GenomeNet

Database: RefSeq
Entry: NC_015727
LinkDB: NC_015727
Original site: NC_015727 
LOCUS       NC_015727            1499175 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Cupriavidus necator N-1 plasmid BB1p, complete sequence.
ACCESSION   NC_015727
VERSION     NC_015727.1  GI:339327781
DBLINK      Project: 68689
            BioProject: PRJNA68689
KEYWORDS    RefSeq.
SOURCE      Cupriavidus necator N-1
  ORGANISM  Cupriavidus necator N-1
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Cupriavidus.
REFERENCE   1  (bases 1 to 1499175)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Complete genome sequence of the type strain Cupriavidus necator N-1
  JOURNAL   J. Bacteriol. 193 (18), 5017 (2011)
   PUBMED   21742890
REFERENCE   2  (bases 1 to 1499175)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1499175)
  AUTHORS   Poehlein,A., Kusian,B., Friedrich,B., Daniel,R. and Bowien,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2011) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen,
            Lower Saxony 37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002879.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1499175
                     /organism="Cupriavidus necator N-1"
                     /mol_type="genomic DNA"
                     /strain="N-1"
                     /isolation_source="soil"
                     /culture_collection="ATCC:43291"
                     /db_xref="taxon:1042878"
                     /plasmid="BB1p"
                     /country="USA: University Park, PA"
                     /note="type strain of Cupriavidus necator"
     gene            101..1312
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /db_xref="GeneID:10915780"
     CDS             101..1312
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein A"
                     /protein_id="YP_004687474.1"
                     /db_xref="GI:339327782"
                     /db_xref="GeneID:10915780"
                     /translation="MVKTSQLPAVDRTVPLEQISQFAERVTIFTDELRETILAPRPRK
                     TAPIFKTGEIADLCNISHSQVQYLATKGDGELPPGKAAGTGRTRTFTLEEARIWVQKV
                     SDIYQTPLVTGTREPEGKIIITAQLKGGSAKTTTTMCLAQGLTLRGRKVLVVDLDPQA
                     SLSELCGLYAEKDVTPEDTVLPYIYDQQIEGGLQGSIQSTYWDGLDLIPAHTELIGAE
                     FHLPAMQKIKPGFRFWTVLREGLEPLRKHYDYILMDTSPSLSYMNLNALLAADAMVMP
                     MVPENLDFISSLSFWRLFSDVSKSFIKYEADKKYDFVSLLLSKVDYGRTSSAPIVRAW
                     AQSAYEKWLHSIEVPASSVMSTGALAFSTVFDVSSTHSAAKSLTRVRQPIMDYCRWLD
                     EIYAEKWRSAQ"
     misc_feature    119..1237
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /note="plasmid-partitioning protein RepA; Provisional;
                     Region: PRK13869"
                     /db_xref="CDD:139929"
     misc_feature    461..1054
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    482..>871
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    482..502
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(500..502,860..862)
                     /gene="parA1"
                     /locus_tag="CNE_BB1p00010"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            1309..2280
                     /gene="parB"
                     /locus_tag="CNE_BB1p00020"
                     /db_xref="GeneID:10914989"
     CDS             1309..2280
                     /gene="parB"
                     /locus_tag="CNE_BB1p00020"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein B"
                     /protein_id="YP_004687475.1"
                     /db_xref="GI:339327783"
                     /db_xref="GeneID:10914989"
                     /translation="MSNMREQLLAKTAGIRKTSAINQDEVKRSDRTQTAPGLTGALAV
                     AQLRVQELEATGVASQLAVADIVPNPWQPRRVFNELKLSELAESIREVGLMQPIVVRR
                     AESGYQIVAGERRWRAHKMLGLDTVKAVVVECSDADMAVLAMVENISRDDLSDYEIAL
                     SVRQTEKEFPSRVRLAEALGLSKSGLYRFLSFAQLPDFVLKDLDLQPRLLGGSAAEAI
                     VTTIRKYGEAGNDAAKEIWPLVASGKMEQGKVAGAIKALATRRASAPSSASERSIDKF
                     FSGKEQAGSITKDVNGFTVKIRAGVLSEALETQIRQLISESFHHQPK"
     misc_feature    1483..2016
                     /gene="parB"
                     /locus_tag="CNE_BB1p00020"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    1489..1752
                     /gene="parB"
                     /locus_tag="CNE_BB1p00020"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     gene            2368..4005
                     /locus_tag="CNE_BB1p00030"
                     /db_xref="GeneID:10914990"
     CDS             2368..4005
                     /locus_tag="CNE_BB1p00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687476.1"
                     /db_xref="GI:339327784"
                     /db_xref="GeneID:10914990"
                     /translation="MGRSLARLGDLPSLGRCQARLNDLPKLGRCPARMARQPFQVGTV
                     RTAHRPSQVGTVPRTARRPSQVGTVPRTARRPSQIGTVPRTHGSPTFLSWGGAPTARR
                     PSQVGTEPRTVRRPSQVGTVPLTARQPSQVGTVPRTARQASQVGTVPRTARQASQVGT
                     VPGMARQSSQVGTVPVRLVDLPGWDGARRASPTFPNWDGVRHGSPAFPSWDDAPHGSP
                     TFPSWDGAPHSSPTFPSWDGAPHSSPTFPSWDGAPHSSPTFPSWDGAPHGSPRFPSWG
                     GAPHGSPIFPSWDGARHGSPIFPSWDGARHGSPTFPNWDGPARMPAFPSWDGAPHGSP
                     SFPSWDGARHGSPIVPSWDGARTARQASQVGTMPRTARADLRKLGRCQARLASLPKLG
                     RCPARLTDLPKLGRCPAWLANRPKLGRCPYGSPSFPGWDDAPHGSPTFASWDGVRHGS
                     PAFPSRDGAPHGSPRFPSWDGAPHGSPIFPSWDDARHGSPTFPNWDDARHGSPTFPNW
                     DGPARMPAFPSWDGAPHGSPTFPSWDGARYARADLPS"
     misc_feature    <2458..3669
                     /locus_tag="CNE_BB1p00030"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(4537..5706)
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /db_xref="GeneID:10914991"
     CDS             complement(4537..5706)
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-based site-specific recombinase
                     activity site-specific DNA integration"
                     /protein_id="YP_004687477.1"
                     /db_xref="GI:339327785"
                     /db_xref="GeneID:10914991"
                     /translation="MNTSPLTPNALPSPVLPGGLSDAELVRAWLDAKAAAGLGLRAST
                     CSQYELEARRLLWYADAQGRPLATWQVTHASDYLTFLRDPPAHAVSNGRVRRGSAAWR
                     PLRGPLSEASRRQSAVIVGSLFDWLVRVGALRINPFAPVPRERSATGPGSQRRFLELE
                     QVAAVFEAIEARPAPTRWAQLHQARDRLLVALLFQTGLRASEVAALTWADFERHPGRS
                     RAFWTVRIRQAKGGNDQLVPCDNAMDELARFRRLVGLPPMPSPTDTAAVIPAIAGGRQ
                     RAVPPVDPFELQRKLSRPLRTRQGIYAIVRTAFAEAADRLEREDRSEEAARLRGASTH
                     WLRHTHATHLLRAGVPVTDVQRALRHRDINTTRRYTHEALEDVALALAGKIPGAA"
     misc_feature    complement(4576..5643)
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /note="Site-specific recombinase XerD [DNA replication,
                     recombination, and repair]; Region: XerD; COG4974"
                     /db_xref="CDD:227308"
     misc_feature    complement(4594..5241)
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(4600..4602,4705..4713,5017..5019,
                     5107..5112))
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(4600..4602,4627..4629,4696..4698,
                     4705..4707,5017..5019,5110..5112))
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(4600..4602,4627..4629,4696..4698,
                     4705..4707,5110..5112))
                     /gene="int"
                     /locus_tag="CNE_BB1p00040"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(5836..6042)
                     /locus_tag="CNE_BB1p00050"
                     /db_xref="GeneID:10914992"
     CDS             complement(5836..6042)
                     /locus_tag="CNE_BB1p00050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687478.1"
                     /db_xref="GI:339327786"
                     /db_xref="GeneID:10914992"
                     /translation="MRGVACIRWGFDTHGKDALEVVSNAAIGGTARPLSWNDFLPADD
                     IGLGLRCPCGRRTLFTIIRIMVND"
     gene            complement(6382..6612)
                     /locus_tag="CNE_BB1p00060"
                     /db_xref="GeneID:10914993"
     CDS             complement(6382..6612)
                     /locus_tag="CNE_BB1p00060"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687479.1"
                     /db_xref="GI:339327787"
                     /db_xref="GeneID:10914993"
                     /translation="MSYESPSLLGLLSMVEAGWAVAPLARCAVPQHFTILGQPQRLPE
                     LASLELVLARSAKSNRPPCDFLAEQIISELHR"
     misc_feature    complement(6430..>6606)
                     /locus_tag="CNE_BB1p00060"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            6880..7026
                     /locus_tag="CNE_BB1p00070"
                     /db_xref="GeneID:10914994"
     CDS             6880..7026
                     /locus_tag="CNE_BB1p00070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687480.1"
                     /db_xref="GI:339327788"
                     /db_xref="GeneID:10914994"
                     /translation="MASREGKLVLKRMRLEASSVSEDIILANSELAWYLGQFVFGRMA
                     SLRA"
     gene            complement(7108..7329)
                     /locus_tag="CNE_BB1p00080"
                     /db_xref="GeneID:10914995"
     CDS             complement(7108..7329)
                     /locus_tag="CNE_BB1p00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687481.1"
                     /db_xref="GI:339327789"
                     /db_xref="GeneID:10914995"
                     /translation="MACASPAYLAKHGTPVAPPDLSTHDLLGFDECLGCLFPAHLTAG
                     SWKFRDQSGVYDLPIKPRIRSNNNFGSTC"
     misc_feature    complement(<7129..>7323)
                     /locus_tag="CNE_BB1p00080"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            complement(7329..7472)
                     /locus_tag="CNE_BB1p00090"
                     /db_xref="GeneID:10914996"
     CDS             complement(7329..7472)
                     /locus_tag="CNE_BB1p00090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687482.1"
                     /db_xref="GI:339327790"
                     /db_xref="GeneID:10914996"
                     /translation="MVANYLDRYPQVQVELLLVDRCVDLVSEGFEAAIQLGSPFDASL
                     RTA"
     misc_feature    complement(<7341..7469)
                     /locus_tag="CNE_BB1p00090"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            complement(7655..8452)
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /db_xref="GeneID:10914997"
     CDS             complement(7655..8452)
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687483.1"
                     /db_xref="GI:339327791"
                     /db_xref="GeneID:10914997"
                     /translation="MTTQHPAANDLRVALNTPASAVVVTGGASGIGEACAAALAAIGR
                     PVAIWDIQEDKARAVAAAIADRYGVPAFGLGIDLRAPAGLEDALVRTRASLPALGGMV
                     HAAGVVDQSGIDGLTQARWDAVLDVNLRAMALLVQAMLPDLRAQPGAAVVGIASINAT
                     LGNALIPAYSASKGGLLSLVRSLADSLGRDRIRINAVSPGQIHTPMLQPAIDALPEGT
                     FERRIQLGRLGTPAEIGRVVRFLLSDEASYVTGTELIVDGGNIPSQR"
     misc_feature    complement(7676..8389)
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(7682..8389)
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(7838..7843,7847..7858,7934..7936,
                     7946..7948,7985..7993,8072..8074,8135..8143,8219..8227,
                     8297..8305,8360..8371,8375..8377))
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(7934..7936,7946..7948,7985..7987,
                     8069..8071))
                     /gene="fabG1"
                     /locus_tag="CNE_BB1p00100"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(8671..9840)
                     /locus_tag="CNE_BB1p00110"
                     /db_xref="GeneID:10914998"
     CDS             complement(8671..9840)
                     /locus_tag="CNE_BB1p00110"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004687484.1"
                     /db_xref="GI:339327792"
                     /db_xref="GeneID:10914998"
                     /translation="MTRPPWLDVQHPGQSALGVDEISDLIGLVYDGPLLDIPWQSLLD
                     ALRHLLAANYVTLVLRPPSNTSPGLMITSSAVDTTVGTGAYAQHFYAIDPFVNLPNEQ
                     VLTAYELIGETRWLESEIYRFFNKPYDVLHIMGVDIRPEQGMECRLRVCRPHGSDSFS
                     NADKALCQRIVPHLQRAVRIHANLNTTESERRLYAGTVDRLLIGSVILDDTGQILTTN
                     GLADALLAEKDGLMACNGQLMVDSAQENRKLQALIRQAMTLRDSVQPGIPIGLSVSRQ
                     GDHARLGLLVRPIAAQKWAQRPRQPAVAVFIRDPDQKALASADLLRNMFEFTRAEASL
                     VLLLTQGMSLDEAAQELDIRRNTARAHLRAVFSKTGVTRQAALVQTVLQSIIPLG"
     misc_feature    complement(8689..8871)
                     /locus_tag="CNE_BB1p00110"
                     /note="DNA-binding HTH domain-containing proteins
                     [Transcription]; Region: CsgD; COG2771"
                     /db_xref="CDD:225360"
     misc_feature    complement(8692..>8862)
                     /locus_tag="CNE_BB1p00110"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(order(8719..8721,8752..8766,8770..8775,
                     8779..8784,8806..8814,8851..8859))
                     /locus_tag="CNE_BB1p00110"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(8713..8721,8812..8814,8818..8820,
                     8824..8826))
                     /locus_tag="CNE_BB1p00110"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            10148..11236
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /db_xref="GeneID:10914999"
     CDS             10148..11236
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /EC_number="1.17.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketosteroid-9-alpha-hydroxylase oxygenase
                     subunit"
                     /protein_id="YP_004687485.1"
                     /db_xref="GI:339327793"
                     /db_xref="GeneID:10914999"
                     /translation="MEAQHILQTTPPDNRYARGWHCLGQASDYKDGKPHRLDIFGTRL
                     VAFTGEDGRIRILDAWCPHMGADLALGEVKGKAIVCRFHGWHWNGEGACEHVPCAKRI
                     PPKARTRAWTVCEQNHLLFIWHDPEGAPPPPAVAVPRISACFTGEWTGWTIRKMVIGT
                     NCRELVDNLADVAHFGPVHGSPAVYFCNTFDRHIGYQMFRGEESELLGRGLVADSAYF
                     GPAYHVTRMTAEVDGKPLDTILLNCHVPIDSQSFELRYGVMVKKVPGQSEEQNQEMAQ
                     AYVEQAQASFFQDVEIWHNKIRVDRPVLSDADGPIYQLREWYRQFYTDVADLPADHDR
                     KKVFERRDGTWHTLDAVPPEAVSKLHQI"
     misc_feature    10199..11137
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    10202..10531
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    order(10328..10330,10334..10339,10385..10387,10391..10396,
                     10400..10402,10406..10408)
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(10328..10330,10334..10339,10385..10387,10394..10396,
                     10400..10402)
                     /gene="kshA"
                     /locus_tag="CNE_BB1p00120"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            11251..12078
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /db_xref="GeneID:10915000"
     CDS             11251..12078
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687486.1"
                     /db_xref="GI:339327794"
                     /db_xref="GeneID:10915000"
                     /translation="MRLEGKVALITGAGSGMGRAMAVRFAAEGAAVVVVDRDAGAAQA
                     TLDMIGGEAHGMARGCDVADSGAVRALHEAVAQRWGRLDILVNNAGIGQVPGDGFEHY
                     QERAAERGRQLAAGETPTVYTDMIVDLNDAGWQRVVDVNLNGTFYCSREAVRLMTRAG
                     VGGAIVNIASVSALSGEGPLSYCASKAAVLGLTRCLARDLGPRGIRVNAICPGPTRTP
                     MMQSISDEWVRSLERAIPLGRMAEPEEIAAAALFLVSGDGRQMTGQTLSVSGGMAMI"
     misc_feature    11251..12072
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    11272..12054
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(11284..11286,11290..11301,11356..11364,11428..11436,
                     11512..11520,11668..11670,11752..11760,11794..11796,
