             complement(403719..404093)
                     /locus_tag="CNE_1c04090"
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfate sulfotransferase-like protein"
                     /protein_id="YP_004684255.1"
                     /db_xref="GI:339324562"
                     /db_xref="GeneID:10916800"
                     /translation="MCEIFIRANPASYQSQSRSLRLHGVATSIRLESLFWEVLEELAR
                     RDDMTVNQLITRLHDELTEHRGSEAVAGNFSSFLRVCCLRYLMLQGEGRIPADASVPI
                     RSLDARAVLDNLPESWVEARPH"
     misc_feature    complement(403767..404093)
                     /locus_tag="CNE_1c04090"
                     /note="Uncharacterized protein related to arylsulfate
                     sulfotransferase involved in siderophore biosynthesis
                     [General function prediction only]; Region: COG4321"
                     /db_xref="CDD:226771"
     gene            complement(404196..404774)
                     /gene="thiJ"
                     /locus_tag="CNE_1c04100"
                     /db_xref="GeneID:10916801"
     CDS             complement(404196..404774)
                     /gene="thiJ"
                     /locus_tag="CNE_1c04100"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular protease/amidase/DJ-1/PfpI family"
                     /protein_id="YP_004684256.1"
                     /db_xref="GI:339324563"
                     /db_xref="GeneID:10916801"
                     /translation="MAKKILMLVGDYAEDYETMVPFQALQMVGHTVHAACPDKQAGDA
                     CATAIHDFEGDQTYTEKRGHNFTLNATFAGIDPASYDALVIPGGRAPEYLRLNARVLE
                     IVRHFAQADKPIAAVCHGAQLLAAAGVLEGKTCSAYPACAPEVKLAGGTYADIPVDQA
                     HTDGNLVTAPAWPAHPAWLAQFLAVLGTRIVH"
     misc_feature    complement(404214..404765)
                     /gene="thiJ"
                     /locus_tag="CNE_1c04100"
                     /note="intracellular protease, PfpI family; Region: PfpI;
                     TIGR01382"
                     /db_xref="CDD:233389"
     misc_feature    complement(404217..404765)
                     /gene="thiJ"
                     /locus_tag="CNE_1c04100"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in a subgroup of proteins similar to PfpI
                     from Pyrococcus furiosus; Region: GATase1_PfpI_1; cd03169"
                     /db_xref="CDD:153243"
     misc_feature    complement(404421..404423)
                     /gene="thiJ"
                     /locus_tag="CNE_1c04100"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153243"
     gene            404991..405563
                     /gene="apt"
                     /locus_tag="CNE_1c04110"
                     /db_xref="GeneID:10916802"
     CDS             404991..405563
                     /gene="apt"
                     /locus_tag="CNE_1c04110"
                     /EC_number="2.4.2.7"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine/guanine phosphoribosyltransferase Apt"
                     /protein_id="YP_004684257.1"
                     /db_xref="GI:339324564"
                     /db_xref="GeneID:10916802"
                     /translation="MADSIIQSPELGDVTGYLRERIRTVPDWPMPGVMFRDITPLLQN
                     PKTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQT
                     VAEEYELEYGSATVEIHADACKAGDRVLLVDDLIATGGTMMAGRKLLERLGATVVEGA
                     AIVDLPELGGSKLLQDGGLPLFTVCKFEGH"
     misc_feature    405183..405542
                     /gene="apt"
                     /locus_tag="CNE_1c04110"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(405201..405203,405207..405209,405387..405395,
                     405399..405413,405483..405485)
                     /gene="apt"
                     /locus_tag="CNE_1c04110"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            405607..406218
                     /locus_tag="CNE_1c04120"
                     /db_xref="GeneID:10916803"
     CDS             405607..406218
                     /locus_tag="CNE_1c04120"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine efflux protein"
                     /protein_id="YP_004684258.1"
                     /db_xref="GI:339324565"
                     /db_xref="GeneID:10916803"
                     /translation="MPDLLLFLLTSIAVTVAPGPDNLQVLARGMAQGRRAGLVAALGF
                     SVGCLFHTVIAAVGLAAVLRSSPLAFQLIKYAGAAYLIWIGIQALRAKGGLAQGGDVD
                     AVPLGRVFRQSVLGNIMNPKVTLFFLVFLPQFVRADATHPGLQFLLLGVVFMLQTAVV
                     FSLFGLCAGWLGAWLRRRPATGRWLDRAAGAIFVGLGIKVALP"
     misc_feature    405616..406212
                     /locus_tag="CNE_1c04120"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            406450..408129
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /db_xref="GeneID:10916804"
     CDS             406450..408129
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/phosphate symporter NptA"
                     /protein_id="YP_004684259.1"
                     /db_xref="GI:339324566"
                     /db_xref="GeneID:10916804"
                     /translation="MGVLLHLLSGVALLVWGTNIVKVGILRVYGANLRHVLSTSVSNR
                     FTAFLAGLGVTGLVQSSNATAVIVSSFVGQGLIAVAPALAIMLGANVGTALMVQVFSL
                     DLSWLSPLLIFVGVICHLTWKGSKPGHVGRVLIGLGLITLALELISIATRPVVQAAGV
                     KVLFASLTGDSGLDMLVGAFLTILCYSSLAVVLFCGALASAGVVSIHVALALVLGANL
                     GSGISALLTTSGNNQPGKRVTLGNLLSRLLGCLVALPLLGQAEELLALLDHDPQRLIV
                     NFHLLFNVALAVLLLGATAPLARLCEKVLPGRNTGDSQVTPRHLDTAALTTPTLALAN
                     AAREVLRIGDRVEQMLDNMLRVLRTNDAKLADATCRIDNEVDDLYTAIKLYLTRISLE
                     ALDERDGQRWTEIISLTINLEHAGDIIERILLDTKDKKIAHNLMFSEAGMQEIAEMHA
                     RLVANLRLGLSVFLNGDLKSAQALMAEKANFRELERKYARTHLQRVAVQTAESIETSS
                     LHLDVISELKRLNSLFCATAYPVLEQAGVLNRSRMKEDDLPTVSTVQAAQH"
     misc_feature    406450..408051