                     11806..11808,11884..11895,11899..11904)
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(11671..11673,11758..11760,11794..11796,11806..11808)
                     /gene="fabG2"
                     /locus_tag="CNE_BB1p00130"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            12150..12980
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /db_xref="GeneID:10915001"
     CDS             12150..12980
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dichloro-2,5-cyclohexadiene-1,4-diol
                     dehydrogenase LinX"
                     /protein_id="YP_004687487.1"
                     /db_xref="GI:339327795"
                     /db_xref="GeneID:10915001"
                     /translation="MRVTGRLQDKVALISGAGTGIGAATAARFAAEGAKVMLCGRREA
                     PLRAVAEEIRSHGGDAAWIRADVTNEADVERVVIQTVAQFGGLHVMVNNAVNYTWGTL
                     DEVSTESWRQCLSGSLDVAFFGTRAALRVMKAAGGGAIVNLGSVVGLLGSPGLSAYGA
                     AKAGVLNFSRAVALEGAAHNVRVNVVIPGVVWSEGTREALVSEEIARGTARAVPLGRL
                     GEPHEVAGAILFLASDEASYITGQSLVVDGGKTCRLDVGATDYVSQTSAERRAEPQAN
                     "
     misc_feature    12165..12896
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    12183..12890
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(12195..12197,12201..12212,12267..12275,12342..12350,
                     12426..12434,12495..12497,12576..12584,12621..12623,
                     12633..12635,12711..12722,12726..12731)
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(12498..12500,12582..12584,12621..12623,12633..12635)
                     /gene="linX"
                     /locus_tag="CNE_BB1p00140"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            13025..13666
                     /locus_tag="CNE_BB1p00150"
                     /db_xref="GeneID:10915002"
     CDS             13025..13666
                     /locus_tag="CNE_BB1p00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687488.1"
                     /db_xref="GI:339327796"
                     /db_xref="GeneID:10915002"
                     /translation="MALDAAQTESLQARLDRLESIEEIRMLPAKYALALDMRDLDAWT
                     SLFPEDVAVGKDQVGREHLRRWMDETLRNQFTVTSHHVGGHIIEFQDADHASGVVYSK
                     NEHETGPEWVIMQMLYWDDYERIGGRWHFRRRLPCYLYASDLNKPPIGDKKMRWPGRE
                     PYDGSWHALWPSWKAFWNAKPDASLPSIAEPVPLDRFLATMRRGSVLPKVRTR"
     misc_feature    13094..13426
                     /locus_tag="CNE_BB1p00150"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cd00531"
                     /db_xref="CDD:238296"
     gene            13700..14812
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /db_xref="GeneID:10915003"
     CDS             13700..14812
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase NemA"
                     /protein_id="YP_004687489.1"
                     /db_xref="GI:339327797"
                     /db_xref="GeneID:10915003"
                     /translation="MSTRLFEPLLLGDIALANRIVMAPMTRSRAGAGDLPTDLHQTYY
                     AQRAGAGLIVAEGTYPSRHGKGYCRTPGIETATQIDAWREVTGIVRSQGAAMVLQLMH
                     VGRVATRHNKAADAQTVAPSGIRARGTIYADGHGLVEMETPHALTGHEIVAVINEYRQ
                     AAVNARAAGFDGVELHCSSGYLPMQFLLACANQRRDGYGGSLTARLRFVVETLEAIAG
                     AIGVGRVGLRICPDNPYNDMQDDDPTATYSALLDAVAPIGLAYLHVSRSPNPALDAFA
                     LARRHFGGALILNDGFDGSSAERAVAGGVGEAVSFARHFIANPDLPVRLRHSAPLAAF
                     DRTLLYTPGARGYTDYPGAAALAASGQIVPQGGLQP"
     misc_feature    13712..14707
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(13769..13771,13775..13777,13868..13870,13994..13996,
                     14381..14383,14567..14569,14627..14629,14633..14641)
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(13769..13771,13775..13777,13868..13870,13994..13996,
                     14000..14002,14021..14023,14225..14227,14234..14236,
                     14240..14242,14381..14383,14402..14404,14567..14569,
                     14627..14629,14633..14638)
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(13775..13777,14000..14002,14225..14227,14234..14236,
                     14240..14242,14636..14638)
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    14240..14242
                     /gene="nemA1"
                     /locus_tag="CNE_BB1p00160"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
     gene            14809..16386
                     /locus_tag="CNE_BB1p00170"
                     /db_xref="GeneID:10915004"
     CDS             14809..16386
                     /locus_tag="CNE_BB1p00170"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_004687490.1"
                     /db_xref="GI:339327798"
                     /db_xref="GeneID:10915004"
                     /translation="MSDCLPLIPTIPNAVARTARLYADAVAIEEDGLSMQYSALHEAA
                     RAAARALMALGVAPGERVAVWAPNLHEWIVAALGIQMAGGVLVPLNTRLKGGEAADIL
                     TRSGARVLISIGEFLGVDYPAMLGGHALPALQQRVILRGEREGALSWEAFLARAEDTP
                     EAMLDARIAALTPDSPSDLLYTSGTTGRPKGVITTHGQNLRAFSDWSYIVGLRAGDRY
                     LIINPFFHAFGYKAGWLAALLRGATILPLAQFDAEAVLARVERYRVSFLPGSPTLYLS
                     LLAHPRLDAYDLSSLRVAVTGAASIAPELIRRMRKVLGFDVVLTAYGLTECCGLATVC
                     RLGDALQTIANTSGRPLAGVEIRCVDVEGNDVAAGEPGEVWIRGYNVMRGYFYDDAAT
                     REAIDSAGWLHTGDIGNLDAVGNLSITGRLKDMFIVGGFNCYPAEIEHLIGAHPAVAQ
                     VAVVGVPDARLGEVGRAFVVLREGERLNAEALLEWCRPRLANYKMPRSVTFMAALPTN
                     AAGKVEKLDLMSKFQSA"
     misc_feature    14836..16353
                     /locus_tag="CNE_BB1p00170"
                     /note="long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07656"
                     /db_xref="CDD:236072"
     misc_feature    15325..16362
                     /locus_tag="CNE_BB1p00170"
                     /note="Uncharacterized subfamily of fatty acid CoA ligase
                     (FACL); Region: FACL_like_2; cd05917"
                     /db_xref="CDD:213284"
     misc_feature    order(15343..15345,15352..15369,15373..15378)
                     /locus_tag="CNE_BB1p00170"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213284"
     misc_feature    order(15352..15354,15697..15702,15766..15783,16024..16026,
                     16060..16062,16069..16071,16102..16104,16342..16344)
                     /locus_tag="CNE_BB1p00170"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213284"
     misc_feature    order(15352..15354,15472..15477,15616..15618,15622..15627,
                     15634..15636,15697..15702,15766..15783,16024..16026,
                     16060..16062,16069..16071,16093..16104,16285..16287)
                     /locus_tag="CNE_BB1p00170"
                     /note="putative active site [active]"
                     /db_xref="CDD:213284"
     misc_feature    order(15472..15474,15622..15627,15634..15636,15697..15699,
                     16093..16101,16267..16269,16285..16287)
                     /locus_tag="CNE_BB1p00170"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213284"
     gene            17380..18227
                     /locus_tag="CNE_BB1p00180"
                     /note="DSBA oxidoreductase"
                     /pseudo
                     /db_xref="GeneID:10915005"
     gene            complement(18378..20474)
                     /locus_tag="CNE_BB1p00200"
                     /db_xref="GeneID:10915006"
     CDS             complement(18378..20474)
                     /locus_tag="CNE_BB1p00200"
                     /EC_number="6.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="YP_004687491.1"
                     /db_xref="GI:339327799"
                     /db_xref="GeneID:10915006"
                     /translation="MPEFPDLSRLVRPRNILVVGGSQRPNSEGARLLENLTRHSRLRG
                     EVFVVHPKMQDAEGYRCWPSVAAVPPAPIDVALVMVRVELVLDALRDCAAREIPFAIV
                     MSSGFAEAGAEGQAIEAEIKKLCDETGLRVYGPNCPGLTNLTDRIGMTFSPAFQSDIH
                     AGSVGIVTQGGGSGRNILQGLSHGVGAALWMSGGNELDLGAPDFIAHMASDPQIRVIA
                     VLLEGIKHGTRLIAALDLARQHRKPVVVLKVGRSEYGVRAAQSHTGSIAGAAAVNSAV
                     FRQFGAIEVEELDDLVAVSRLLAGERPPTSRKLAILTFSGGAAAMAADQAGLQGLELA
                     DFLPATTEGLRERLPGFAAVSNPVDVTAEALKRTDALAGCLRLVAEDPDVGAVLVPIP
                     ADYGPVTDNIASAIIDASANAPRPIVPVWMSRRHGAGFRMLEEAGLAPFVSLSKALNA
                     LKLAAPKAREGATLVAPPPAAATPARHLLPYNEATAKRILGQSGITVPRGVLVRSADE
                     VESVAAEIGFPLVMKVSSAQILHKTEVKGVHLNIRSEEQATAAYARILADVAARRPNA
                     TIDGVLMERMYDTRGREMLVGVHRDPAFGPVLTVGLGGIFVELLKDVSHRVLPIGKED
                     ALDMLSELRNAAYLGAFRDAPSADVDALANLLVQVSGFAVSHPEIEEAELNPVWVGPQ
                     GEGAVALDALILTAGH"
     misc_feature    complement(18615..20459)
                     /locus_tag="CNE_BB1p00200"
                     /note="Acyl-CoA synthetase (NDP forming) [Energy
                     production and conversion]; Region: COG1042"
                     /db_xref="CDD:223972"
     misc_feature    complement(20055..20435)
                     /locus_tag="CNE_BB1p00200"
                     /note="CoA binding domain; Region: CoA_binding_2;
                     pfam13380"
                     /db_xref="CDD:257707"
     misc_feature    complement(19581..19994)
                     /locus_tag="CNE_BB1p00200"
                     /note="Succinyl-CoA ligase like flavodoxin domain; Region:
                     Succ_CoA_lig; pfam13607"
                     /db_xref="CDD:257921"
     misc_feature    complement(18396..19049)
                     /locus_tag="CNE_BB1p00200"
                     /note="ATP-grasp domain; Region: ATP-grasp_5; pfam13549"
                     /db_xref="CDD:257867"
     gene            complement(20567..21532)
                     /locus_tag="CNE_BB1p00210"
                     /db_xref="GeneID:10915007"
     CDS             complement(20567..21532)
                     /locus_tag="CNE_BB1p00210"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor family protein
                     136"
                     /protein_id="YP_004687492.1"
                     /db_xref="GI:339327800"
                     /db_xref="GeneID:10915007"
                     /translation="MKKLLAFAAATAVMAPMGMARAETAAYPSAPVKIAVGFAAGGGT
                     DLLARFYAKRLGEKLGQPFVIENRPGKGGAIAVQTTVHAQPNGYALVIGTTGIAVDAA
                     LGESKYDWKRDLTPIAPLAYSANVLVVSSQSNIRSVDDLLQEARRRHLTFGSAGVTTS
                     MHMTGELFKQMAGIEMTHVPYRGAAPAEQALLSGEIDVIFDNVAGAASFIEAGKFRPL
                     AISSRTRSGELPNVPTMEESGLKGFETTGSFFLLAPARTPPAVLKRLESVVGEITREP
                     DTVAYLRKLHMVPLNGGSAVVTQMLSAEYEKWRKLVAAKGVSLSK"
     misc_feature    complement(20585..21391)
                     /locus_tag="CNE_BB1p00210"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(21611..22957)
                     /locus_tag="CNE_BB1p00220"
                     /db_xref="GeneID:10915008"
     CDS             complement(21611..22957)
                     /locus_tag="CNE_BB1p00220"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="YP_004687493.1"
                     /db_xref="GI:339327801"
                     /db_xref="GeneID:10915008"
                     /translation="MTQVPAMTGITERAARFAVDRTSPIPADALDIARLSFFDGLTVA
                     LAGAREPVGAAVRKLVALEGGAPQASAFGLAGRVPARAAALLNGTVAHALDYDDTHFD
                     FVGHPTVAVLPAALAVAEQTQASGRELLEAFLTGVEVACRVGAWLGRPHYNAGFHQTA
                     TSGTFDATATAARLLGLDAAQASHALGLAATRAAGLKCQFGTMVKPFHAGMAAANGVE
                     CATLASLGLVARPDALECAGGFASTHGASPDATDLFEAEGHRFVDVQYKFHACCHGTH
                     PALEALTALRDQSRLRCEDIEAVTLVIHPQWLPVCCIPSPRTGLELKFSLAMTAAMVL
                     AQIDTGALGSFSDAACQDSALTALARRIAIETDASLPDTACHVSIKTRGGASLTLGLD
                     LAEPVPYSLKTAKLRRKASALLGKERAGGLWEMAGCLDRLDASVLYPRLHDLLAAA"
     misc_feature    complement(21857..22942)
                     /locus_tag="CNE_BB1p00220"
                     /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
                     /db_xref="CDD:260693"
     gene            complement(22975..23745)
                     /locus_tag="CNE_BB1p00230"
                     /db_xref="GeneID:10915009"
     CDS             complement(22975..23745)
                     /locus_tag="CNE_BB1p00230"
                     /EC_number="2.3.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase"
                     /protein_id="YP_004687494.1"
                     /db_xref="GI:339327802"
                     /db_xref="GeneID:10915009"
                     /translation="MIKTEIGFTTIDKITVRGLDLSNDIIGKFDFIDMIFHTTLVRLP
                     EAREKAMVNAILVTTADHGITPSALAARLTYAGAPEALQGAVAAGLLGAGNVFLGTMQ
                     NAAEMLREGAQELADDASGEAVHDVARNLIRRYREARRPIFGLGHPIHIHGDPRVPAL
                     RELSRRHGYYGKHWRLMDAIGEVFGEEKGKSLPLNAVAAIGAMIAELALDPLMARGLA
                     IVGRSAGLLAHVVEEKQAPIASKAWLHVLSADSRNELP"
     misc_feature    complement(23005..23694)
                     /locus_tag="CNE_BB1p00230"
                     /note="Citryl-CoA lyase (CCL), the C-terminal portion of
                     the single-subunit type ATP-citrate lyase (ACL) and the
                     C-terminal portion of the large subunit of the two-subunit
                     type ACL. CCL cleaves citryl-CoA (CiCoA) to acetyl-CoA
                     (AcCoA) and oxaloacetate (OAA); Region: CCL_ACL-C;
                     cd06100"
                     /db_xref="CDD:99854"
     misc_feature    complement(23035..>23658)
                     /locus_tag="CNE_BB1p00230"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    complement(order(23017..23019,23026..23028,23080..23082,
                     23155..23157,23161..23163,23170..23172,23278..23280,
                     23302..23325,23437..23439,23446..23448,23455..23463,
                     23551..23553,23560..23562))
                     /locus_tag="CNE_BB1p00230"
                     /note="active site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(23017..23019,23080..23082,23278..23280,
                     23302..23307,23455..23457,23551..23553,23560..23562))
                     /locus_tag="CNE_BB1p00230"
                     /note="oxalacetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(23080..23082,23161..23163,23278..23280,
                     23302..23316,23320..23325,23455..23460,23551..23553,
                     23560..23562))
                     /locus_tag="CNE_BB1p00230"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(23026..23028,23155..23157,23161..23163,
                     23170..23172,23302..23325,23437..23439,23446..23448,
                     23455..23463))
                     /locus_tag="CNE_BB1p00230"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99854"
     misc_feature    complement(order(23155..23157,23305..23307,23455..23457))
                     /locus_tag="CNE_BB1p00230"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99854"
     gene            complement(23757..24506)
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /db_xref="GeneID:10915010"
     CDS             complement(23757..24506)
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687495.1"
                     /db_xref="GI:339327803"
                     /db_xref="GeneID:10915010"
                     /translation="MDLGLKERVAIITGSARGIGAETARFLAAEGAAVVITDLDASGA
                     EQTASEIVAASGRAIGVRCDVRNEDDVKRMVGAAREAFGGVDVLVNNAGLVKDRTLLK
                     MDEADWDIVIDVTLKGTFHCCRAVLPGMNETGWGRIVNIASRALFGNPGQTNYSSAKA
                     GLVGFTRALSLEQARKGITVNAVAPGFIETEYLKSLPNYETIREGAKAKNAVTFAGQP
                     ADIAGAVAFLASEHARYITGTTLFVTGGRYG"
     misc_feature    complement(23763..24497)
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(23769..24485)
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(23943..23954,24030..24032,24042..24044,
                     24078..24086,24228..24236,24387..24395,24450..24452,
                     24456..24461,24465..24467))
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(24030..24032,24042..24044,24078..24080,
                     24162..24164))
                     /gene="fabG3"
                     /locus_tag="CNE_BB1p00240"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(24547..25704)
                     /gene="mmgC1"
                     /locus_tag="CNE_BB1p00250"
                     /db_xref="GeneID:10915011"
     CDS             complement(24547..25704)
                     /gene="mmgC1"
                     /locus_tag="CNE_BB1p00250"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase MmgC"
                     /protein_id="YP_004687496.1"
                     /db_xref="GI:339327804"
                     /db_xref="GeneID:10915011"
                     /translation="MDFSLDSTQVALVDSLRRYLEAEVAPLVEAHEAEKRPVPRHIVA
                     AMRDYGLIGGLLPESEGGFGLSMTTYGALIAEVARVWPSLRGMLSVSNLAATALARAG
                     SAELREKYLPRILSGEAICCFALSEPNIGSDAANVETRAERTASGGWRINGRKIYITN
                     GPICDLGIVFVNTPLEDGSRGVTCLVFEKSMPGVSCTPLGKMGMHCSPLGELLFEDVE
                     VPAENIVGEVGGGFAIAKRYLNAGRSVVGFAALGIAQASLDAAIRFAKDRVQFGRPIG
                     SFQLVQQMIADMMTQVEAARLLCYRSADALDRNDSDNRILCSMAKRYASDAALRVAET
                     ALQVHGGAGYTTLFPVERYYRDARHLSIGEGTNQILAMVMAQDELGLSALR"
     misc_feature    complement(24556..25704)
                     /gene="mmgC1"
                     /locus_tag="CNE_BB1p00250"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(24580..25686)
                     /gene="mmgC1"
                     /locus_tag="CNE_BB1p00250"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(24601..24603,24607..24609,24613..24621,
                     25228..25230,25234..25236,25330..25332,25336..25338,
                     25426..25428))
                     /gene="mmgC1"
                     /locus_tag="CNE_BB1p00250"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            25997..26440
                     /locus_tag="CNE_BB1p00260"
                     /db_xref="GeneID:10915012"
     CDS             25997..26440
                     /locus_tag="CNE_BB1p00260"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="YP_004687497.1"
                     /db_xref="GI:339327805"
                     /db_xref="GeneID:10915012"
                     /translation="MVDKSLIGKSIGTRTIEVEKGRLRFFASVIGECNPIYVDESAAR
                     DAGHASLPVLPSFLFCLESEAFASVSASKAAGFDPGRVLHGEQQFVYHALAYGGDTLT
                     FDVRFVDAYEKKNGLLDFVVKESRVTNQNGKHIADLRAIIVQRNG"
     misc_feature    26027..26425
                     /locus_tag="CNE_BB1p00260"
                     /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
                     Catalyzes the hydration of trans-2-enoyl CoA to
                     (R)-3-hydroxyacyl-CoA as part of the PHA
                     (polyhydroxyalkanoate) biosynthetic pathway.  The
                     structure of the monomer includes a five-strand
                     antiparallel...; Region: R_hydratase_like; cd03441"
                     /db_xref="CDD:239525"
     misc_feature    order(26075..26077,26090..26092,26096..26098,26105..26107,
                     26150..26152,26159..26164)
                     /locus_tag="CNE_BB1p00260"
                     /note="active site"
                     /db_xref="CDD:239525"
     misc_feature    order(26090..26092,26096..26098,26105..26107,26159..26161)
                     /locus_tag="CNE_BB1p00260"
                     /note="catalytic site [active]"
                     /db_xref="CDD:239525"
     gene            26454..26870
                     /locus_tag="CNE_BB1p00270"
                     /db_xref="GeneID:10915013"
     CDS             26454..26870
                     /locus_tag="CNE_BB1p00270"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC-like dehydratase"
                     /protein_id="YP_004687498.1"
                     /db_xref="GI:339327806"
                     /db_xref="GeneID:10915013"
                     /translation="MAPQFDQVKVGDKLPPLTLPPISRKTLALYAGASGDHMAVHIDQ
                     DVARAARYPDVFAHGMLTVAYLGRLLTNWVAQERIREMSVRFVAITHLYNAPMCTAEV
                     IEKLEHAGEKRVRVAVKAENQYGEVKIVGEAVLAIA"
     misc_feature    26481..26861
                     /locus_tag="CNE_BB1p00270"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(26625..26630,26709..26720)
                     /locus_tag="CNE_BB1p00270"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(26643..26645,26652..26657,26664..26666,26685..26693)
                     /locus_tag="CNE_BB1p00270"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            26897..27727
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /db_xref="GeneID:10915014"
     CDS             26897..27727
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687499.1"
                     /db_xref="GI:339327807"
                     /db_xref="GeneID:10915014"
                     /translation="MRNLESKVALVTGAGRGIGRAVAEKLAAEGARVVVNDLDRDPAM
                     EVVEAIRAAGGEAVACHGSVSVPDFADRFVRTAVDHYKSVDIIVNNAGYTWDNVIQKM
                     SDEQWYAILDTHLTAPFRILRAAQPVIRNLVRSEAEQGREVFRKIVNISSVSGTQGNA
                     GQANYSAAKAGILGLTKSLAKEWGRMKVNVNAVAFAYIATRMTSVAADTNTTLRIDGR
                     DIKVGVGNEILNNAAALIPLGRPGTPEDAAGAVYMFCIPESNYVSGQVMICGGGRGGF
                     "
     misc_feature    26903..27712
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    26915..27709
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(26933..26935,26939..26944,26948..26950,27005..27013,
                     27164..27172,27344..27352,27389..27391,27401..27403,
                     27479..27490)
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(27236..27238,27350..27352,27389..27391,27401..27403)
                     /gene="fabG4"
                     /locus_tag="CNE_BB1p00280"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            27770..28891
                     /locus_tag="CNE_BB1p00290"
                     /db_xref="GeneID:10915015"
     CDS             27770..28891
                     /locus_tag="CNE_BB1p00290"
                     /EC_number="5.1.99.4"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-methylacyl-CoA racemase"
                     /protein_id="YP_004687500.1"
                     /db_xref="GI:339327808"
                     /db_xref="GeneID:10915015"
                     /translation="MSKLSGTKVVEIAGIGPGPFCAMTLADLGADVIVVERAGTLPEG
                     SLNADVALTNRGKRSVSVDLKSAEGRDTVLRLIEGADALIEGMRPGVMERLGLGPDVC
                     LARNPRLVYGRLTGWGQTGPLAQAAGHDANYISLSGALHYASPAGQPPVAPFSLVGDV
                     AGGSLYLVIGLLSGLLEARATGKGCVVDAAITDGSAHMLALVLNGKKAGRISDARGES
                     LHDASHFYNTYRCADGGFVTVAPVEPQFYRLMLQMLGLADEPLFATQWDRTQWPAQRE
                     RLQKVFASRSRAAWQALFEGSDACIAPVLSPEEAARHSHNVARGNYFERDGYLQAMPA
                     PRFDGEPATPGAIPHRGQHTQAVLAALKEARAGSPWPRG"
     misc_feature    27779..28852
                     /locus_tag="CNE_BB1p00290"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(28954..31647)
                     /locus_tag="CNE_BB1p00300"
                     /db_xref="GeneID:10915016"
     CDS             complement(28954..31647)
                     /locus_tag="CNE_BB1p00300"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein"
                     /protein_id="YP_004687501.1"
                     /db_xref="GI:339327809"
                     /db_xref="GeneID:10915016"
                     /translation="MPQSRILIPTKFAPPRLSTRSIPRQGLLQRLHQLRHCSLVLVTG
                     PAGFGKTTLLAQWRKTLMKGGSRVVWLSLAQEERRFAAFWTHLTASLNHEGVALEDNV
                     LLLDPNASGSVQTVAAALIQALSRVPGELYLMIDDFHHADDPQTFRLVQTLVDCRPEN
                     LHLVLATRASPAMPLGRLRAAGLLGEIECADLPFDFGETTAFLRDHVEGSLDVNTVQM
                     IQELTDGWPIGMQLVSVALKANPGSLTRLRSLVVKTGNLHAYLTEDVIGHLPAALVDF
                     MEKISILRRFNTDVAGYVAETDDAARLIGTMEQQNLFILPVDFDDGCQWYRLHPVFAD
                     YLGERIARSPGRAARLHLRASRWYADHMMLAEALRHASRCADPAQAIELVDRAAPPMA
                     DLGDLGNALRWVESLQLDLVRHHPRLLLLGCWTYALTNRLEKAGQWIQALQQSPESGS
                     ESITHQITLLNALLAVLREDAETSLELLERTPQPEIPFLQQVRAALLIIALSQMGRHA
                     EAHSTFHAFSNLHRGNPEMGVLPATTAAAAALLEGDVLRAQRISASALGWAEKLYGRR
                     SGSAAGAGVVLAAALYEADRPAEAREVLANRLDVVQHSTPYVLVNGVLCQARLQYLES
                     PPAALSFLAEQEAAFRTRGLDWATACVLAERLRIAAQMGDMHAATRLLMALDALAAQH
                     RDATGIRAGILALAAQANARVALLERRPEQALRYVAQLQDYGVQQGRGRPLVTADMLS
                     AIAFDMLGRQDAAAASLTSALAAGYRMGLVRTFTDEGARLGALFPLLGLTGDGPTDAY
                     RQCVAASFRPYQATPAPAVATAGMPAPQESGIPESLGLTRRESEILVLLEQAMSNKRI
                     AATLNLSPGTVKWNIKNIFAKLGVSSRYEAIVLARQQRGER"
     misc_feature    complement(28972..31647)
                     /locus_tag="CNE_BB1p00300"
                     /note="ATP-dependent transcriptional regulator
                     [Transcription]; Region: MalT; COG2909"
                     /db_xref="CDD:225461"
     misc_feature    complement(31153..31578)
                     /locus_tag="CNE_BB1p00300"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(28972..29142)
                     /locus_tag="CNE_BB1p00300"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(28999..29001,29032..29046,29050..29055,
                     29059..29064,29086..29094,29131..29139))
                     /locus_tag="CNE_BB1p00300"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(28972..28977,28984..28986,28993..29001,
                     29092..29094,29098..29100,29104..29106))
                     /locus_tag="CNE_BB1p00300"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            32644..32829
                     /locus_tag="CNE_BB1p00310"
                     /db_xref="GeneID:10915017"
     CDS             32644..32829
                     /locus_tag="CNE_BB1p00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687502.1"
                     /db_xref="GI:339327810"
                     /db_xref="GeneID:10915017"
                     /translation="MYFHPFFNTMDVGPIVLEIPPATGGSITGSVDDAWQPAIVDVGP
                     TDMDKGKGGKYTPTATR"
     misc_feature    32647..>32811
                     /locus_tag="CNE_BB1p00310"
                     /note="Protein of unknown function (DUF1254); Region:
                     DUF1254; pfam06863"
                     /db_xref="CDD:253949"
     gene            complement(33003..33152)
                     /locus_tag="CNE_BB1p00320"
                     /db_xref="GeneID:10915018"
     CDS             complement(33003..33152)
                     /locus_tag="CNE_BB1p00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687503.1"
                     /db_xref="GI:339327811"
                     /db_xref="GeneID:10915018"
                     /translation="MLVPRTRYDEAVGVAAAAADAIAVGDPSDPTTAMGRYATSRIRA
                     CLTPS"
     gene            33189..33602
                     /locus_tag="CNE_BB1p00330"
                     /db_xref="GeneID:10915019"
     CDS             33189..33602
                     /locus_tag="CNE_BB1p00330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687504.1"
                     /db_xref="GI:339327812"
                     /db_xref="GeneID:10915019"
                     /translation="MHCITPDFTAAARSASSRTSKAGLPPSSCATRLTVGAALIATWT
                     LARVDPVMEAMSTSGCNDSAAPTDCTVAEEHIEDPSGPASCMISAKIRAFRGEISEAL
                     STTVQPFDAGLNSGVRAHRQPDSQEGQHRDDVAAV"
     gene            complement(34072..34542)
                     /locus_tag="CNE_BB1p00340"
                     /db_xref="GeneID:10915020"
     CDS             complement(34072..34542)
                     /locus_tag="CNE_BB1p00340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687505.1"
                     /db_xref="GI:339327813"
                     /db_xref="GeneID:10915020"
                     /translation="MPLQTSPSPSARTWALHCTLFRGQTPPRACLYLLADLRRGVALS
                     AILAEQPMGGALAAWLEAAAIGRPPPQALQSTELPSEQDRRALYAWIAAHDVVLEPQT
                     LGGRFWKPVNQLLRSAWESLGLAPGAVGEMPTWSGAQQGLDRWFREHCQHVSGA"
     gene            complement(34986..35291)
                     /gene="metF"
                     /locus_tag="CNE_BB1p00350"
                     /db_xref="GeneID:10915021"
     CDS             complement(34986..35291)
                     /gene="metF"
                     /locus_tag="CNE_BB1p00350"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_004687506.1"
                     /db_xref="GI:339327814"
                     /db_xref="GeneID:10915021"
                     /translation="MALNIQCVWAPGPASIAVLARYAALCGVSACASLWSKYGVSIGK
                     LFGSAGPDLFVDRLATGLTEAHGKVSLHFFPFGGVAQSVRWIEQYSFRTEPLPRRGT"
     misc_feature    complement(35025..>35258)
                     /gene="metF"
                     /locus_tag="CNE_BB1p00350"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cl00246"
                     /db_xref="CDD:260296"
     gene            complement(35501..35677)
                     /locus_tag="CNE_BB1p00360"
                     /db_xref="GeneID:10915022"
     CDS             complement(35501..35677)
                     /locus_tag="CNE_BB1p00360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687507.1"
                     /db_xref="GI:339327815"
                     /db_xref="GeneID:10915022"
                     /translation="MSTTVEREPLPLPGGHNKVLLHSCCAPCSGEVMEAMLASGIDYT
                     IFFYNPNIHPLKEY"
     misc_feature    complement(<35504..35638)
                     /locus_tag="CNE_BB1p00360"
                     /note="Uncharacterized BCR, COG1636; Region: DUF208;
                     cl17782"
                     /db_xref="CDD:266835"
     gene            complement(35677..36588)
                     /locus_tag="CNE_BB1p00370"
                     /db_xref="GeneID:10915023"
     CDS             complement(35677..36588)
                     /locus_tag="CNE_BB1p00370"
                     /codon_start=1
                     /transl_table=11
                     /product="MetR family transcriptional regulator"
                     /protein_id="YP_004687508.1"
                     /db_xref="GI:339327816"
                     /db_xref="GeneID:10915023"
                     /translation="MLERIHLSIVQQVEKQGSLTAAAGVLNLTQSALSHSMKKLEQQL
                     GTDVWLREGRSLRLTQAGQYLLAVANRVLPQLDLAEERLGQFAQGERGALRIGMECHP
                     CYQWLLKVVSPYLAAWPDVEVDVKQKFQFGGIGALFGYEIDLLVTPDPLFKPGLKFEP
                     VFDYEQVLVVPRGHALASATYVKPQQLTQEVLISYPVDIERLDIYNQFLLPAGVTPRR
                     HKAIETTDIMLQMVASGRGVAALPRWLVEEYAAKMDVVPVRLGARGIAKQIFLGAREA
                     DTGIDYVRAFIELARQPAPTTLAQRAN"
     misc_feature    complement(35707..36588)
                     /locus_tag="CNE_BB1p00370"
                     /note="DNA-binding transcriptional regulator MetR;
                     Provisional; Region: PRK15421"
                     /db_xref="CDD:185319"
     misc_feature    complement(36400..36573)
                     /locus_tag="CNE_BB1p00370"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(35719..36309)
                     /locus_tag="CNE_BB1p00370"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator metR, which regulates
                     the expression of methionine biosynthetic genes, contains
                     type 2 periplasmic binding fold; Region: PBP2_MetR;
                     cd08441"
                     /db_xref="CDD:176132"
     misc_feature    complement(order(35887..35892,35896..35901,35917..35934,
                     36208..36228,36232..36234,36244..36246,36253..36258,
                     36262..36267))
                     /locus_tag="CNE_BB1p00370"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176132"
     gene            complement(36635..36850)
                     /gene="msuE"
                     /locus_tag="CNE_BB1p00390"
                     /db_xref="GeneID:10915024"