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /note="Na+/phosphate symporter [Inorganic ion transport
                     and metabolism]; Region: NptA; COG1283"
                     /db_xref="CDD:224202"
     misc_feature    406486..406899
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    406849..>407127
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    407464..407715
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    407782..408006
                     /gene="nptA"
                     /locus_tag="CNE_1c04130"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(408139..408624)
                     /locus_tag="CNE_1c04140"
                     /db_xref="GeneID:10916805"
     CDS             complement(408139..408624)
                     /locus_tag="CNE_1c04140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684260.1"
                     /db_xref="GI:339324567"
                     /db_xref="GeneID:10916805"
                     /translation="MELSVVSVTKPEATNFIFGQSHFIKTVEDLHEALAGTVPGILFG
                     LAFCEASGKRLVRWSGTDEDLIDLACENARAIGAGHTFLIFLGDGFFPVNVLAAVRAV
                     PEVCRIFCATANPTQVIIAETDVGRGVVGVIDGASPLGIETDADVAERKALLRKFGYK
                     L"
     misc_feature    complement(408142..408609)
                     /locus_tag="CNE_1c04140"
                     /note="Adenosine specific kinase; Region: Adenosine_kin;
                     pfam04008"
                     /db_xref="CDD:112807"
     gene            complement(408735..411599)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /db_xref="GeneID:10916806"
     CDS             complement(408735..411599)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_004684261.1"
                     /db_xref="GI:339324568"
                     /db_xref="GeneID:10916806"
                     /translation="MEEIKIRGARTHNLKNINLDLPRNRLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVT
                     EIHDYLRLLYARAGTPYCPDHNLPLQAQSVSQMVDAALALPEDTKLMILAPVVADRKG
                     EHSDLFDSMQAQGFVRFRIRSGGGAAHEAEAKVYEVDALPKLKKTEKHTIEVVVDRVK
                     VRADIKQRLAESFETALRLADGRALALELDSGKEHMFSSKFACPICSYSLQELEPRLF
                     SFNNPMGACPSCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQGLAA
                     YYDFDTETPFEELPENVQQSVLHGSGEQEIPFTYINERGRTTVREHVFEGIIPNLERR
                     YRETDSVAVREELAKYQNNQPCPACHGTRLRTEARHVKLGEGEQARAIFEINGWPLRD
                     ALTYFLTLDMHGAKREIGDKIIKEISARLNFLNNVGLDYLSLERSADTLSGGEAQRIR
                     LASQIGSGLTGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDIGNSVLVVEHDEDMIRAC
                     DYVVDIGPGAGVHGGMIVAEGTPRQIEESPASLTGQYLSGQRRIEVPKERAAPDDERL
                     LRIVNASGNNLRNVTAEVPVGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSTPEPA
                     PHDRIEGLEHFDKVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPG
                     RFSFNVKGGRCESCQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVLYKGRNISE
                     VLDLTVEQAHEFFSAVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELS
                     KRDTGRTLYILDEPTTGLHFHDIELLLKVIHKLRDQGNTVVIIEHNLDVIKTADWLID
                     MGPEGGAGGGQVIARGTPEDVARSKASFTGKYLAPLLKRA"
     misc_feature    complement(408741..411599)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     misc_feature    complement(<411252..411590)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(409839..>410177)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(408804..409727)
                     /gene="uvrA"
                     /locus_tag="CNE_1c04150"
                     /note="ATP-binding cassette domain II of the excision
                     repair protein UvrA; Region: ABC_UvrA_II; cd03271"
                     /db_xref="CDD:213238"
     gene            411966..413216
                     /locus_tag="CNE_1c04160"
                     /db_xref="GeneID:10916807"
     CDS             411966..413216
                     /locus_tag="CNE_1c04160"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS sugar family"
                     /protein_id="YP_004684262.1"
                     /db_xref="GI:339324569"
                     /db_xref="GeneID:10916807"
                     /translation="MPSIQSSSPGAGAADASQAPARERMTRAELRAAVSLASIFALRM
                     LGLFLILPVFAEFAHSLPDGHDAQRVGLAMGIYGLMQAFLHIPLGWLSDRIGRKPVMV
                     AGLLLFIAGGLVAAFSDTLSGIIAGRALQGMGAISAAITACIADLTRERHRTKAMAMV
                     GGSIGLTFALSLVIASPLLHSIGMSGIFGLMSVLGLVAIGVTLFLVPTPPPPHPVRLP
                     FRKVLLNADLARLNVGVLALHASQVAMFMVVPAMLADAGMPLDQHWKVYLPVVLVSFV
                     LMLGPMMAAERYGRVRPVLLGAVALMTAVQLLFAAVHGLWAIVGVLLLFFVAFNVLEA
                     MQPSLVSRYAAAARGAALGVYNTTQALGLFLGGAAGGWLLKHEGRSAVFVGCAVVLLL
                     WLIIAWSMKAPPARGQEAAPATPA"
     misc_feature    412065..413168
                     /locus_tag="CNE_1c04160"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    412071..412952
                     /locus_tag="CNE_1c04160"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(412104..412106,412113..412121,412125..412130,
                     412185..412187,412194..412199,412206..412208,
                     412218..412223,412227..412232,412374..412379,
                     412386..412391,412398..412400,412434..412439,
                     412446..412451,412467..412469,412680..412682,
                     412689..412694,412701..412706,412713..412715,
                     412752..412754,412764..412766,412776..412778,
                     412785..412787,412797..412799,412941..412943,
                     412950..412955,412962..412964,412974..412979,
                     412986..412988,413016..413021,413028..413033,
                     413040..413045,413052..413054)
                     /locus_tag="CNE_1c04160"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            413400..413948
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /db_xref="GeneID:10916808"
     CDS             413400..413948
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /codon_start=1
                     /transl_table=11
                     /product="ssDNA-binding protein"
                     /protein_id="YP_004684263.1"
                     /db_xref="GI:339324570"
                     /db_xref="GeneID:10916808"
                     /translation="MASVNKVILVGNLGADPETRYLPSGDAVTNIRLATTDRYKDKQS
                     GEMKEATEWHRVSFFGKIAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVA
                     DQMQMLGSRQGGGGGGDEGGYGGGAGGGGYSREASGGGYGGGARGGQGGAQGGGQSGG
                     AARRPQQPASNGFEDMDDDIPF"
     misc_feature    413403..413945
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    413418..413723
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(413418..413429,413502..413510,413553..413555,
                     413559..413561,413622..413624,413649..413651,
                     413682..413684,413691..413693)
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(413433..413441,413457..413459,413487..413489,
                     413508..413513,413547..413552,413556..413558,
                     413562..413564,413568..413570,413574..413576,
                     413613..413618,413640..413642,413646..413648,
                     413652..413657,413694..413696,413700..413702)
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(413622..413624,413628..413630,413634..413636,
                     413715..413717)
                     /gene="ssb"
                     /locus_tag="CNE_1c04170"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            414160..415356
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /db_xref="GeneID:10916809"
     CDS             414160..415356
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-based site-specific recombinase CMGI-7"
                     /protein_id="YP_004684264.1"
                     /db_xref="GI:339324571"
                     /db_xref="GeneID:10916809"
                     /translation="MPLFAPTVYSLTQLRGRNLAANTIEQSLRHIIVLLLFLEQRGID
                     IETRFQEGRLVDLAEIESLANACSLHLADIDAAEGQKAGAKPARMPSLERLRMLRSNA
                     GAKTVDAASAANRVRGIADYLSWLVKSHLLKLSASSSSFQALESTRQMVIQALLARAP
                     SHRSRNVVAAREGLPPETAARLLKVTAKNSPENPWTGEFIKLRNELLFRWLYSFGLRR
                     GELLNVKVSDISFQKETVTIVRRADAPEDPRKEQPTVKTRDRVLPIPSDLCRLTHDYV
                     LHGRRHLTGARKHEYLFVADKTGAPMSLSALNKCFAFLRTHIPDLPDDLSPHVLRHTW
                     NDNFSAAMDRMKTPEADEQKMRSFLMGWSETSGTAVNYTRRHVRKRANEVSLLLQSEM
                     TNKNDI"
     misc_feature    414751..>415158
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(414808..414810,414925..414927,415141..415143,
                     415150..415152)
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(414808..414810,415141..415143,415150..415152)
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /note="active site"
                     /db_xref="CDD:238231"
     misc_feature    order(414808..414813,414925..414927,415135..415143)
                     /gene="int"
                     /locus_tag="CNE_1c04180"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     gene            415356..416888
                     /locus_tag="CNE_1c04190"
                     /db_xref="GeneID:10916810"
     CDS             415356..416888
                     /locus_tag="CNE_1c04190"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004684265.1"
                     /db_xref="GI:339324572"
                     /db_xref="GeneID:10916810"
                     /translation="MTALPAIIEEASPIVRTRGGAWFDPNQVRWVIREGHGAASINFE
                     RLMGVATPMFVHGFRKTLIWYAENKSLRHLDNMFQRAEHLFKHLNEGRLEPLHEISEV
                     SLLNYHSSLGNQKWYLGSLAGFLKKWHALGYHGVTTPAITLLNELRLAGNIKGVAVLT
                     MDPHNGPFTDIELESIQAALNNAYACGVVAKDDYLLAWLFMLLGQRPSQYALLKVSDV
                     HAPKIKDGSRIHCLKVPRAKQRQAARLEFKERLLTPQIGELLYEYANEVEKSFEGKLE
                     DPREGPLFPADSTGLQPAGMEYHQEADSLARKLVRALTKLEVFSERTGDLIHITATRF
                     RRTLGTRAAREGHGELVIAELLDHTDTQNVGVYVQSTPEIVERIDKSVAMALAPLAQA
                     FAGIVIADESAAIRGKDPSSRIFDPRIERSCQPMGSCGSHGFCKFSAPIACYTCQSFQ
                     AWLDGPHEAVLNHLLAERERKLTTTDMRIATINDRTILAVAEVIRQCEAHRETMELAA
                     HG"
     misc_feature    415881..416462
                     /locus_tag="CNE_1c04190"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(415971..415976,416067..416069,416346..416351,
                     416454..416456)
                     /locus_tag="CNE_1c04190"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(415971..415973,416067..416069,416349..416351,
                     416358..416360,416427..416429,416454..416456)
                     /locus_tag="CNE_1c04190"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(415971..415973,416349..416351,416358..416360,
                     416427..416429,416454..416456)
                     /locus_tag="CNE_1c04190"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(415971..415973,416358..416360,416454..416456)
                     /locus_tag="CNE_1c04190"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            416881..418959
                     /locus_tag="CNE_1c04200"
                     /db_xref="GeneID:10916811"
     CDS             416881..418959
                     /locus_tag="CNE_1c04200"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_004684266.1"
                     /db_xref="GI:339324573"
                     /db_xref="GeneID:10916811"
                     /translation="MADIVLFTPKSEWDASENLNDFVAMCREQLTVFGADLCFDENVW
                     DITDAIELKGRGNKRFRVVFSNLSTANDATVRPMAEPFLSFAKADFRYSFAMRPTKSP