     CDS             complement(36635..36850)
                     /gene="msuE"
                     /locus_tag="CNE_BB1p00390"
                     /EC_number="1.5.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase MsuE"
                     /protein_id="YP_004687509.1"
                     /db_xref="GI:339327817"
                     /db_xref="GeneID:10915024"
                     /translation="MDVSFLLSWIDLRGAATSQFARAQQYGFVNWVGMLFAVFCHSAL
                     EDHANHLQQLQMLGPCANGEDAIGGNP"
     gene            36838..37419
                     /locus_tag="CNE_BB1p00380"
                     /db_xref="GeneID:10915025"
     CDS             36838..37419
                     /locus_tag="CNE_BB1p00380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687510.1"
                     /db_xref="GI:339327818"
                     /db_xref="GeneID:10915025"
                     /translation="MTHPLRVVAVSGGLQRPSKSAFLAEHLLDLIADEVPCQQRLIEM
                     GGIAPLLAGAVWRSQLSDTVEQELAAVEQADVLVVVTPVFRGSYTGLFKHFFDFIHQD
                     ALIDKPVLLAATGGSERHALVIDHQLRPLFSFFQARTLPLGIYATDKDFVDYCLQDEA
                     VIERARLAVQRALPLVELARQARPSLAEEVVVA"
     misc_feature    36853..37368
                     /locus_tag="CNE_BB1p00380"
                     /note="FMN reductase, MsuE subfamily; Region:
                     FMN_reduc_MsuE; TIGR03566"
                     /db_xref="CDD:211840"
     gene            37464..38447
                     /locus_tag="CNE_BB1p00400"
                     /db_xref="GeneID:10915026"
     CDS             37464..38447
                     /locus_tag="CNE_BB1p00400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687511.1"
                     /db_xref="GI:339327819"
                     /db_xref="GeneID:10915026"
                     /translation="MNNELTFKLKSICFDENYHPSDSTRITTNFANLARGKSRQQNLR
                     NTLRMIDNRFNDLAHWDNPTADRYSVELEIISVEMNIDTKSSNDVFPLIEILKTSILD
                     KKANKRIDGIAGNNFSSYVRDYDFSVLLPEHNVNRPDFSTPDNFGDLHGKLFKQFANS
                     STYKECFNKPPVICISASTSKTYQRTGNQHPILGVEYQQNELSSTDQYFAKMGMQVRF
                     FMPPNGVAPLAFYFHGDLLGDYTNLELIGTISTMETFQKIYRPEIYNANSAAGKLYQP
                     SLKNQDYSLTQIVYDREERSQLAVKQGKFAEEHFIKPYKGVLEQWAANSSL"
     misc_feature    37464..38435
                     /locus_tag="CNE_BB1p00400"
                     /note="Domain of unknown function (DUF1852); Region:
                     DUF1852; pfam08908"
                     /db_xref="CDD:149846"
     gene            38762..39787
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /db_xref="GeneID:10915027"
     CDS             38762..39787
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methylcobalamin:homocysteine methyltransferase
                     MetE"
                     /protein_id="YP_004687512.1"
                     /db_xref="GI:339327820"
                     /db_xref="GeneID:10915027"
                     /translation="MFETSIAGSLPKPAWLAETNKLWPQWKAEGEALRQAKADATLLW
                     IKAQEDAGLDIVCDGEQSRQHFVHGFLEQVEGIDFENKVKMGIRDNRYDAMVPQVVSA
                     LRLKGRVHAFEAQLARAHTKKKLKFTLPGPMTLVDTVADRFYGDKVKMAFAFAELLNQ
                     EALALQADGVDIIQFDEPAFNVYMKDAADWGVQALERAAQGLTCTTAVHICYGYGIKA
                     NTDWKSTLGDEWRQYEAVFPALARSSIDQVSLECIHSHVPPDLMSLLVGKDVLVGVID
                     VASDVIETPEEVADTIGRALEYVPKERLFPCTNCGLAPMARDVAWRKLEALAAGTRLA
                     KERLTTA"
     misc_feature    38771..39760
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, C-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_C_terminal_like;
                     cd03311"
                     /db_xref="CDD:239427"
     misc_feature    order(38780..38788,38939..38941,38957..38959,39281..39283,
                     39287..39289,39386..39388,39392..39394,39689..39694)
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(39032..39040,39173..39175,39293..39295)
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(39386..39388,39392..39394,39512..39514,39689..39691)
                     /gene="metE"
                     /locus_tag="CNE_BB1p00410"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            complement(40215..41729)
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /db_xref="GeneID:10915028"
     CDS             complement(40215..41729)
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /EC_number="1.2.1.18"
                     /EC_number="1.2.1.27"
                     /note="acylating"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate semialdehyde dehydrogenase"
                     /protein_id="YP_004687513.1"
                     /db_xref="GI:339327821"
                     /db_xref="GeneID:10915028"
                     /translation="MTAPYTSPSEVIHYVSGEPYEGNGKRAQAVFNPATGAVARQVRL
                     GTVEDVDAAVASAVAAFPKWADTPPIRRARVMLKFLELMNQHKDELAAIITAEHGKVL
                     SDAAGEVSRGIDIIEFACGVPQLLKGDFTDQVSTGMDNWTLRQPLGVVAGITPFNFPC
                     MVPCWMFPVAIATGNCFILKPSERDPSASLFMARLLKEAGLPDGVFNVIQGDKTVVDA
                     LLHHRDVKAVSFVGSTPIANYIYETGARLGKRVQALGGAKNHMVVMPDADIDQALDGL
                     IGAAYGSAGERCMAISVAVLVGDVADKIMPKLEARARELVIKNGMEADAEMGPVVTGQ
                     ALERIENYIALGVEEGAKLVVDGRNYKVPGHEQGFFTGGTLFDNVTPEMRIYKEEIFG
                     PVLSCVRVDDFAQAVKLINEHEFGNGVACYTRDGQVAREFCRRIEVGMVGINVPIPVP
                     MAWHGFGGWKRSLFGDMHAYGEEGVRFYTRQKSIMQRWPNDTARGAEFAMPTAK"
     misc_feature    complement(40266..41693)
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /note="Methylmalonate semialdehyde dehydrogenase and ALDH
                     family members 6A1 and 6B2; Region: ALDH_F6_MMSDH;
                     cd07085"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(40266..40271,40275..40292,40311..40313,
                     40353..40355,40359..40361,40371..40373,40398..40409,
                     40413..40415,40419..40424,40431..40433,40440..40445,
                     40449..40454,40458..40460,40980..40982,40986..40988,
                     40995..40997,41004..41006,41016..41018,41295..41297,
                     41304..41306,41313..41315,41328..41351,41376..41381,
                     41388..41390,41487..41489,41499..41501,41508..41510,
                     41520..41522,41526..41528))
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(40479..40481,40557..40559,40563..40565,
                     40866..40868,40962..40970,41022..41024,41031..41042,
                     41091..41093,41181..41183,41190..41192,41235..41237,
                     41259..41270))
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(40866..40868,40875..40877,40968..40970,
                     41259..41261))
                     /gene="iolA"
                     /locus_tag="CNE_BB1p00420"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143404"
     gene            41917..42882
                     /locus_tag="CNE_BB1p00430"
                     /db_xref="GeneID:10915029"
     CDS             41917..42882
                     /locus_tag="CNE_BB1p00430"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687514.1"
                     /db_xref="GI:339327822"
                     /db_xref="GeneID:10915029"
                     /translation="MAKEKAEELWEHLHWLVVLQQQGSFSKAAARLGVSKASMSQHIT
                     DLEKAAGITLVQRTTRSASLTDAGRQLVESMRGAFEQIATGYANVRDLAGAPRGFLRV
                     TAPVAFARQQLVPRLPDFLRKYPQIQLELDMSDRLRPLAQEGFDIAVRHTSAPPETHV
                     AWTLAATRAVLVANRAYLRSRGAPETPQALVDHACLHYPRRQGTTTWTFVPPVAGSVG
                     RYADPVTVPVTGPLAVNNSEALRDAAIEGLGIALLPDFSAQSALETGRLVKVLPQWRS
                     TGAFGDWLYAIRPYSAHASRVSQVFVDYLRETFSEGFTSTPPTLI"
     misc_feature    41944..42849
                     /locus_tag="CNE_BB1p00430"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    41944..42123
                     /locus_tag="CNE_BB1p00430"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    42208..42831
                     /locus_tag="CNE_BB1p00430"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(42238..42240,42250..42252,42367..42369,42409..42411,
                     42415..42417,42625..42627,42676..42678,42766..42768)
                     /locus_tag="CNE_BB1p00430"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(42241..42246,42256..42261,42265..42270,42277..42279,
                     42289..42291,42295..42315,42496..42498,42607..42621,
                     42640..42645,42652..42654)
                     /locus_tag="CNE_BB1p00430"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            43039..44670
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /db_xref="GeneID:10915030"
     CDS             43039..44670
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit IlvG"
                     /protein_id="YP_004687515.1"
                     /db_xref="GI:339327823"
                     /db_xref="GeneID:10915030"
                     /translation="MLGSELVIRALARRGVTTIFSLSGNQIMPLYDACIDANIRIVHV
                     RHEAAAVFMADAWSQITGEIGVAMLTAAPGIANGIAPLYSASQAESPILLLSGDSPVS
                     EDGMGAFQELDQVAMTSPLTKWSKRVTDARTLVSAVDTAISAAMADRRGPVHLALPFD
                     LMTRESGVDVLPDRIPDVAPVVPASAAVESISQLLGQARRPLILVGPSLCRGAGKASL
                     RVASQTLSAPIVSMESPRGLRDPSLGAIAEVVAESDLIVLLGKRLDFTTGFGRENVFG
                     KAARIVVIDADVDMIRRAERLLGDRLAARCFADVSVALNALKSAARQPACDRGAWMER
                     VAAASLERGIPAPATTPSIHPRVLCETVDTFLREVPSPVLVCDGGEFGQWAQAYCSAP
                     ARIINGMSGAIGGGICYAIAAKIARPESTVVLLMGDGTAGFHLSEFDTAVREQAAVVA
                     VVGNDLRWNAEHVIQQRTYGEDRLIGCSLSATARYDAAVAGLGGFGTLVERLDEMAPA
                     LKAAVDSQQPACINVQMEGHPAPIFARNQVGASAH"
     misc_feature    43039..44634
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="Thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase] [Amino acid transport and metabolism /
                     Coenzyme metabolism]; Region: IlvB; COG0028"
                     /db_xref="CDD:223107"
     misc_feature    43051..43512
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(43090..43092,43105..43110,43120..43122,43132..43134,
                     43156..43176,43183..43185,43192..43197,43204..43209,
                     43213..43221,43255..43257,43276..43278,43288..43290,
                     43297..43302)
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(43105..43113,43120..43122,43132..43134,43159..43161,
                     43165..43176,43180..43182,43255..43257,43264..43269,
                     43273..43278,43285..43287,43387..43389,43396..43398)
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(43105..43107,43177..43179,43255..43257,43267..43269)
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    43615..43989
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    44152..44616
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(44245..44247,44317..44328,44401..44403,44407..44409)
                     /gene="ilvG1"
                     /locus_tag="CNE_BB1p00440"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            44689..45423
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /db_xref="GeneID:10915031"
     CDS             44689..45423
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /EC_number="1.3.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur subunit"
                     /protein_id="YP_004687516.1"
                     /db_xref="GI:339327824"
                     /db_xref="GeneID:10915031"
                     /translation="MEATKAAQRTLTVRIARGTEEGNFETYEVPWRENQTVLDVVTEV
                     QRRIDSTLSYRFACRVGVCGSCAMTVNGKPRWTCRTHVSRVEEDGVIVIEPLRNMPRI
                     KDLVVDMSEFFDKWKKAGSTFVGTATRHDPPAAVSPTSKKRKMADAAIECINCGVCYA
                     SCDVVAWDKEYLGPAALNRAWTLFNDERHADPKDVLKKATSGSGCNSCHTQGNCMTHC
                     PVSLSPTGSIAGLKKNALLQFLKGGD"
     misc_feature    44713..45411
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="Succinate dehydrogenase/fumarate reductase, Fe-S
                     protein subunit [Energy production and conversion];
                     Region: FrdB; COG0479"
                     /db_xref="CDD:223555"
     misc_feature    44722..45030
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_3; pfam13085"
                     /db_xref="CDD:257488"
     misc_feature    44749..>44901
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(44830..44832,44851..44853,44860..44862,44869..44871,
                     44875..44886)
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(44860..44862,44875..44877,44884..44886)
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    45139..45357
                     /gene="frdB"
                     /locus_tag="CNE_BB1p00450"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     gene            45426..45761
                     /locus_tag="CNE_BB1p00460"
                     /db_xref="GeneID:10915032"
     CDS             45426..45761
                     /locus_tag="CNE_BB1p00460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687517.1"
                     /db_xref="GI:339327825"
                     /db_xref="GeneID:10915032"
                     /translation="MEQRLFALQRLSAMVMAPFVLVHLGVILYAVRGGLTAAEILSRT
                     QGSLLWIPFYSLFVISVAVHVPIGLRNILIEWARVSRGAASVFCFLFGLLLLSMGLRA
                     VAAVGGLLS"
     gene            45758..46105
                     /locus_tag="CNE_BB1p00470"
                     /db_xref="GeneID:10915033"
     CDS             45758..46105
                     /locus_tag="CNE_BB1p00470"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase, cytochrome b subunit"
                     /protein_id="YP_004687518.1"
                     /db_xref="GI:339327826"
                     /db_xref="GeneID:10915033"
                     /translation="MKSPRNHRAYWAFLGHRLSGLALGIFLPAHFYVLGLALDQRARM
                     DAFLKFADMGAVKFGEWGLVLLLSIHMCFGLRLLALELLPWSTTRDARLSWISWGGAL
                     SLFIGVIFALGVI"
     misc_feature    45785..>45967
                     /locus_tag="CNE_BB1p00470"
                     /note="Succinate:quinone oxidoreductase (SQR) and
                     Quinol:fumarate reductase (QFR) family, transmembrane
                     subunits; SQR catalyzes the oxidation of succinate to
                     fumarate coupled to the reduction of quinone to quinol,
                     while QFR catalyzes the reverse reaction. SQR; Region:
                     SQR_QFR_TM; cl00881"
                     /db_xref="CDD:260677"
     misc_feature    45803..45805
                     /locus_tag="CNE_BB1p00470"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:239573"
     misc_feature    order(45824..45826,45965..45967)
                     /locus_tag="CNE_BB1p00470"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239573"
     gene            46107..47855
                     /locus_tag="CNE_BB1p00480"
                     /db_xref="GeneID:10915034"
     CDS             46107..47855
                     /locus_tag="CNE_BB1p00480"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase/succinate dehydrogenase
                     flavoprotein"
                     /protein_id="YP_004687519.1"
                     /db_xref="GI:339327827"
                     /db_xref="GeneID:10915034"
                     /translation="MQIENHKTDILILGTGGAGLFAALHAKKANPALRVSVAVKGLLG
                     KCGCTRMVQGGYNVALSTDDSVERHFMDTIEGGKWLPRQDLAWRLVEGAIERVRELEN
                     EIGCFFDRNPDGTLHQKAFAGQSFDRTVHKADLTGIEIINRLMEQVRALDVEELEEHR
                     AIELIPAADGSGISGVLFIDMRRGTYRFVQAKAVLLATGAGPTMYRYHTPSGDKTCDG
                     LAMAMRYGLSLRDMEMVQFHPTGLLGGPDTRMTGTVLEEGLRGAGGWLINGDGDRFMT
                     NYDPRGERATRDVVSRGIYSEMRAGRTGPMGGIYIQMSHLGPEKVAKTFPGMVNRCKD
                     CGFDLAGGRVEVVPTAHYLMGGVEFDADCSTASPGLFAAGEDCGGVHGANRLGGNGVA
                     NSTVFGGIAGDSMAAYVSKVQHWKEPDKRVILSGVERAEYPFSKTPGAIHELRDALAQ
                     TMWDDVGVLRNEQAMRRGLSAVAGHRDALLAMGVPDGDRRYNVTWHDWLNLQSLVDMS