                     DRRMVALRALEEALAENGNYPDPVRMTAETFNRAAQLVKERFSMSSAYRVGGQLELLS
                     KFLSDNHLVAVRIDWRNPLRRPTDTSRVGKEFDERRNKKLPSAAALEAIPKIFQTATE
                     PSIVFASAIAATLCSAPDRINEILLLPANCEVREKKGDGTEAYGLRWWSAKGAEPMVK
                     WVVPSMAEVVSEAIRRIRDLSANARKVAVWYEEHPNEAYLSEAAEHLRHQEWLSASEL
                     NLVLFGDETVPRQSGTQWCKLKKVTLIKRGRASYAKFADVEAALLELLPKGFPWLSKS
                     VGLKYRDALCIVRENELHFDANIQVGRIAAVTIDQIHVWLGGATEKWSIFSRSDFWEP
                     DGSAIKITSHQFRHYLNTLAQAGGMSQLDIAKWSGRRDIRQNAAYDHVSADELVLKIR
                     NALGDDRQMFGPLAELPKRIVIHRDEFARLKVPTAHTTEFGVCIHDYTMAPCQLHADC
                     LNCHEQVCIKGDEVRAARIRAELDTARESLAAAEQAQGDGYFGASRWVAHHRLGVERL
                     TQLCEILDDPKVPMGAVIQLSNIQTASRIEQAAEARAGLGHEEGSSDESVTPSQAMRN
                     LLTMMENSDA"
     misc_feature    416881..418755
                     /locus_tag="CNE_1c04200"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4688"
                     /db_xref="CDD:227032"
     gene            418952..419422
                     /locus_tag="CNE_1c04210"
                     /db_xref="GeneID:10916812"
     CDS             418952..419422
                     /locus_tag="CNE_1c04210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684267.1"
                     /db_xref="GI:339324574"
                     /db_xref="GeneID:10916812"
                     /translation="MPKQSKSRARNLGDEDLEAISRLLDGWDGKLSWELLIEAIETRL
                     KARYTRQALSQHARIKLAFQLTKERLTGQPRSKQQGSAGLGATEAQALLERYQRLEGE
                     NARLKAENERLLEQFVVWAYNASNRGLDARFLSQPLPRVDRDQTKLRPSRPSKL"
     misc_feature    419207..>419299
                     /locus_tag="CNE_1c04210"
                     /note="integrating conjugative element protein, PFL_4705
                     family; Region: conj_TIGR03752"
                     /db_xref="CDD:234342"
     gene            419709..420785
                     /locus_tag="CNE_1c04220"
                     /db_xref="GeneID:10916813"
     CDS             419709..420785
                     /locus_tag="CNE_1c04220"
                     /note="porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_004684268.1"
                     /db_xref="GI:339324575"
                     /db_xref="GeneID:10916813"
                     /translation="MKVGNTRRSHAMALTGVLAGAICGVAQQALAQSVSTSISVYGLI
                     DTMVRYSDNNRGDQSLAELSEGYFSGSRWGVRGNEALGAGWSALFNLESGFDLATGTS
                     LQGTAASNYGQVGTQGTGRLFGRQSYLGIEHLAWGKLTVGRQFTTAYDATFRFQPYGH
                     PNLDAVAILNGYTGPRQDNMAKYAGQWGAFSATAHYTFGEVPGDAAASSSRGLALAWI
                     TALIDVGALFQSTSALANEEKRTIWGIGGSSQLGRVKLALGYLDNRYHLSPTRNHVLT
                     GGATVQATPALALSLAAGYDRQTAASGHRLMLTSVAEYSLSRRTSVYAEADFNRISGS
                     YALPAFMGVRGNKFGGGVGLRHRL"
     misc_feature    419814..420779
                     /locus_tag="CNE_1c04220"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(419814..419816,419820..419822,419838..419840,
                     419844..419852,419937..419951,419967..419969,
                     419973..419981,419985..419987,419991..420002,
                     420078..420083,420087..420101,420129..420137,
                     420234..420236,420240..420245,420654..420659,
                     420666..420668,420768..420770,420774..420776)
                     /locus_tag="CNE_1c04220"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(419835..419837,419922..419924,420081..420083,
                     420174..420176,420234..420236)
                     /locus_tag="CNE_1c04220"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            420801..421787
                     /gene="bugT2"
                     /locus_tag="CNE_1c04230"
                     /db_xref="GeneID:10916814"
     CDS             420801..421787
                     /gene="bugT2"
                     /locus_tag="CNE_1c04230"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004684269.1"
                     /db_xref="GI:339324576"
                     /db_xref="GeneID:10916814"
                     /translation="MISRRQFLAAALAAPALPGMPARADSGATAWPRHPVRLVVTFPP
                     GGSSDIVARLLAPVLQEKLGQPFVTDNRPGAGSTIGAAAVAAAPNDGYTLLMSNSAAL
                     SISPFLLRRPAYDPVRSFTHVHYIGAVPTVFAVHPSVPARNLAELAAWIRAQRDPVPF
                     GSGGAASVAHIVGELFGQQAGLRLTHVPYKGAGPMRADLLGGQIPFAVDALPQNLPLL
                     QSGALRLLAVTSAQRVPQAPQLPTVAQAGYPGLVAENFVGVSAPANLPEDIVQRLHQQ
                     LQVILQQPALRGRLEAQGFVLAERRPDEFAAYVRQQAQAWGPVVAATGATLS"
     misc_feature    420882..421772
                     /gene="bugT2"
                     /locus_tag="CNE_1c04230"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            421784..422719
                     /locus_tag="CNE_1c04240"
                     /db_xref="GeneID:10916815"
     CDS             421784..422719
                     /locus_tag="CNE_1c04240"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_004684270.1"
                     /db_xref="GI:339324577"
                     /db_xref="GeneID:10916815"
                     /translation="MSARIQVVLFGPEGRGSFNEAGHVGAMRARNAGHDLAVTWIADP
                     DPQARAAALLALCETGPDLIVAHGGQGDYPVSVAAARHPARRFVVTQGSVLCANTASY
                     AVLQEQSAFLAGVLAAMDSRTGVVAHLSGEKVCPGLKGRAAFLHGVRSVVPGLPALTT
                     FCGNQHDPALAGGAVAAQARAGADIVFAMIDGGRDGAIAACRAAGIRQIGNVLDWTSR
                     HPDVFLASAVADSGLCVELAIGDFKRDRIAWGTIHSFGLEAPAAVRLALGSDVSTAAR
                     AAIDHWSQRLLDGGVAVAEGYDGPEFAVGDAPAVA"
     misc_feature    421793..422578
                     /locus_tag="CNE_1c04240"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(422727..423899)
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /db_xref="GeneID:10916816"
     CDS             complement(422727..423899)