                     RVITVSALARENSRGAHAREDFPEPGDLHSSRYTRVTADGDDIRLEMVPVKFDIVTPG
                     TSLITGEAGQPPKVAA"
     misc_feature    46107..47702
                     /locus_tag="CNE_BB1p00480"
                     /note="succinate dehydrogenase flavoprotein subunit;
                     Reviewed; Region: sdhA; PRK06263"
                     /db_xref="CDD:235758"
     misc_feature    46119..47390
                     /locus_tag="CNE_BB1p00480"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    47439..47807
                     /locus_tag="CNE_BB1p00480"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:251613"
     STS             46542..46613
                     /locus_tag="CNE_BB1p00480"
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            47867..48802
                     /locus_tag="CNE_BB1p00490"
                     /db_xref="GeneID:10915035"
     CDS             47867..48802
                     /locus_tag="CNE_BB1p00490"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase subunit alpha"
                     /protein_id="YP_004687520.1"
                     /db_xref="GI:339327828"
                     /db_xref="GeneID:10915035"
                     /translation="MTISIDRVEEAAFEIMKRAAIEIPKDYKRGIQELQKTETGKLPR
                     FVIHAMQDNWEAADQDRRPMCADTGLPRYYVKVGNNATVQRGFVAVERALRMATADAT
                     QAIPLRPNRVHPLWRTDNNNNVGINAPEIEWSFEPDADWVDITTVHKGGLFGTDYRML
                     FPGDGIDGIKRFVLDTLIAFGKRGLACQPAIVGIGLGGSKDTCMQLGKQAACLRVVGD
                     RNPDPKIAELELELMKLGNSIGMGAMGFVGSSMVVDCHIEVGHTHTGGMPISLHTFCL
                     SSRRATARIYADGNIEYRTDPQWFTPYLRRETVEW"
     misc_feature    47888..48721
                     /locus_tag="CNE_BB1p00490"
                     /note="Fumarate hydratase (Fumerase); Region: Fumerase;
                     pfam05681"
                     /db_xref="CDD:253319"
     gene            48796..49479
                     /gene="fumA"
                     /locus_tag="CNE_BB1p00500"
                     /db_xref="GeneID:10915036"
     CDS             48796..49479
                     /gene="fumA"
                     /locus_tag="CNE_BB1p00500"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="class I fumarate hydratase"
                     /protein_id="YP_004687521.1"
                     /db_xref="GI:339327829"
                     /db_xref="GeneID:10915036"
                     /translation="MVSPQDDELKVFHINLPATTEDIAKLEIGSAVYLTGVIYTAREG
                     VYKKVLDEGLEPPVELRGLSNVNFHCSPAAAPNEDGSYNVGAVTATASFRFSKWIPKW
                     MEKTACRIFIGKGGMPADDYKRVLAPGGAIYLTTVGYGTGALLGRGIKQVRDVFWLDE
                     LGIAQAMWMFEVENFGPFIVESDLEGNSLFAQHAEVINAGIEKLYAGLKPPALHRYGE
                     TDDRKNEVM"
     misc_feature    48826..49407
                     /gene="fumA"
                     /locus_tag="CNE_BB1p00500"
                     /note="Fumarase C-terminus; Region: Fumerase_C; cl00795"
                     /db_xref="CDD:260626"
     gene            49517..50350
                     /locus_tag="CNE_BB1p00510"
                     /db_xref="GeneID:10915037"
     CDS             49517..50350
                     /locus_tag="CNE_BB1p00510"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004687522.1"
                     /db_xref="GI:339327830"
                     /db_xref="GeneID:10915037"
                     /translation="MIIDFRLRPPVGGFLDTLMYSAGERRDGFTRTVGFEPSPAAQQQ
                     SMDLLLKEMDEAGVDKGVVVGRLAGTLGSVSNEDVARIVRDHPQRFIGAASIDPTNRV
                     AACKTISDAVANGFKAINIEPGSYPIPMYADDRRLYPIYAHCEDLGVPVIMMVGGTAG
                     PDLSYSDPVKTDRVLTDFPKLNVVVVHGGWPWVTEILHIAFRRPNMYLSPDMYFSRMP
                     GWEEYVKAADTFLADRMLYASSFPFCPVRDYKQWFGTLPIRPENMEKVMGGNARRLLG
                     L"
     misc_feature    49664..50347
                     /locus_tag="CNE_BB1p00510"
                     /note="Predicted metal-dependent hydrolase of the
                     TIM-barrel fold [General function prediction only];
                     Region: COG2159"
                     /db_xref="CDD:225070"
     gene            50429..51343
                     /locus_tag="CNE_BB1p00520"
                     /db_xref="GeneID:10915038"
     CDS             50429..51343
                     /locus_tag="CNE_BB1p00520"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687523.1"
                     /db_xref="GI:339327831"
                     /db_xref="GeneID:10915038"
                     /translation="MDVKTLYTLVAIADRGSFAEAGNAIGLTISAVSMQMRALEEELG
                     ITIFDRSRRPPVLTDAGLAFTNRARDLLTHWESMSAALKREAAGGVLKLGSVHTCVSG
                     VLPLALKRLQQQGHRIDIHLTTGLTHDLERAVYRRQLDVAVVTEPEVPRLDLQFMPFF
                     NEEFVVITHTTTRGDSDKGILETTPYVRFNRTARVGLLVQEEMVRRQIAVRSTMEIDT
                     LEGVIAMVANGLGSSVVPARGVENEFPASIRTIPFGSPPLTRRLGILVPRDNPRAHLS
                     HLLLEALTDVTKPTSAPDDGHPRLVQKS"
     misc_feature    50429..51283
                     /locus_tag="CNE_BB1p00520"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    50444..50611
                     /locus_tag="CNE_BB1p00520"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    50699..51277
                     /locus_tag="CNE_BB1p00520"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(50741..50746,50750..50755,50762..50764,50774..50776,
                     50780..50800,51065..51082,51098..51103,51107..51112)
                     /locus_tag="CNE_BB1p00520"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            52461..53555
                     /locus_tag="CNE_BB1p00530"
                     /db_xref="GeneID:10915039"
     CDS             52461..53555
                     /locus_tag="CNE_BB1p00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687524.1"
                     /db_xref="GI:339327832"
                     /db_xref="GeneID:10915039"
                     /translation="MNSHDTGKAIGNWLARGRQWLRRIRQNPIVKELCQDADAPWYRT
                     STAVAMFAFAIAPLAMVPAHAEEWPNKPIRLVVPFASGGATDLLARAVAVELGKQWKQ
                     PVVVDNRPGAGGAVGAEAVAKSAPDGYTLLLASGSMFTVNPFIYQKLPYSAESFEMIS
                     KIASGPMVLTVNTKVAAKTMAEFISYAKANPGKLTFASAGNGSQVHIANEAFAEAAGI
                     DVVHVPYKGEGPAYSDLMAGTVDMTVGNINAISPLLKGNRLRALAVTGKERSPLLPDV
                     PTTAEAGLPGFTFYGWFALMAPAGTPKELTARMYADLEKATAGPSMQQYLAAQGMTKT
                     LTPKGQLPQEIAQESGRWKQLVTKRKISAN"
     misc_feature    52725..53543
                     /locus_tag="CNE_BB1p00530"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            53671..54678
                     /locus_tag="CNE_BB1p00540"
                     /db_xref="GeneID:10915040"
     CDS             53671..54678
                     /locus_tag="CNE_BB1p00540"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor family protein
                     22"
                     /protein_id="YP_004687525.1"
                     /db_xref="GI:339327833"
                     /db_xref="GeneID:10915040"
                     /translation="MNRILGRCIKALGLGAFAIGATMVGAAPAAAQAYPSRPVTIVVP
                     FAAGGDADQSARNLSVTASALLGQPVVVMNRPGANGAIGSQVAKDASPDGYTLLLARV
                     GSQVLLPAIQDSGLAYKWNDFTFIGLLELNPVVCVVHPESKFKTLADLAAELQAHPGK
                     LNYSASGPATVQNLAPQLLLQSLNLKPNGAVNVNYKGGNEAALAVISKEVDFSCNNLS
                     SMAGQVAGGKLRALVTTTPERLKQFPDVPTAREAGFPKLEAVIGWSALYGPPKMPPEI
                     VKKWAGVLKSAFTDARWISANATYGGIPRVLTPEETAKYVSENFSAYQSLAKSAGIKM
                     Q"
     misc_feature    53710..54672
                     /locus_tag="CNE_BB1p00540"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            54716..55459
                     /locus_tag="CNE_BB1p00550"
                     /db_xref="GeneID:10915041"
     CDS             54716..55459
                     /locus_tag="CNE_BB1p00550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687526.1"
                     /db_xref="GI:339327834"
                     /db_xref="GeneID:10915041"
                     /translation="MGTEHYAVLGATVAGAYTVFGLTGFGAAMVAVPILVQFIPLQFV
                     VPMLLLLDLVTTSMVGMRNWNSVSRPELLRLIPFMMVGVALGTTVLAKVESRWLLVGL
                     GLFVLVMTGRALLTSSARAEEVARGWSVPAGVVGGVFSALFGTGGPIYTMYLSRRLPQ
                     IDAFRSTIAAVILFSALVRLAAFGSSGLLQQVDLLRSAAFAMPFSLIGLAVGSRLRRK
                     ISTDAVRRALLIFLCASGVSVLCRGLLMH"
     misc_feature    54740..55426
                     /locus_tag="CNE_BB1p00550"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            55471..56913
                     /locus_tag="CNE_BB1p00560"
                     /db_xref="GeneID:10915042"
     CDS             55471..56913
                     /locus_tag="CNE_BB1p00560"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004687527.1"
                     /db_xref="GI:339327835"
                     /db_xref="GeneID:10915042"
                     /translation="MTNPIEGLESALRDIVGDQGLIVRASEMEPYLIDWNGAVAGNAR
                     CVVRPQTTEETAKVLSLCAARGVPVVPQGGLTGMAAGATPLASGEEVIVNLSRMNRII
                     DVDPENFTIAVEAGCILENVKMAAEAVDRYFPLALGAQGSCEIGGNISTNAGGLNVLR
                     YGSMRSAVLGIEVVLPDGSVLDLLRSVRKDNTGYDLKQLFIGAEGTLGIITKAVLQLY
                     PRCENVATAWIALASLDDAVRLLSRMRSAVGERVSAFELISRPMLDVVLRHFRGSRDP
                     LAERVEWYVLMEWSDTSTAFDLRAVMEVELSKCIEDGLVVDVALADSLAHAEEFWALR
                     ENISEAQRAEGAVVKHDISAPVSAVPRLIHEATGVVRRLAPMATVIAFGHVGDGNVHY
                     NVVQPTGCDLTEFKTMMRDVSDEIYRLVAELGGSISAEHGLGQLKAKAAFDLKSQAER
                     ALMVTIKAGLDPQGIMNRGKLIPMDQLISG"
     misc_feature    55501..56889
                     /locus_tag="CNE_BB1p00560"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    55597..56019
                     /locus_tag="CNE_BB1p00560"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    56134..56883
                     /locus_tag="CNE_BB1p00560"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            56997..57081
                     /gene="trnL"
                     /locus_tag="CNE_BB1p00570"
                     /note="tRNA-Leu-TAA"
                     /db_xref="GeneID:10915043"
     tRNA            56997..57081
                     /gene="trnL"
                     /locus_tag="CNE_BB1p00570"
                     /product="tRNA-Leu"
                     /codon_recognized="UUA"
                     /db_xref="GeneID:10915043"
     gene            57433..58038
                     /locus_tag="CNE_BB1p00580"
                     /db_xref="GeneID:10915044"
     CDS             57433..58038
                     /locus_tag="CNE_BB1p00580"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687528.1"
                     /db_xref="GI:339327836"
                     /db_xref="GeneID:10915044"
                     /translation="MGSFGASATLHALPSLLSTFRERYPGVQVVVTEKPDAETSRDLI
                     ERRIELAVVTLPKPDFDTITLAIDELVAIVPVEHPLAGKEVIDLPDLICHPFLMTRAG
                     SQPLIARLFARHDVRPTVAHELLQLMSILEYVSRGEGVSILARLALPTAYPGVKYVPL
                     RPTTRRSIGIACLSENRLSPAARALWQAARKLTVATALGGS"
     misc_feature    57451..57999
                     /locus_tag="CNE_BB1p00580"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(57472..57477,57481..57486,57493..57495,57505..57507,
                     57511..57531,57793..57810,57826..57831,57835..57840)
                     /locus_tag="CNE_BB1p00580"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            58264..59460
                     /locus_tag="CNE_BB1p00590"
                     /db_xref="GeneID:10915045"
     CDS             58264..59460
                     /locus_tag="CNE_BB1p00590"
                     /EC_number="2.8.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-transferase family III family protein 22"
                     /protein_id="YP_004687529.1"
                     /db_xref="GI:339327837"
                     /db_xref="GeneID:10915045"
                     /translation="MTVSIPNMALAGVKILDLSRILAGPSSTQLLGDLGADVVKVERP
                     DAGDDTRKWGPPYVADKDGELTNESAYYLSANRNKRSIAIDLASEDGRDLIFELLDHA
                     DVLVENYKVGGLAQYGLSYEQIKDRYPRLIYCSITGFGQTGPYAERPGYDFLIQGMGG
                     IMSLTGEPEGQPMKVGVGIADVMTGMYAAVGVLAALHHRDRLGVGQHIDISLLDAQIA
                     WLVNGATNYLADGKLPTRLGNGHPNIVPYQVFGTADAPMILAVGNDSQFVRFCKVADL
                     LHLTTDLKFSTNPARVAHRQEVCELIEGALRKRKRIEWLSELEGVGVPCGPVNNLEDV
                     FSDPHVKARGARIEVPCDWARDGHVRLLANPLKFSKTPASYRRPPPRLDEHREDVLKD
                     WLSSNK"
     misc_feature    58291..59451
                     /locus_tag="CNE_BB1p00590"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            59476..60663
                     /gene="bcd"
                     /locus_tag="CNE_BB1p00600"
                     /db_xref="GeneID:10915046"
     CDS             59476..60663
                     /gene="bcd"
                     /locus_tag="CNE_BB1p00600"
                     /EC_number="1.3.8.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase short-chain specific"
                     /protein_id="YP_004687530.1"
                     /db_xref="GI:339327838"
                     /db_xref="GeneID:10915046"
                     /translation="MYSLTNAQKDLQLKARDLAQCAFAPTAANTDVTEAYPWANVDRL
                     LTEGFMGMTIPKEYGGQGRSYHDTVIVIEEMAKACATMGRITVEANMGAIGAIMNYGT
                     EEQKKIAAAAVLSGDKPAICISEPNAGSAASEMTTRADRKGDRYILNGEKYWITGGGV
                     SRLHLIFARVFDDGVDQGICAFICVREGNSPENLVVGRRLYAMGVRGIPETHLEFRDL
                     QVHKSMLVVPPGGLKRGFASLMNAYNAQRVGAGTVALGIAQGAFEEAVTYAKERQQFG
                     RPIAEFQGLQWMISDMSIQLEAARLLLHAAACSGESFPDIAMAARAKIFAAETANKVT
                     NDSLQIYGSSGYGRHNPMERHVRDARMFTIAGGTAQILRTQVAGSILDMKLPQTRGGF
                     LPK"
     misc_feature    59476..60633
                     /gene="bcd"
                     /locus_tag="CNE_BB1p00600"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    59497..60621
                     /gene="bcd"
                     /locus_tag="CNE_BB1p00600"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(59749..59751,59836..59838,59842..59844,59935..59937,
                     59941..59943,60565..60573,60577..60579,60583..60585)
                     /gene="bcd"
                     /locus_tag="CNE_BB1p00600"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            60709..61695
                     /locus_tag="CNE_BB1p00610"
                     /db_xref="GeneID:10915047"
     CDS             60709..61695
                     /locus_tag="CNE_BB1p00610"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor family protein
                     62"
                     /protein_id="YP_004687531.1"
                     /db_xref="GI:339327839"
                     /db_xref="GeneID:10915047"
                     /translation="MKRRAFIQTMSVIGAGMAARATGAYAAADAAAFPTAPVRLVAPF
                     PPGGTVDILARVVSAQLTRELGQSVVVENRAGAGGTIGADAVARSKPDGYTILFGAAH
                     HAIAQTVYPSLPYDIRKMTPISFLGRVDHVLLVTNKLPVKNVSELVAYLKAHPDTVAY
                     GTPGSGTLHHLMAEQFKAVTGTRMMHVPYKGSSPAMVDLISDTIQVYFETMPSALQYV
                     RNGSVRALAVTSKQRSRSLPNLPTIAESGVPNYDAASWYGLFSAAGTPAPIVAKVNAA
                     TARAFEDSAFVTQWRNQGAEPGGGKPGVLQKLLISEVDRWSSVAKEANIRIE"
     misc_feature    60868..61683
                     /locus_tag="CNE_BB1p00610"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(61781..62710)
                     /locus_tag="CNE_BB1p00620"
                     /db_xref="GeneID:10915048"
     CDS             complement(61781..62710)
                     /locus_tag="CNE_BB1p00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687532.1"
                     /db_xref="GI:339327840"
                     /db_xref="GeneID:10915048"
                     /translation="MTWSVIFALTPVAALVALGQLLRRSEFLAPTFWPQAERLCYYVL
                     LPALFAHGLAEAHLQSIPVLPLAGVLIFSTVVVAIILVLVRPLVRVDGASFTSVFQGA
                     VRFNNYVGVTLAAGLFGAKGVALAAVCNAAIVPTVNLLCVLVFARYGSSQCKGTALLR