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /EC_number="2.7.7.65"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator PleD"
                     /protein_id="YP_004684271.1"
                     /db_xref="GI:339324578"
                     /db_xref="GeneID:10916816"
                     /translation="MLHDAGQFLALVNPAIAILLSLCFLLAWNHERTRHYLLQLGACY
                     LLYALAIALQIVWVPRNGGGNATVTGALYLGSAVLMLRGMLARIGARVDTCALVSLPL
                     ALFATLAWFDFVQPQLVARIYILNIGIALILLLGIAPLARLRTGSTADRVLFWVFLLF
                     ALHFLPRTVLTIAPATGQDAAAFTRSAYWLWLQVTLALLLLTLALALLAAAMQDVIDG
                     LRHERDTDPLTQLHTRRSLEALAAREIPPPQGKPLSVLLCDLDFFKFINDNYGHSAGD
                     AVLAQIGRIIAAGVRRRDIAARLGGEEFVVLLPDTPPDAALHLAERLRQTLESSEMDV
                     LPGMHSVTASFGVATLRPGEDLEALLMRVDNVLYAAKNKGRNCVEWEREAGMPVLA"
     misc_feature    complement(422766..423227)
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(422994..422996,423123..423125))
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(422991..423002,423006..423008,
                     423072..423074,423084..423086,423096..423101,
                     423108..423110))
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(422934..422936,423018..423020))
                     /gene="pleD"
                     /locus_tag="CNE_1c04250"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            424298..424642
                     /locus_tag="CNE_1c04260"
                     /db_xref="GeneID:10916817"
     CDS             424298..424642
                     /locus_tag="CNE_1c04260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684272.1"
                     /db_xref="GI:339324579"
                     /db_xref="GeneID:10916817"
                     /translation="MKTKKAMPALLLAASVLAAPFAMAQGGAKSKPKPMTDPMAASEP
                     AAQNSPYMQVQQWKKGDRLPTEFRDRQYVIDDYKQYNLPAPRKGTRWVGIGAEYYLVA
                     PNGVVQQVGSGS"
     misc_feature    424475..424627
                     /locus_tag="CNE_1c04260"
                     /note="Domain of unknown function (DUF3315); Region:
                     DUF3315; pfam11776"
                     /db_xref="CDD:256612"
     gene            complement(424729..425022)
                     /locus_tag="CNE_1c04270"
                     /db_xref="GeneID:10916818"
     CDS             complement(424729..425022)
                     /locus_tag="CNE_1c04270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684273.1"
                     /db_xref="GI:339324580"
                     /db_xref="GeneID:10916818"
                     /translation="MDYAGNPNSVFVEAIVRKSVLVLMALLLAGAPGLALAHNCPNEM
                     KAIDAKLSTRPALSPEDSAKVAKLRADGEAYHKAGKHDEAMKSLLEAKKILGI"
     gene            425485..426555
                     /locus_tag="CNE_1c04280"
                     /db_xref="GeneID:10916819"
     CDS             425485..426555
                     /locus_tag="CNE_1c04280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684274.1"
                     /db_xref="GI:339324581"
                     /db_xref="GeneID:10916819"
                     /translation="MPLMRNRGASIVQHIDLKLAAIPLACLAILLAGCGGGGGDSAPA
                     NAAPSASVAGPAGANGKTILSGTNAPTADAGTDGDFYLNATTSTLYGPKAGGAWPAGV
                     SLVGPQGVAGAPGAVLLHGAADPTAADGGEGSFYLNTTTNTLFGPKTAEGWPAGVSVV
                     GLTGPVGPAGPAGSDGAAGAQGPQGEKGEKGDTGETGATGPQGQQGEAGGNGGAGATI
                     YTANFAVYNSPDGNGTYVMTGTGLDRQSIDPNFGAVMPVGCSGGLTLNASLAGAVPDD
                     EVKYTLAAYRVASGAALETIAPLAITDASACSLGATVRTCSAPATTTVAANDIVQVQV
                     SGNRNFKWGGALYVSLSCKSSS"
     misc_feature    425965..>426078
                     /locus_tag="CNE_1c04280"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; pfam01391"
                     /db_xref="CDD:189968"
     gene            426736..427236
                     /locus_tag="CNE_1c04290"
                     /db_xref="GeneID:10916820"
     CDS             426736..427236
                     /locus_tag="CNE_1c04290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684275.1"
                     /db_xref="GI:339324582"
                     /db_xref="GeneID:10916820"
                     /translation="METSAEHYSLALLCAAVLTVTVVGIHYEALRLLSAIHPRRWSGR
                     MNIGVLIVCIIVVHCLEALVFALGFWFADHVLGLGGLTAMGSAGVSGVHTQPGVLVYA
                     YFALETFTTQSLGDIVPVGASRLIASIEPLVGLILIGWSTSFTYVMMRRDWELERDEG
                     GGRRAP"
     misc_feature    <427042..427164
                     /locus_tag="CNE_1c04290"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            427313..428773
                     /locus_tag="CNE_1c04300"
                     /db_xref="GeneID:10916821"
     CDS             427313..428773
                     /locus_tag="CNE_1c04300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684276.1"
                     /db_xref="GI:339324583"
                     /db_xref="GeneID:10916821"
                     /translation="MARLVMILLGVDYLRTRWRGLLRLGCLSVLLGGAMFVDALDNAI
                     YFPMTPFAVVLLLEGLATLVVARTGIGGQRTLRQVKGVSFCFAAVLILAGHHHGNFVL
                     SMIFGTLFLADGLLQIVSARVVRFRTWRLAVAVGMFEIALAIFFYQPYPTHYVGTVPY
                     CLALGLIFGGWNMLLLASRLRRLDHNPGMDEADAAPAAPASAVPATDAAAAADVPDMT
                     LWDGPPEPGEHALTVHVWTPVGSARGEARRQPLVDRYIAAVDRDGVISTGHAALESPE
                     GIYISLYPAEEIDRSPDEFTRILRATRENDVGGKFQPDYQTESRAWCPSTVQVRIRNY
                     DPERLGRFWSAYRQNTTYNLTDRNCSSTVSHALEGASARVWRQAKGWRPLWRLLTTPE
                     LWVAAQIRKRAKTMAWTPGLTLDYARALSMLADPRPSGWASMTRMALGQMRRQRRGWR
                     EAARTRADKEGSGAVAGGIDAANAENAGSVRQAAND"
     misc_feature    427382..427753
                     /locus_tag="CNE_1c04300"
                     /note="Tripartite tricarboxylate transporter TctB family;
                     Region: TctB; pfam07331"
                     /db_xref="CDD:254158"