                     QIATNPLVVACLVGISMQMFGVTFPRIIEPAIGAIGAASMPLGLLCVGAALNFEGTKQ
                     WAEPVAVASVVKFLVMPVLTLAAARILHLSDPALTVALLFQALPTASSSYIMARQLGG
                     DAPLMAGITAAQTVIAAGAMPVVLATLVAVQVI"
     misc_feature    complement(61799..62710)
                     /locus_tag="CNE_BB1p00620"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0679"
                     /db_xref="CDD:223751"
     gene            complement(62846..63745)
                     /locus_tag="CNE_BB1p00630"
                     /db_xref="GeneID:10915049"
     CDS             complement(62846..63745)
                     /locus_tag="CNE_BB1p00630"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004687533.1"
                     /db_xref="GI:339327841"
                     /db_xref="GeneID:10915049"
                     /translation="MSLRPLRTLVAIVQHGTFARAGDAIGLTQSAVSLQVKALEEEFA
                     VKLFDRSRRKPVLTEAGRVLLAQAEQVLSLYDGIPGALRDEKALVGRLRVGAIHTALS
                     APLPEALLSLRAAHPLLRVHVTAGMSAELAQRVASGDLDAAITTHPVGAHPPDLVWHM
                     LYEDRFWVLAPPQAKEKKTSEILANLPFIRFDAQAWAGRQIANELRRLGVRVREEMVL
                     DSQETIVRMVARGLGAAIVALPDATLAQLPAVAKFPFGLPQIHRSVVMLEHQSRPTGQ
                     FADVLADSIRSATLSISHQIHNK"
     misc_feature    complement(62882..63745)
                     /locus_tag="CNE_BB1p00630"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(63560..63739)
                     /locus_tag="CNE_BB1p00630"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(62897..63475)
                     /locus_tag="CNE_BB1p00630"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_2; cd08427"
                     /db_xref="CDD:176118"
     misc_feature    complement(order(63056..63061,63065..63070,63086..63103,
                     63371..63391,63395..63397,63407..63409,63416..63421,
                     63425..63430))
                     /locus_tag="CNE_BB1p00630"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176118"
     gene            complement(63745..64647)
                     /locus_tag="CNE_BB1p00640"
                     /db_xref="GeneID:10915050"
     CDS             complement(63745..64647)
                     /locus_tag="CNE_BB1p00640"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687534.1"
                     /db_xref="GI:339327842"
                     /db_xref="GeneID:10915050"
                     /translation="MSDFTSNPPTLRQLELFLSLASSEGIATAGARLGMTPSATSHAL
                     RALETILGTPIVDRSGTHLSLTHTGELILPHVRDVFSSLHLVQTTAAASAGLKTGKVR
                     IGSFGPSSSLKLLPPLLEKFNARYPGIDVYVTEKPDAEIEQDLHEKRIEIGVVTLPKA
                     QFDTHPLAVDEFIAVLPENHPLAKNESVSLQDLAKYPLVLTHAGSQDLITRLFERSEI
                     KPRVTHELSQLLSILEFVSRGQGVSIIASLAAPSKYDGVVYRSLTPRASRRIGLACLN
                     EQRLSPAAQALWQQAKKLQVKKTP"
     misc_feature    complement(63772..64623)
                     /locus_tag="CNE_BB1p00640"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(64438..64617)
                     /locus_tag="CNE_BB1p00640"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(63775..64290)
                     /locus_tag="CNE_BB1p00640"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(63934..63939,63943..63948,63964..63981,
                     64243..64263,64267..64269,64279..64281,64288..64290))
                     /locus_tag="CNE_BB1p00640"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            64755..65954
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /db_xref="GeneID:10915051"
     CDS             64755..65954
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /EC_number="2.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase AatA"
                     /protein_id="YP_004687535.1"
                     /db_xref="GI:339327843"
                     /db_xref="GeneID:10915051"
                     /translation="MFAKMMESLRPSPIQEMAELSRRATAAGNDIVDMTLGEPDFPTP
                     SHIGEAAVRAIAEGQTRYTPINGSVRLREAIVEKFWRDNGIRTSMADISVGCGGKQVI
                     YQAFLATLNPGDEVLIPAPYWASYGDIVTMNGGVLKPIGTTPEQGYVMQPESLQAAIT
                     SKTKWLVLNSPSNPSGTAYTRTQIESFCEVIRRSANQEFLILADDIYEHILFDGRTFC
                     TLANIAADLAGRILTVNGVSKAYSMTGWRVGFACGPKALIDAMTKIQMQVNSHTSSIS
                     QAAAVAALTGPQDEVVRRCAAFQARRDLLLARFSEIEGLRTPTPEGAFYVFPDIRTFI
                     GKRKADGEVIANDVDFATYLLGAGVAVVPGSGFGMPGFMRLSYATSDEKLEQAACRIK
                     AAVERLS"
     misc_feature    64755..65951
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /note="aspartate aminotransferase; Provisional; Region:
                     PRK05764"
                     /db_xref="CDD:235596"
     misc_feature    64848..65933
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(65043..65051,65121..65123,65271..65273,65373..65375,
                     65460..65462,65466..65471,65493..65495)
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(65052..65054,65151..65153,65352..65354,65487..65495,
                     65580..65582,65589..65591)
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    65469..65471
                     /gene="aatA1"
                     /locus_tag="CNE_BB1p00650"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            66009..67616
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /db_xref="GeneID:10915052"
     CDS             66009..67616
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase AlsS"
                     /protein_id="YP_004687536.1"
                     /db_xref="GI:339327844"
                     /db_xref="GeneID:10915052"
                     /translation="MTTVSELIGERLYAVGCRRSFGIPGGEVLAVMRGLDDAGVNFTL
                     VKHENSGGFMAEGVHHRDGAPGVLVATLGPGVANAINVVANAWQDRVPMIFLTGCVDE
                     SEAATYTHQVFDHAQLMRPITKASLRMTADAAEVTIDKAIAIAMDDPPGPVHIDVPIS
                     VALQTVKPAAGAKRSQPAPVVPANSPAFEEARRWLAEAKRPIMIAGVEALHHGAEHEI
                     QAFVEELGIPLITTYKAKGIVDERHEMVIGGAGLSPMADKILLPLIEAADLVLLTGYD
                     PIEMRVNWRNVWSDEQRVVEFAATRNTHYVHQASHSFVGSIKEGLRKFRGDTSRASTW
                     TPGEVAEITAKLAAIYRTDEEWGPSAIVDVARRLLPDNTVASVDSGAHRILLSQTWKC
                     YEPRGLMQSSGLCTMGCSLPLGIGAKLAEPSRAVAVFTGDACLEMTLGEFATARDAKT
                     PVIVFVFADESLSLIEIKQRANGQPNLGVDFDATDFAAVGRALGGQGFDVRSRDELAR
                     AIQESLDADCFSVISCHIPRMAYDGRI"
     misc_feature    66009..67598
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="Thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase] [Amino acid transport and metabolism /
                     Coenzyme metabolism]; Region: IlvB; COG0028"
                     /db_xref="CDD:223107"
     misc_feature    66024..66485
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(66063..66065,66078..66083,66093..66095,66105..66107,
                     66129..66149,66156..66158,66165..66170,66177..66182,
                     66186..66194,66228..66230,66249..66251,66261..66263,
                     66270..66275)
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(66078..66086,66093..66095,66105..66107,66132..66134,
                     66138..66149,66153..66155,66228..66230,66237..66242,
                     66246..66251,66258..66260,66360..66362,66369..66371)
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(66078..66080,66150..66152,66228..66230,66240..66242)
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    66573..66977
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    67080..67598
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(67227..67229,67299..67310,67383..67385,67389..67391)
                     /gene="alsS"
                     /locus_tag="CNE_BB1p00660"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            67727..69184
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /db_xref="GeneID:10915053"
     CDS             67727..69184
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /EC_number="1.2.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP+ dependend succinate-semialdehyde
                     dehydrogenase GabD"
                     /protein_id="YP_004687537.1"
                     /db_xref="GI:339327845"
                     /db_xref="GeneID:10915053"
                     /translation="MSFTLIRSDLVRSQVLIDGKWSQAETTFEVSDPASGEVITHVPD
                     CTPALARSAVDAAEAALPAWRQTSAKARTKVLKRWRRLVLDNVHDLARIISSEQGKPL
                     LEATAEIEYAASYIEWFAEQGPRLNGHLIPSPISSRQLQVRREPVGVVAVITPWNFPA
                     AMIARKIATALAAGCTVVCKPAEDTPLTSLALLAEAGAPAGVANIVTASRARTPELVS
                     AWLEDFRVRKISFTGSTAVGKLLAQRSAATLKRLSLELGGNAPFIVFPDADLDAAVEG
                     LIAAKLRNGGQTCVSPNRVFVHNDVIDAFTTKLVKRVSALKVGPAEDPASQIGPMINQ
                     GAVRKIDEHVSDAISRGARLLAGGRRLEEIGRNFYAPTVLADVDDTMMFSREETFGPV
                     VPVTQFATESEVIRLANDTAYGLAGYFYSRDVGTVHRVADALEVGIVGVNEGAIGSEA
                     APFGGVKESGYGREGSVWGLDDYVNVKYVCIGGLQ"
     misc_feature    67814..69169
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(67928..67930,67955..67957,68078..68080,68087..68092,
                     68096..68122,68138..68146,68159..68161,68405..68407,
                     68441..68443,68453..68455,68462..68464,68633..68635,
                     68645..68647,68783..68785,68990..68992,68996..69001,
                     69011..69013,69017..69019,69026..69028,69032..69052,
                     69068..69070,69077..69082,69098..69100,69113..69115,
                     69149..69169)
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(68183..68197,68219..68221,68264..68266,68270..68275,
                     68417..68428,68435..68437,68444..68449,68489..68497,
                     68591..68593,68885..68887,68891..68893,68969..68971,
                     69083..69085)
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(68195..68197,68489..68491,68582..68584,68591..68593)
                     /gene="gabD1"
                     /locus_tag="CNE_BB1p00670"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            69261..70433
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /db_xref="GeneID:10915054"
     CDS             69261..70433
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /EC_number="3.5.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase ArgE"
                     /protein_id="YP_004687538.1"
                     /db_xref="GI:339327846"
                     /db_xref="GeneID:10915054"
                     /translation="MSAQDSAQVSTRTMEWLRTLIGYKTVSGSDSNLELLECVEATLL
                     ARGFQVRYSRSPDGARANLFASIGRGDGGLLFSGHTDVVPTTGQEWSRPEFTLTEEQD
                     RLYGRGTTDMKGYIAAVLAAVESFPLENLRSPLHVALTYDEEIGCVGVRGLLADLSSA
                     GIRPAACVVGEPTRLQVVRAHKGRHSYRCHVRGRAAHSSLAGLGINALVAASRVVGLV
                     SHRADMLKNHENDQGFYVPYSTMAPCRLLAGNANNVIPEAAEFDFDLRFLPSTDPDDV
                     MAPIINAATLIEGELRTKVEDASVRIERRTAVPALAEQSGSDAVAEMALRAGAQRGAN
                     VAFTTEGGLYQQAGIPTIICGPGDIAQAHTADEYIERSQLAAANRFVRRMLDALSQ"
     misc_feature    69288..70430
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /note="acetylornithine deacetylase; Provisional; Region:
                     PRK07522"
                     /db_xref="CDD:236039"
     misc_feature    69303..70415
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /note="M20 Peptidase acetylornithine deacetylase; Region:
                     M20_ArgE; cd03894"
                     /db_xref="CDD:193514"
     misc_feature    order(69495..69497,69591..69593,69687..69692,69771..69773)
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193514"
     misc_feature    order(69816..69818,69849..69860,69876..69878,69882..69887,
                     69894..69899,69903..69908,69912..69914,69978..69980,
                     69984..70007,70023..70028,70050..70052,70056..70058,
                     70266..70268)
                     /gene="argE1"
                     /locus_tag="CNE_BB1p00680"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193514"
     gene            complement(70540..71811)
                     /locus_tag="CNE_BB1p00690"
                     /db_xref="GeneID:10915055"
     CDS             complement(70540..71811)
                     /locus_tag="CNE_BB1p00690"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004687539.1"
                     /db_xref="GI:339327847"
                     /db_xref="GeneID:10915055"
                     /translation="MTETTSMTKKSKKSSAPKLFPDELIDQLLAQVQNKDAESILGES
                     GLAGLLKKQLAERMLAAELTHHLASEAKQGKSGNHRNGSSAKTVITPNGELELDIPRD
                     RQATFEPQLVAKYQRRLSGFDDHVISMYARGMSVREIQGHLQELYGLQVSPDLISTIT
                     DEVLAEVDQWQQRPLEAMYPIVYFDALRLKIRDEGTVRNKAVYLALGIRADGRKEVLG
                     LWIEQTEGAKFWLKVFNELKNRGLEDILIAVVDGLRGFPQAIEAVYPAAQIQTCIVHL
                     IRNSLNLASWKDRKGLATALKPIYQAATADAAATALDAFAGSDWGRKFPTVADMWRRQ
                     WEQVIPFFAYPPEVRRIIYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNI
                     EKDWKMPPITWKQAANQFAILFGDRFTNALR"
     misc_feature    complement(70621..71751)
                     /locus_tag="CNE_BB1p00690"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    complement(70567..71715)
                     /locus_tag="CNE_BB1p00690"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            72116..73081
                     /locus_tag="CNE_BB1p00700"
                     /db_xref="GeneID:10915056"
     CDS             72116..73081
                     /locus_tag="CNE_BB1p00700"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor family protein
                     149"
                     /protein_id="YP_004687540.1"
                     /db_xref="GI:339327848"
                     /db_xref="GeneID:10915056"
                     /translation="MQRRRFCGAMIAGGFGAYIAPSFAMERPIRFVVPFAPGGSGDMI
                     PRMVAPSISELLGQPVIIENKAGGGGSIGANYVSRSSPDGLTIGVATVSTHCIFPAVS
                     KSAPYDPLKDFVYVSNLARVPNVVSVHPSVPASNMREFIALIRDPKSNLSFGSPGVGS
                     LGHMMGELLMQQTGGRMLHVPYRGAGLALQDAVAGQVQVLCDNLPASLPHIKSGKLRA
                     LAVAWPSRVTQLPSIPTFGELGMADLNGPAWFGLVAPARTSSAVVDRLQKAVAKALAR
                     PEVRQNIESTGAEPVGGTAMAFSEDVRAEYAKWKRVAEIGKISLE"
     misc_feature    72245..73066
                     /locus_tag="CNE_BB1p00700"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            73156..76003
                     /gene="ppc"
                     /locus_tag="CNE_BB1p00710"
                     /note="phosphoenolpyruvate carboxylase Ppc"
                     /pseudo
                     /db_xref="GeneID:10915057"
     gene            76695..77126
                     /locus_tag="CNE_BB1p00760"
                     /db_xref="GeneID:10915058"
     CDS             76695..77126
                     /locus_tag="CNE_BB1p00760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687541.1"
                     /db_xref="GI:339327849"
                     /db_xref="GeneID:10915058"
                     /translation="MSDAKQETRRTLRTERVSISRALRLSVPPDARPAPVNGKDWLRQ
                     RKEQLQAARAAAKQRRDLLRAEIMSAVQEVAREERTAARLEAERLKAEAKAARTYTRE
                     DARAGAKFERGQPTRSASKRKTLANEKRKLVSYADLLRMRG"
     gene            77119..77511
                     /locus_tag="CNE_BB1p00770"
                     /db_xref="GeneID:10915059"
     CDS             77119..77511
                     /locus_tag="CNE_BB1p00770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687542.1"
                     /db_xref="GI:339327850"
                     /db_xref="GeneID:10915059"
                     /translation="MGDLVEVRQGGLPIDFVEGGVDLVIRFDALSDKRLNARWTMSNR
                     RLTCIRYRPNAAAADPLPSFPPVRLQRQLLKYGGHSTLRYSGQIIDMDMRQSILGMTV
                     LVVERSAYLCVIKNALLPRQSRAAMQFR"
     misc_feature    77155..>77262
                     /locus_tag="CNE_BB1p00770"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            77746..78027
                     /locus_tag="CNE_BB1p00780"
                     /db_xref="GeneID:10915060"
     CDS             77746..78027
                     /locus_tag="CNE_BB1p00780"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_004687543.1"
                     /db_xref="GI:339327851"
                     /db_xref="GeneID:10915060"
                     /translation="MKPSQVKPISYLKSHAAEIVRDITESGEPMLITQNGEAKVVVQD
                     AQSYEDMQQTVALLKILAMGQNDIETGNFTPTDEVFAELERMDREEGIE"
     misc_feature    77758..77952
                     /locus_tag="CNE_BB1p00780"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            78961..79083
                     /locus_tag="CNE_BB1p00790"
                     /db_xref="GeneID:10915061"
     CDS             78961..79083
                     /locus_tag="CNE_BB1p00790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687544.1"
                     /db_xref="GI:339327852"
                     /db_xref="GeneID:10915061"
                     /translation="MWGLIGYTIPPQVRQLDFTFCSAKNWITKPCEKERDGVSN"
     gene            complement(79336..79770)
                     /locus_tag="CNE_BB1p00800"
                     /db_xref="GeneID:10915062"
     CDS             complement(79336..79770)
                     /locus_tag="CNE_BB1p00800"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004687545.1"
                     /db_xref="GI:339327853"
                     /db_xref="GeneID:10915062"
                     /translation="MTVKRMDNVLIVVDDLEAVKAFFFELGLELEGQTTVEGPSVGSL
                     IGLGDVRATLAMLRTPDGQGIELDKFHTPNAVRFGPVDAPVNALGLRRIMFAVDDIDA
                     VVARMQAHGAELIGQMQYEKSYRLAYIRGPEGIIVGLAEQLG"
     misc_feature    complement(79342..79764)
                     /locus_tag="CNE_BB1p00800"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_7; cd08353"
                     /db_xref="CDD:211359"
     misc_feature    complement(order(79345..79347,79360..79368,79387..79395,
                     79411..79413,79426..79428,79453..79455,79462..79467,
                     79474..79515,79549..79554,79561..79563,79573..79578,
                     79579..79584,79588..79593,79630..79632,79636..79644,
                     79651..79653,79687..79695,79729..79764))
                     /locus_tag="CNE_BB1p00800"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:211359"
     gene            80152..80850
                     /locus_tag="CNE_BB1p00810"
                     /db_xref="GeneID:10915063"
     CDS             80152..80850
                     /locus_tag="CNE_BB1p00810"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_004687546.1"
                     /db_xref="GI:339327854"
                     /db_xref="GeneID:10915063"
                     /translation="MSNSKLEVLTPHNSQIIFIDHQPQMAFGVQSMDRQTMKNNVVGL
                     AKAAKIFDIPTTITTVESDSFSGYSYPELLDVFPGKQTLERTSMNSWDDQKVRDALAA
                     NGRKKVIVAGLWTEVCNTTFALCAMLEGNYEIYMVADASGGTTKEAHDYAMQRMVQAG
                     VVPVTWQQVLLEWQRDWKNRDTYDAVMNVAKEHSGAYGMGVDYAYTMVHKAEQRTATK
                     HESLAPVHAQVIER"
     misc_feature    80197..80676
                     /locus_tag="CNE_BB1p00810"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    order(80209..80211,80404..80406,80503..80505)
                     /locus_tag="CNE_BB1p00810"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    order(80218..80220,80227..80229,80365..80367)
                     /locus_tag="CNE_BB1p00810"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    80488..80493
                     /locus_tag="CNE_BB1p00810"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            80988..81614
                     /locus_tag="CNE_BB1p00820"
                     /db_xref="GeneID:10915064"
     CDS             80988..81614
                     /locus_tag="CNE_BB1p00820"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004687547.1"
                     /db_xref="GI:339327855"
                     /db_xref="GeneID:10915064"
                     /translation="MSKLPLLEPADCALILVDEQAGLAFAAGSQDPQILRSNGLAVAK
                     TAVAFDLPVVVSTSASKVYSGPLMPAFREVLPNVTPIERRNMNLWEDDAVRDAITATG
                     KRTLIIAGMLTEACVSFPVLSALSEGYQVYVVADACGGLTPTSHDLALRRMASAGAVM
                     TSWLQLLLEFQRDWTRHDTYEKARSIVVEHGGGYGTGLAYARDMIKPT"
     misc_feature    81024..81503
                     /locus_tag="CNE_BB1p00820"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    order(81039..81041,81234..81236,81333..81335)
                     /locus_tag="CNE_BB1p00820"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    order(81048..81050,81057..81059,81195..81197)
                     /locus_tag="CNE_BB1p00820"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    81318..81323
                     /locus_tag="CNE_BB1p00820"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            complement(82108..83820)
                     /locus_tag="CNE_BB1p00830"
                     /db_xref="GeneID:10915065"
     CDS             complement(82108..83820)
                     /locus_tag="CNE_BB1p00830"
                     /EC_number="3.4.14.11"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidyl-peptidase, peptidase family
                     S15"
                     /protein_id="YP_004687548.1"
                     /db_xref="GI:339327856"
                     /db_xref="GeneID:10915065"
                     /translation="MQIDWDVEIPMDDGLVVRADVFRPKEEGRYPVLMSYGPYAKGLP
                     FQVGFPAQWQSLTTKHPEILKGSSGKYANWETADPERWVPLGYICIRVDSRGAGRSPG
                     VIDCFSPREAQDFYDCIEWAAKQPWSNGKIGLAGVSYYGATQWLVAAKRPPHLAAICP
                     FEGFSDYYRDACRHGGILNTFMVAWYPKQVENVQHGLGRRGHVNPNTGLPISGPAELS
                     DEELLANRVDINATQLSAELISDSYFDGRRADLGAIEVPVLSCANWGGHGLHLRGNVQ
                     GYLGAGSKHKWLELHGLEHWTEFYTDYGVALQKRFFDHFLKGEDNGWDRQPPIKMQVR
                     HVDRFVERDEHEWPLARTAWTPMYLDAGAQSLRSEPSVTASRVSFDGMAGKVSFSTAP
                     FERETEVTGPLSATLWISTTARDADLFLTLRAFAPDGKEHLILGAVEPNAPLAQGWLR
                     ASHRKLDPQASRPYQPVHTHQEIQLLEPNEIYELQVEIWPMCFVFQKGYRLVLTVGSS
                     DFEHDLPGPYPQIYGKSMRGSSVLLHDHPDDRRSDRFAGQTTVHTGEKYASFLLLPVI
                     PATC"
     misc_feature    complement(82117..83805)
                     /locus_tag="CNE_BB1p00830"
                     /note="Predicted acyl esterases [General function
                     prediction only]; Region: COG2936"
                     /db_xref="CDD:225487"
     misc_feature    complement(82225..82860)
                     /locus_tag="CNE_BB1p00830"
                     /note="X-Pro dipeptidyl-peptidase C-terminal non-catalytic
                     domain; Region: PepX_C; pfam08530"
                     /db_xref="CDD:254857"
     gene            complement(83854..84933)
                     /locus_tag="CNE_BB1p00840"
                     /db_xref="GeneID:10915066"
     CDS             complement(83854..84933)
                     /locus_tag="CNE_BB1p00840"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004687549.1"
                     /db_xref="GI:339327857"
                     /db_xref="GeneID:10915066"
                     /translation="MYKERQASFAVYGKAGSEPGGSRRAQPIVRLYALALFALPCASY
                     ATNAQLYGLADAYVGVTHLSGQRSATGVESGGLQTSFWGMTGSEDLGAGLKANYRLEG
                     FFQMDTGANGRAPTDGLFSRNAYVGLEGGFGEVRLGRLANPTFLATALFDAFSGSTKF
                     SPLQNVLWTPQQGRFIAGDTAWNNAIGYYSPEFAGISFRGLYSLGEQPGTNSQNNAVG
                     MLLYDRGPLSASFGIQKTRLGPGLPAGSWAQTAMVGGLSYDFKAIKLLTEYAHTSTSG
                     ASTTTDALQVGAQIPVGSGKILASAVSSRVRSDVMADYRRHGLAGGYDYALSKRTDVY
                     AVTMFDKVTGKGSGTSFALGMRHKL"
     misc_feature    complement(83860..84786)
                     /locus_tag="CNE_BB1p00840"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(84391..84393,84478..84480,84568..84570,
                     84691..84693,84775..84777))
                     /locus_tag="CNE_BB1p00840"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(83863..83865,83869..83871,83941..83943,
                     83950..83955,84382..84387,84391..84393,84517..84525,
                     84550..84564,84568..84573,84613..84624,84628..84630,
                     84634..84642,84646..84648,84664..84678,84760..84768,
                     84772..84774))
                     /locus_tag="CNE_BB1p00840"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     gene            complement(85153..86484)
                     /locus_tag="CNE_BB1p00850"
                     /db_xref="GeneID:10915067"
     CDS             complement(85153..86484)
                     /locus_tag="CNE_BB1p00850"
                     /EC_number="3.7.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetase"
                     /protein_id="YP_004687550.1"
                     /db_xref="GI:339327858"
                     /db_xref="GeneID:10915067"
                     /translation="MPPDTTMELNHTHDASRHSWLDSANAAGCDFPLQNLPLCIFRRL
                     GRAEPWRGGVAIGDQIVDLAALHGRGCLQDLAAEATRAAAAPTLNALLDLGPSAWRAL
                     RHGIFALLEADSVHERPVRETLVPQAAAEFAVPIRIGDYTDFYTSLDHAVNCCRQFGL
                     EVNPNFDWLPIAYHGRVSSIGVSGQQVYRPMGQYRADPGSAPVYGPCQRLDYELEVGA
                     VIGIGNARGTPIPLAKAQQHIFGLCLLNDWSARDIQTWEMQPLGPFLAKNFATTLSPW
                     IVTLEALLPYRTGWTRSPGRPQPLDYLRSADNAAAGAFDIQLEVSILSARQLTQGRQP
                     RTLTHTSFRHQYWTLSQMIAHHTMGGCNLQSGDLLGSGTISGPAPGEAGALIELTVSG
                     TQPVDIGDGEQRGFLEDGDTVVFRGWCERDDYARIGFGLNYGTVLPAPASA"
     misc_feature    complement(85165..86430)
                     /locus_tag="CNE_BB1p00850"
                     /note="fumarylacetoacetase; Region: PLN02856"
                     /db_xref="CDD:215461"
     misc_feature    complement(86080..86385)
                     /locus_tag="CNE_BB1p00850"
                     /note="Fumarylacetoacetase N-terminal; Region:
                     FAA_hydrolase_N; pfam09298"
                     /db_xref="CDD:255272"
     misc_feature    complement(85309..86064)
                     /locus_tag="CNE_BB1p00850"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            complement(86474..87304)
                     /locus_tag="CNE_BB1p00860"
                     /db_xref="GeneID:10915068"
     CDS             complement(86474..87304)
                     /locus_tag="CNE_BB1p00860"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase protein"
                     /protein_id="YP_004687551.1"
                     /db_xref="GI:339327859"
                     /db_xref="GeneID:10915068"
                     /translation="MHLQRGPPTMTRRFVDLSIYLENDVVSDPPGYGPRIEYLSHRST
                     AEQVTSFFPGLKPSDLPDSEGWAIERIQLNTHNGTHLDAPYHFHSTMNESLGQRERAI
                     TIDEVPLEWCFQPGVKLDFTGLDDGYVVTANDVDAELDRIGHVLKPLEIVVVNTRAGK
                     RYGQPDYVSSGCGMGFDATMYLLERGVRLTGTDAWSWDAPFVHTARKYAETQDASLIW
                     EGHKAGRNIGYCHLEKLHNLEALPPHGFYISCFPHKIRGASAGWTRAVAIFDDALNAA
                     "
     misc_feature    complement(86702..87265)
                     /locus_tag="CNE_BB1p00860"
                     /note="Putative cyclase; Region: Cyclase; pfam04199"
                     /db_xref="CDD:252447"
     gene            complement(87324..88589)
                     /locus_tag="CNE_BB1p00870"
                     /db_xref="GeneID:10915069"
     CDS             complement(87324..88589)
                     /locus_tag="CNE_BB1p00870"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004687552.1"
                     /db_xref="GI:339327860"
                     /db_xref="GeneID:10915069"
                     /translation="MPPNPASLKWRVLIGCFLSYMFDAVDIIILAIAMPAITASLHIT
                     QAQAGLLVTATLLGIGLSSVVMGRLADTMGRRTALLLSLVTFGALTMAISGATDWRQI
                     LFLRFLSGLGLGGVWSTAAAHVNETWPAHQRGRATAFVLSSFSAGATVAALAAAYLLP
                     AHGWRVLFFLCGGAVAIAIFYVWLRVPESEVWLAQRYGDQSARASAGRASLAELFAPS
                     LLRITLLGTATSALALSAYWGASTWLPTFLVKERGLDVTTMASFVAVLNVGMFLGYNV
                     FGLLADRIGKQRAVIASLVGSGLTLPAYAFATDHATLLVLGPVFAFFMAFAGLVGSYF
                     AELFPTRIRATGAGFCFNVGRGISAFAPLALGWAATGFGFAPGIALCGGLFLLSAIVV
                     ALLPREIAEQDTGVGARKAPGTAPSLDAS"
     misc_feature    complement(87489..88589)
                     /locus_tag="CNE_BB1p00870"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(87402..88553)
                     /locus_tag="CNE_BB1p00870"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(87516..87518,87525..87530,87537..87542,
                     87549..87554,87585..87587,87594..87599,87609..87611,
                     87618..87623,87630..87632,87768..87770,87780..87782,
                     87789..87791,87801..87803,87813..87815,87855..87857,
                     87864..87869,87876..87881,87888..87890,88146..88148,
                     88164..88169,88176..88181,88215..88217,88224..88229,
                     88236..88241,88248..88253,88389..88394,88398..88403,
                     88413..88415,88422..88427,88434..88436,88485..88490,
                     88494..88502,88509..88511))
                     /locus_tag="CNE_BB1p00870"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            88755..89474
                     /locus_tag="CNE_BB1p00880"
                     /db_xref="GeneID:10915070"
     CDS             88755..89474
                     /locus_tag="CNE_BB1p00880"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687553.1"
                     /db_xref="GI:339327861"
                     /db_xref="GeneID:10915070"
                     /translation="MARLYGGSMEGREARKSAVGARGRAREEVQGLPIPEASKRERVL
                     DAAERLFAEGGFDGVSMRDIAAAADVGLPLIVYHFETKRNLYRALFERRKTLFEARLA
                     ALHEPLIAGEDPVEHIVRAFVQPVMRIQDTEAGIAYAKLVAREASDPREAERGIVADY
                     FDPFAMEFVKAIRKALPGNSAGYAHWAYLFAVGALVMSVFDSRIERISGGKVKAGDVR
                     RKSEYLVTFIAAGIRAGADRT"
     misc_feature    88857..89462
                     /locus_tag="CNE_BB1p00880"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    88881..89021
                     /locus_tag="CNE_BB1p00880"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(89824..90960)
                     /locus_tag="CNE_BB1p00890"
                     /db_xref="GeneID:10915071"
     CDS             complement(89824..90960)
                     /locus_tag="CNE_BB1p00890"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902"
                     /protein_id="YP_004687554.1"
                     /db_xref="GI:339327862"
                     /db_xref="GeneID:10915071"
                     /translation="MNAPDTALQGQDRAVIGRLYMAFELGEKSWKLSLGDGVRGPSRY
                     TVAAGDKDAVLRAIAKAKARCGLTSQVPVRSCYEAGRDGFWLHRWLTEQGIDNLVVDS
                     SSIEVNRRARRAKTDRLDGDKLLSMLLRYHAGERRVWGVARVPTPEQEDERRLHRELG
                     RLRQERTALSNRIRSLLVLHNLRVAHVGGRSWAHWWNDHGAQLPVGLRAEIERSVARL
                     SLAVTQIRTIEAQQHATVKAGAQPAIALLARLRGIGVGSAWILVKELFGWRNFHNRRE
                     VASSLGLAPTPYSSGESQVEQGISKAGNKRARWLMIELAWSWLRYQPASQLTQWFNER
                     FAPGGKRMRRIGIVALARRLAIGLWRYLEYGEIPVQASFKPVAT"
     misc_feature    complement(89875..90810)
                     /locus_tag="CNE_BB1p00890"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(90445..>90756)
                     /locus_tag="CNE_BB1p00890"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(89983..90228)
                     /locus_tag="CNE_BB1p00890"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            91164..92294
                     /locus_tag="CNE_BB1p00900"
                     /db_xref="GeneID:10915072"
     CDS             91164..92294
                     /locus_tag="CNE_BB1p00900"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004687555.1"
                     /db_xref="GI:339327863"
                     /db_xref="GeneID:10915072"
                     /translation="MDHDSTLYVGLDVHKESITVAYALGEGEVELLGKIGTTKAEVER
                     LCKRLQSKARRVRVVYEAGPCGYGLYRQLAGKGFDCMVCAPSLIPKKPGERVKTDRRD