     gene            428821..429171
                     /locus_tag="CNE_1c04310"
                     /db_xref="GeneID:10916822"
     CDS             428821..429171
                     /locus_tag="CNE_1c04310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684277.1"
                     /db_xref="GI:339324584"
                     /db_xref="GeneID:10916822"
                     /translation="MPSQRTLIRIAAIAALAMACSAHAQRPDGDSAAAAAINEAVQQG
                     TTPYRPDPAATPGSIQSDECRALAAQIAEAPKREYRATQPAIETAQGRMIPELERDRP
                     KKSLQQAYREKCSQ"
     gene            429482..430420
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /db_xref="GeneID:10916823"
     CDS             429482..430420
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate ABC transporter permease
                     GltI"
                     /protein_id="YP_004684278.1"
                     /db_xref="GI:339324585"
                     /db_xref="GeneID:10916823"
                     /translation="MKAAQVTCPRSSQRPLAEPLAAAVLALFAGTAGAADVAASPTLS
                     KVKSSGTIAIGHRTSSIPFSYYDANQKVIGFSQDICDRVVDAVKRETGVPGLQVRMVP
                     VTSQNRISLVQNGTVDLECGVTTNLKSRQQQVAFSTTFFVAGTRLLVKKGSPVRDFAD
                     LSGKAVVTNAGTTSERILRRLNDEKQANITVQSAKDYGESFLILQSGRVAAFMMDDVL
                     LSGARTLAPNPAEWAVVGTPQSFEAYAFMMRKDDPGFKQVVDGAITGLIRSGEINKLY
                     ARWFAAPVPPKHVNFELPMSEPLKKAYANPNDEAFD"
     misc_feature    429632..430321
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    429635..430321
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(429659..429661,429794..429796,429869..429871,
                     429998..430000,430124..430126)
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(430073..430075,430085..430087,430103..430105)
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    430205..430222
                     /gene="gltI1"
                     /locus_tag="CNE_1c04320"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(430436..431350)
                     /locus_tag="CNE_1c04330"
                     /db_xref="GeneID:10916824"
     CDS             complement(430436..431350)
                     /locus_tag="CNE_1c04330"
                     /codon_start=1
                     /transl_table=11
                     /product="GlvR family transcriptional regulator"
                     /protein_id="YP_004684279.1"
                     /db_xref="GI:339324586"
                     /db_xref="GeneID:10916824"
                     /translation="MPMPPDSPTPSPQAPPQDLDALLALLRSNFPTLSTQFQGGARYL
                     LDHPQDVAVLSMRKIAASAGVQPATLVRLSQHLGFEGWQGLRELFVDALRGGSQPYAR
                     RARKVVRESSASRMLGEMLDAQHHNLDMIATSNEKTLQQAAELLSHAACVHVAGFRSC
                     FPIAFTFHYVYRLFRSTVHLIRADAGTLEMELRGLAPKDAVLVVSFAPYSQESIRVAA
                     AARECGCKVIALTDSTVAPIALAADCTLLFSVESPSFFPSVTAGVAMVEALVEQLLAR
                     KGKGAIRALEQAEGELHRTGAYVAAGRG"
     misc_feature    complement(430475..431272)
                     /locus_tag="CNE_1c04330"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    complement(431093..>431230)
                     /locus_tag="CNE_1c04330"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    complement(430541..430942)
                     /locus_tag="CNE_1c04330"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    complement(order(430736..430738,430871..430873))
                     /locus_tag="CNE_1c04330"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            431636..432157
                     /gene="pilE1"
                     /locus_tag="CNE_1c04340"
                     /db_xref="GeneID:10916825"
     CDS             431636..432157
                     /gene="pilE1"
                     /locus_tag="CNE_1c04340"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilE"
                     /protein_id="YP_004684280.1"
                     /db_xref="GI:339324587"
                     /db_xref="GeneID:10916825"
                     /translation="MGHRSPAVRHGGRVNSSFRVIGEVGATGNPCRGWRLRGARAAHG
                     FTLIEVMITVAIIAILAAVAIPNYSRHVVRSHRAAIESFMLEVSGAQERYLVDNRAYA
                     ANLGTLGMSVPAAQATRYDVAVTPNAALPPGYSIVATPKGSQVAGDADCGSLTLTSAG
                     AKSASGSGTDCWN"
     misc_feature    431765..432151
                     /gene="pilE1"
                     /locus_tag="CNE_1c04340"
                     /note="Tfp pilus assembly protein PilE [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: PilE; COG4968"
                     /db_xref="CDD:227303"
     gene            432160..432654
                     /gene="fimT1"
                     /locus_tag="CNE_1c04350"
                     /db_xref="GeneID:10916826"
     CDS             432160..432654
                     /gene="fimT1"
                     /locus_tag="CNE_1c04350"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein FimT"
                     /protein_id="YP_004684281.1"
                     /db_xref="GI:339324588"
                     /db_xref="GeneID:10916826"
                     /translation="MRRATFPPSSPGRPTRRGFTLVELLCAMSVLAILAVAAAPSFSS
                     LIANQRVRGASLDLTSALLLARSEAVKRNATVTLAATGAAWTAGWAVTAGAETVRSFG
                     PYGGLTITPSAAGALALGNDGRLTGAAMTFEVAPNGDTAAASRVCVQVSETGRVASAT
                     GACS"
     misc_feature    432328..432585
                     /gene="fimT1"
                     /locus_tag="CNE_1c04350"
                     /note="Type II transport protein GspH; Region: GspH;
                     pfam12019"
                     /db_xref="CDD:256804"
     gene            432651..433274
                     /gene="pilV1"
                     /locus_tag="CNE_1c04360"
                     /db_xref="GeneID:10916827"
     CDS             432651..433274
                     /gene="pilV1"
                     /locus_tag="CNE_1c04360"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilV"
                     /protein_id="YP_004684282.1"
                     /db_xref="GI:339324589"
                     /db_xref="GeneID:10916827"
                     /translation="MKHRIPRLRPRMPGRRTQGGFLLIEVLVAVVILLVALLGTAGLV
                     ARSGQTEMESYQRVQALALLQDMVARLNANRQVASCYANGATGMQLGSAAAPPAACTQ
                     GTAAQKATADADLQAWNTALLGSAEKRPGASAADAAQAVGAMIGARGCIETVDAVNNI
                     YRITVAWQGLATTGAPALGCGKDQYGNDAYRRAVSTQIRVGTLGTVS"
     misc_feature    432693..433196
                     /gene="pilV1"
                     /locus_tag="CNE_1c04360"
                     /note="Tfp pilus assembly protein PilV [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: PilV; COG4967"
                     /db_xref="CDD:227302"
     misc_feature    432702..>433004
                     /gene="pilV1"
                     /locus_tag="CNE_1c04360"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; cl06830"
                     /db_xref="CDD:263062"
     gene            433271..434314
                     /gene="pilW1"
                     /locus_tag="CNE_1c04370"
                     /db_xref="GeneID:10916828"
     CDS             433271..434314
                     /gene="pilW1"
                     /locus_tag="CNE_1c04370"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilW"
                     /protein_id="YP_004684283.1"
                     /db_xref="GI:339324590"
                     /db_xref="GeneID:10916828"
                     /translation="MSPLRLSARRLRRQRGISLVELMIGMTIGLVLLTALASLYYANS
                     LSRTEFVKSAEQVENGRYALEQIRREVELAGFFGAGSIARGATVAEPALCAADPAALG
                     FSAAGLTVPLALTGYGPGVAAACLPDLAATSEVLVVRRVSTTPVAAPTPGVPYLQVSA
                     CPQDTNSFVFDASAAAAFGLRTKACDPAQPAALRQAVVRVFYLAGCDRCSNGGDGIPT
                     LKMAELVGGAFQSRSVAQGVQDMHLQYGVDLDSNGSADCYVADPGANNAAACATVPGY
                     DWTNALANWRNVTTVRVNLLARTLKPSGGQSDNRTYDVGRAAASGPFNDGFKRHVYAQ
                     VARLVNVAGLREQ"
     misc_feature    433316..434248
                     /gene="pilW1"
                     /locus_tag="CNE_1c04370"
                     /note="Tfp pilus assembly protein PilW [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: PilW; COG4966"
                     /db_xref="CDD:227301"
     gene            434311..434904
                     /locus_tag="CNE_1c04380"
                     /db_xref="GeneID:10916829"
     CDS             434311..434904
                     /locus_tag="CNE_1c04380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004684284.1"
                     /db_xref="GI:339324591"
                     /db_xref="GeneID:10916829"
                     /translation="MTSPRKEQAMIKQSGRQPQGRPLRRGQDGVTLVVTLVFMVLFLL
                     IAMAMVNSGLVNVKVAANQQHTAEARDVAQQAIEQVISNDFTKAPAAVAVPVDVSGDG
                     KADYVAQVAQPECVTSKPMKNVELDLSDADDVSCLIGSGVQNTGIVTAGNSGGNSLCN
                     ATQWDVAATVNDAANTGTVATVHQGVAVRMPTGSACP"
     misc_feature    434395..434544
                     /locus_tag="CNE_1c04380"
                     /note="PilX N-terminal; Region: PilX_N; pfam14341"
                     /db_xref="CDD:258514"
     gene            434954..438196
                     /gene="pilY1"
                     /locus_tag="CNE_1c04390"
                     /db_xref="GeneID:10916830"
     CDS             434954..438196
                     /gene="pilY1"
                     /locus_tag="CNE_1c04390"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly protein PilY"
                     /protein_id="YP_004684285.1"
                     /db_xref="GI:339324592"
                     /db_xref="GeneID:10916830"
                     /translation="MTTNACRQRRLAAFAIALLTFAGVNRARAEDIDLFTGLQTNAGT
                     KPNVLLLLDNASTWNASTTIKGCDIPDVVSANNAGTDVGAIQCALYRAVNTLVTNPQL
                     AGNINMGLMMFGTSTNTGGIFRYPSAAPYTLPTMDATNGNAFLQYIKSIDRQRDNSNN
                     SQVGGGMQEAWAFFAGKKGLSGTQYTSPITNPCQKNFVIYIANAVNNGKPQDTGTDAK
                     DALVAAGANATQLTTLKLNPAANKYESNWGDEWARFMYQTDVNGNVENNQNIITYTIA
                     VTDDNNPDYVESTRSMGDNGGGKRYVVKLGDVQALVDALLQIFNEMQAVNNVFSSVSL
                     PVSVNGQGSYLNQIYIGMFRPDATAAPRWMGNLKQYKLGYDSSKQIVVLDANPSGPNQ
                     QSAISNAGTGFISPNAKSFWTAEPPLAFSGSSYSGSAVTGWPAKGFWVNSPSGAAGAL
                     DSADGAAGVTGGDGEIVEKGGAGEMLRAQIVTDQAARKLYTCPSGACTAKVLASFDTA
                     NTWLTNATGQTALNSSAADVKNLINWVRGRDVQALGESTVAGTEQQKGPGGSVTVRGS
                     VHGDVLHSRPVVINYGGTTGVVVFYGANDGVFHAVNGNQTTGINGVRPGGELWGFVPP
                     EFYGKLGRLYTNTPEVQLSGSPTGSGAKPRDYFFDGTTTVFQDLRDPANPRVVIYLTA
                     RRGGRLVYALDVTNPVAPEFLWKSDSNQIAELGQTWSQPRVIRVKGYTNPLVVMGAGY
                     DAAEDAEPSQGGGATGQGRGVIVFDALTGTVVRAWLADCTGLGATVCSVPAGLNRAIP
                     SDVAVVDRNGDGLIDKGYVGDMGGNVWRLDFETAAGTGPAAWTLGKFAALGGAQTSND
                     ARKFMYPPDVITTGAYDAVMIGSGDREHPLYTTSNAAGLAYNVTNRFYMLKDTALTGG
                     LPATWTPLTESSLFNATATVYADSGTGKGFYLTLGTGEKVVNAPLTVAGYTYFGTNTP
                     SVPKSGACYPDLGIARGYAVSFLTGKGLNDNRYVQFNNGGLPPSPVFGVVAVSDAQGN
                     TSNVPVLIGGGNQNGPGGGDNTSSLGAQKISPPGIGKRKRTYWYTQSDKK"
     misc_feature    434972..438175
                     /gene="pilY1"
                     /locus_tag="CNE_1c04390"
                     /note="Tfp pilus assembly protein, tip-associated adhesin
                     PilY1 [Cell motility and secretion / Intracellular
                     trafficking and secretion]; Region: PilY1; COG3419"
                     /db_xref="CDD:225953"
     misc_feature    436658..>437476
                     /gene="pilY1"
                     /locus_tag="CNE_1c04390"
                     /note="Neisseria PilC beta-propeller domain; Region:
                     Neisseria_PilC; pfam05567"
                     /db_xref="CDD:253258"
     gene            complement(438210..439700)
                     /gene="ttgC1"
                     /locus_tag="CNE_1c04400"
                     /db_xref="GeneID:10916831"
     CDS             complement(438210..439700)
                     /gene="ttgC1"
                     /locus_tag="CNE_1c04400"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux pump outer membrane protein TtgC"
                     /protein_id="YP_004684286.1"
                     /db_xref="GI:339324593"
                     /db_xref="GeneID:10916831"
                     /translation="MSRLTPVFVAAALLCGCAVGPDFRAPAPPDDAGYVPGPQPVATV
                     AADAADAGGQSHAQTLAAGADVPAQWWALFRSPALDATIRGALDASPTLAQARARLRE
                     AQENLAARTGATRWPAVDAKLNTTRQQVDFQSLGITAIPSPGPFTLYGATVQVSYVLD
                     LFGGQRRELEGLQAAVDYQRYELEAARLALTANVATAAIREAGLRAQLADTAAVAAAQ
                     QRQLGITEERLRAGGVARVDVQRQRAELAQTQALVPALQRQLDATRHQLAVYTGQTPA
                     SATLPEFRLDELQLPDTLPVSLPATLARRRPDIRAAEALLHQASANIGVATANLYPQI
                     TLSANGGTQATAARDLFSSLNVWSLAAGLVQPVFRGGELQARKRAAEAAYEQSLAAYR
                     QAVLQGLQNVADSLRALEADAAALRERADSARQARDTLAVVSEQYRLGGVSQLAVLDA
                     ERQSRQASLELAQARANRLADSAALLQALGGGWWKEEGGAVAAAPR"
     misc_feature    complement(438264..439661)
                     /gene="ttgC1"
                     /locus_tag="CNE_1c04400"
                     /note="efflux transporter, outer membrane factor (OMF)
                     lipoprotein, NodT family; Region: outer_NodT; TIGR01845"
                     /db_xref="CDD:233595"
     misc_feature    complement(438885..439466)
                     /gene="ttgC1"
                     /locus_tag="CNE_1c04400"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(438264..438809)
                     /gene="ttgC1"
                     /locus_tag="CNE_1c04400"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            complement(439712..440875)
                     /gene="ybhS"
                     /locus_tag="CNE_1c04410"
                     /db_xref="GeneID:10916832"
     CDS             complement(439712..440875)
                     /gene="ybhS"
                     /locus_tag="CNE_1c04410"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane transport permease YbhS"
                     /protein_id="YP_004684287.1"
                     /db_xref="GI:339324594"
                     /db_xref="GeneID:10916832"
                     /translation="MTAAARKPAAQQRFSLQRWWSIVLKEFLQLRRDRVTFGMIIGLP
                     IMQLLLFGFAINTDPRHLPTAVIAADQSEFTRSFIASMEQSTYFKLVGTLPDEQAGRE
                     ALMKGEVQFVLTIPPDFTRRLLRGERPALLVEADATDPSATGQAIAALPQLPYRVATH
                     DLKGPLAPLAGGKPPFDVQVQRLYNPEGITQYNIIPGLMGVILTMTMVMMTGLAMTRE
                     RERGTMENLLATPVRPLEVMTGKIVPYIFIGLIQSTIVLLAARWIFSVPFVGSVLAVY
                     LAALLFIAANLTVGITLSSLAQNQLQAMQLTFFYFLPNILLSGFMFPFAGMPGWAQAI
                     GNILPMTYFHRMVRGILLKGNGWVELWPNVWPMALFIVVVMAIAVRFYRRTLD"
     misc_feature    complement(<440507..440803)
                     /gene="ybhS"
                     /locus_tag="CNE_1c04410"
                     /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
                     cl19580"
                     /db_xref="CDD:267933"
     misc_feature    complement(439736..440776)
                     /gene="ybhS"
                     /locus_tag="CNE_1c04410"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     misc_feature    complement(439820..440326)
                     /gene="ybhS"
                     /locus_tag="CNE_1c04410"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     pfam01061"
                     /db_xref="CDD:250332"
     gene            complement(440872..441840)
                     /locus_tag="CNE_1c04420"
                     /db_xref="GeneID:10916833"
     CDS             complement(440872..441840)
                     /locus_tag="CNE_1c04420"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_004684288.1"
                     /db_xref="GI:339324595"
                     /db_xref="GeneID:10916833"
                     /translation="MNTTINGGAAGLAIDVRGLNKHFGDKHVVNDLSMQVARGEIFGF
                     LGPNGSGKTTSIRMMCGLLTPDSGTGTCLGYDIRSESDEIKRRVGYMTQKFSYWDDLS
                     IRENLDFVARVYGMPNRREAVDRALEHLGLATRSAQLAGALSGGWKQRLALAACLLHE
                     PELLLLDEPTAGVDPKARRDFWEQLHQLAARGISVLVSTHYMDEAERCHKLAYIAYGK
                     LLAQGTADEVVASQNLSTWSVEGDDLAALSEQLQGAPGVEQTVAFGTALHVTGRDAQA
                     LADTLARLAGPGRRVEQTQTSLEDVFIHMMSGAEDNMAARKAREAS"
     misc_feature    complement(440917..441804)
                     /locus_tag="CNE_1c04420"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(441184..441801)
                     /locus_tag="CNE_1c04420"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(441682..441705)
                     /locus_tag="CNE_1c04420"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(441241..441243,441562..441564,
                     441679..441687,441691..441696))
                     /locus_tag="CNE_1c04420"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(441562..441573)
                     /locus_tag="CNE_1c04420"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(441385..441414)
                     /locus_tag="CNE_1c04420"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(441319..441330)
                     /locus_tag="CNE_1c04420"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(441235..441255)
                     /locus_tag="CNE_1c04420"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            complement(441837..442817)
                     /locus_tag="CNE_1c04430"
                     /db_xref="GeneID:10916834"
     CDS             complement(441837..442817)
                     /lo