                     AVKLVRALRAGDLSRVYVPTVEDEAFRDLSRAWVSAKDDLKRARQRLKAFLLSHGVRY
                     AGRADWGPAHRRWLSTYAFDSAWQQLAFEEHRRTIEDRLAQCARLEAALREAVVNWHF
                     YPAVLGLQTMRGVQFTTAVGMLAELGDLSRFEHPRQLMAWLGVTPSEHSSGDRRRQGS
                     ITKTGNSYARKLLVEAAWSYRHPARVSPDIQRRHEGIPKAIIDRAWDAQVRLCRRYRK
                     LAARGKNANIAVVATARELAGFIWDISQLSMSLAVSEEAPAV"
     misc_feature    91182..92183
                     /locus_tag="CNE_BB1p00900"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    91185..91613
                     /locus_tag="CNE_BB1p00900"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    91836..92096
                     /locus_tag="CNE_BB1p00900"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(92843..94258)
                     /locus_tag="CNE_BB1p00910"
                     /db_xref="GeneID:10915073"
     CDS             complement(92843..94258)
                     /locus_tag="CNE_BB1p00910"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="MocR family transcriptional regulator"
                     /protein_id="YP_004687556.1"
                     /db_xref="GI:339327864"
                     /db_xref="GeneID:10915073"
                     /translation="MAKILDLKVDRASKTALAEQIRAGITVAIESGVLLPGARLPSWV
                     DLAAQLGVARGTVKTAYERLTDAQLIVSSRAGGTRVSEHAPAVRPSTDRTRSIETDLQ
                     SDLYQHFLPGPAVFQMGVPASDCFPTTLFARLRARAARDEVEAPASYPDPRGEHELRR
                     EIAAHLALSRGIECQPSQIFITAGFSGALGIALRVLQAEGRKAWVENPGFLPSRRALS
                     ISQLTTVPVPVDDEGIDVSYGETHAPDAALALVTAGQQAPLGPTLSLARRVQLLEWAI
                     RSESWIIEDDYLGELQLKRHAAPALASQDRAGRVIHVGTFSKTISPTLRQGFVVVPPA
                     LVSRFDEAVACLASAPGPAVQMATAEFMRDGHYMRHLRRMKRIYAARSQALLAGLESR
                     EFEAYPAGLAMVVRLPDDADDKTIAREAYAYGLAPAALSGWYCSTSTQRSGLLLGVAT
                     AIEQQIPAACDRLHHLIRKFT"
     misc_feature    complement(92852..94222)
                     /locus_tag="CNE_BB1p00910"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(94016..94210)
                     /locus_tag="CNE_BB1p00910"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(94025..94036,94040..94045,94073..94075,
                     94082..94087,94091..94105,94127..94132,94136..94138,
                     94205..94207))
                     /locus_tag="CNE_BB1p00910"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(92867..93814)
                     /locus_tag="CNE_BB1p00910"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(93284..93286,93305..93310,93314..93316,
                     93395..93397,93488..93490,93629..93631,93701..93709))
                     /locus_tag="CNE_BB1p00910"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(93188..93190,93197..93199,93284..93292,
                     93416..93418,93599..93601,93698..93700))
                     /locus_tag="CNE_BB1p00910"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(93305..93307)
                     /locus_tag="CNE_BB1p00910"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            94319..94777
                     /locus_tag="CNE_BB1p00920"
                     /db_xref="GeneID:10915074"
     CDS             94319..94777
                     /locus_tag="CNE_BB1p00920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687557.1"
                     /db_xref="GI:339327865"
                     /db_xref="GeneID:10915074"
                     /translation="MILANTELNMKRQRTLLSLVVAASVAYSGVAAAHGAETGGPGDV
                     VKPNFSRAIQNIPGKSLVTVEVIYPPGGASLPHTHAKSAFIYAYVVSGSIASKVNDER
                     ERVYKAGEAFFEEPGSRHPVSRNASKTEPAKLLAVFVVDSNDKELTTPLK"
     misc_feature    94385..94774
                     /locus_tag="CNE_BB1p00920"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            94842..95459
                     /locus_tag="CNE_BB1p00930"
                     /db_xref="GeneID:10915075"
     CDS             94842..95459
                     /locus_tag="CNE_BB1p00930"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="YP_004687558.1"
                     /db_xref="GI:339327866"
                     /db_xref="GeneID:10915075"
                     /translation="MTNAVIDCILSRSAAKYYDPTATLSDEQIREVVRIGTSAPTSFH
                     MQNWRFIAVRSPEAKARLSPIAWSQPPITEAAVTFIVCGQLADSSVIPDRLAPLVEAG
                     VMPAEMVPEWEIPARNLYMEYPQRQRDEAVRTATFGAAAMIYAARSLGLGSTPMIGFD
                     AEGVHREFGLAQDEVPVLLLSVGAERLGNWPQKPRLPVADVLDLV"
     misc_feature    94857..95444
                     /locus_tag="CNE_BB1p00930"
                     /note="Nitroreductase-like family 1. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_1; cd02137"
                     /db_xref="CDD:239052"
     misc_feature    order(94863..94868,94875..94877,94929..94931,94950..94958,
                     94971..94973,94977..94979,94989..94997,95001..95015,
                     95247..95252,95259..95264,95271..95276,95283..95285,
                     95343..95348,95421..95429,95433..95444)
                     /locus_tag="CNE_BB1p00930"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239052"
     misc_feature    order(94875..94877,94881..94883,94959..94967,94971..94973,
                     95052..95054,95250..95252,95301..95315)
                     /locus_tag="CNE_BB1p00930"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239052"
     gene            95612..96109
                     /locus_tag="CNE_BB1p00940"
                     /db_xref="GeneID:10915076"
     CDS             95612..96109
                     /locus_tag="CNE_BB1p00940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687559.1"
                     /db_xref="GI:339327867"
                     /db_xref="GeneID:10915076"
                     /translation="MASPIPLQIAEKGAGSLNFLALLRWALVVIFLWFGGMKFTAYEA
                     AGIAPFIEHSPIMSWLHALFGVQGASYVIGVLELSTAAALILGAFEPIFSALGAAMSA
                     TTYLITLTFFVSTPGVAEATAGGFPAISAAPGQFLLKDLVLLAASLSLLLASLRGPWL
                     SDQKS"
     misc_feature    95666..96037
                     /locus_tag="CNE_BB1p00940"
                     /note="Protein of unknown function, DUF417; Region:
                     DUF417; cl01162"
                     /db_xref="CDD:260815"
     gene            96269..96718
                     /locus_tag="CNE_BB1p00950"
                     /db_xref="GeneID:10915077"
     CDS             96269..96718
                     /locus_tag="CNE_BB1p00950"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_004687560.1"
                     /db_xref="GI:339327868"
                     /db_xref="GeneID:10915077"
                     /translation="MQSVEIKAIENYDFDLWLPLWKGYQRFYDVDIPESVTLRTWARF
                     LDPAEPMHAALAMVGGKALGLVHSIYHRSTWETGDYCYLQDLFVADQARGGGIGRALI
                     EHVYADAKRRGASRVHWLTHEANHGAMQLYDCIADRSEFIQYRKLFA"
     misc_feature    96278..96667
                     /locus_tag="CNE_BB1p00950"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    96431..96622
                     /locus_tag="CNE_BB1p00950"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(96524..96532,96560..96565)
                     /locus_tag="CNE_BB1p00950"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            96942..97868
                     /locus_tag="CNE_BB1p00960"
                     /db_xref="GeneID:10915078"
     CDS             96942..97868
                     /locus_tag="CNE_BB1p00960"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687561.1"
                     /db_xref="GI:339327869"
                     /db_xref="GeneID:10915078"
                     /translation="MDRLVSMQAFTRVVDVGSFAGAAESLDLPKPTLTRQIQHLETHL
                     GVKLLHRTTRRISLTTEGAAYYERCVRILADVEESEQSLTHHNNSPRGTLAVDTTSVL
                     AQMVLMPRLRDFFNAYPELKLELTTNGKPIDMLKEGVDVVLRVGALDESMVARRIGQV
                     KLAFYASPIYLRRFGTPHDLTELALHKAVNFLSNRTGRETPWPLIRAGERSEVLPPSA
                     ISTNDADVYLGCALDGHGIARISQAMADPYINSGRLVEIMTEWQSDELPISAMYPQNR
                     HLSAKVRVFVNWAAEIFSRHPRFGAARRQLAA"
     misc_feature    96942..97826
                     /locus_tag="CNE_BB1p00960"
                     /note="transcriptional regulator; Provisional; Region:
                     PRK10632"
                     /db_xref="CDD:182601"
     misc_feature    96960..97127
                     /locus_tag="CNE_BB1p00960"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    97215..97817
                     /locus_tag="CNE_BB1p00960"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_3; cd08472"
                     /db_xref="CDD:176161"
     misc_feature    order(97245..97247,97257..97259,97374..97376,97413..97415,
                     97419..97421,97611..97613,97662..97664,97743..97745)
                     /locus_tag="CNE_BB1p00960"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176161"
     misc_feature    order(97248..97253,97263..97268,97272..97277,97284..97286,
                     97296..97298,97302..97322,97500..97502,97593..97607,
                     97626..97631,97638..97640)
                     /locus_tag="CNE_BB1p00960"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176161"
     gene            complement(98140..98253)
                     /locus_tag="CNE_BB1p00970"
                     /db_xref="GeneID:10915079"
     CDS             complement(98140..98253)
                     /locus_tag="CNE_BB1p00970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687562.1"
                     /db_xref="GI:339327870"
                     /db_xref="GeneID:10915079"
                     /translation="MMSCSPGKAVYSMGGKSTSVQTVSAMASEISAKWVSV"
     gene            98427..99077
                     /locus_tag="CNE_BB1p00980"
                     /db_xref="GeneID:10915080"
     CDS             98427..99077
                     /locus_tag="CNE_BB1p00980"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase"
                     /protein_id="YP_004687563.1"
                     /db_xref="GI:339327871"
                     /db_xref="GeneID:10915080"
                     /translation="MSLAPMTNGTTMTNAVIDCILSRSAAKYYDPTATLSDEQIRELV
                     RIGTSAPTSFHMQNWRFIAVRSPEAKARLSPIAWSQPPITEAAVTFIVCGQLADSSVI
                     PDRLAPLVEAGVMPAEMVPEWEIPARNLYMEYPQRQRDEAVRTATFGAAAMIYAARSL
                     GLGSTPMIGFDAEGVHREFGLAQDEVPVLLLSVGAERLGNWPQKPRLPVADVLDLV"
     misc_feature    98475..99062
                     /locus_tag="CNE_BB1p00980"
                     /note="Nitroreductase-like family 1. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_1; cd02137"
                     /db_xref="CDD:239052"
     misc_feature    order(98481..98486,98493..98495,98547..98549,98568..98576,
                     98589..98591,98595..98597,98607..98615,98619..98633,
                     98865..98870,98877..98882,98889..98894,98901..98903,
                     98961..98966,99039..99047,99051..99062)
                     /locus_tag="CNE_BB1p00980"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239052"
     misc_feature    order(98493..98495,98499..98501,98577..98585,98589..98591,
                     98670..98672,98868..98870,98919..98933)
                     /locus_tag="CNE_BB1p00980"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239052"
     gene            99265..99810
                     /locus_tag="CNE_BB1p00990"
                     /db_xref="GeneID:10915081"
     CDS             99265..99810
                     /locus_tag="CNE_BB1p00990"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="YP_004687564.1"
                     /db_xref="GI:339327872"
                     /db_xref="GeneID:10915081"
                     /translation="MPRTAALKPEQVPADSKPTLDAITKNIGFTPNMMATFAQSPVAF
                     NSWATLLGSLSKALDVKTRDSIGLAVSEVNGCNYCLTVHSYTAEHLAKLSTDEIILAR
                     KGRANDPKRDAAVQFARKVIEARGNVTDADLKAVREAGYTDANVMEIVALVAMYSLTN
                     FFNNVFDPEKDFPAVTPAGSI"
     misc_feature    99286..99777
                     /locus_tag="CNE_BB1p00990"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2128"
                     /db_xref="CDD:225039"
     misc_feature    99301..99744
                     /locus_tag="CNE_BB1p00990"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; cl00460"
                     /db_xref="CDD:260437"
     gene            99954..100652
                     /locus_tag="CNE_BB1p01000"
                     /db_xref="GeneID:10915082"
     CDS             99954..100652
                     /locus_tag="CNE_BB1p01000"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_004687565.1"
                     /db_xref="GI:339327873"
                     /db_xref="GeneID:10915082"
                     /translation="MTLDHPIFARWPVQYPDRLQLFSLPTPNGVKVGIMLEETGLAYE
                     PHRIDIMANENHDPAFLALNPNGKIPAIYDPEGPGGRPLALFESGAILIYLADKTGQF
                     LSTDPNTRYETIQWLMWQMGGVGPMFGQVGFFNKFAGKAYEDKRPRDRYATESARLLG
                     VLDERLAGRDWVMGADYSIADISLLGWVRNLIGFYEARELVGFDRFLHVQAWLDRGFA
                     RPAVQMGINIPPRD"
     misc_feature    100008..100622
                     /locus_tag="CNE_BB1p01000"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    100008..100256
                     /locus_tag="CNE_BB1p01000"
                     /note="GST_N family, Ure2p-like subfamily; composed of the
                     Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is
                     a regulator for nitrogen catabolism in yeast. It represses
                     the expression of several gene products involved in the
                     use of poor nitrogen sources...; Region: GST_N_Ure2p_like;
                     cd03048"
                     /db_xref="CDD:239346"
     misc_feature    order(100032..100037,100044..100046,100053..100055,
                     100062..100067,100230..100232)
                     /locus_tag="CNE_BB1p01000"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239346"
     misc_feature    order(100035..100037,100155..100163,100212..100217)
                     /locus_tag="CNE_BB1p01000"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239346"
     misc_feature    order(100146..100151,100155..100157,100203..100205,
                     100209..100214,100221..100223)
                     /locus_tag="CNE_BB1p01000"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239346"
     misc_feature    100281..100622
                     /locus_tag="CNE_BB1p01000"
                     /note="C-terminal, alpha helical domain of Ure2p and
                     related Glutathione S-transferase-like proteins; Region:
                     GST_C_Ure2p_like; cd03178"
                     /db_xref="CDD:198288"
     misc_feature    order(100284..100289,100296..100301,100305..100310,
                     100314..100319,100341..100343,100350..100355,
                     100365..100367,100383..100385,100389..100391,
                     100401..100406,100422..100424,100434..100436)
                     /locus_tag="CNE_BB1p01000"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198288"
     misc_feature    order(100293..100295,100311..100316,100500..100502,
                     100509..100514,100608..100610,100614..100616)
                     /locus_tag="CNE_BB1p01000"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198288"
     gene            100726..101196
                     /locus_tag="CNE_BB1p01010"
                     /db_xref="GeneID:10915083"
     CDS             100726..101196
                     /locus_tag="CNE_BB1p01010"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-like protein"
                     /protein_id="YP_004687566.1"
                     /db_xref="GI:339327874"
                     /db_xref="GeneID:10915083"
                     /translation="MIKITADMEAIIKQTMLSFVATVNADGTPNLSPKASLTVTNGVL
                     YFADIASPRTILNLRRNPAIEINVVDIFQRRGYRFKGRALVLPPGDGEYLMIADWVRA
                     TNGPEYPVNHVVKIETTSIIPLLSPAHVFARPPRSQDEIRSTYHQKYRVKPIGA"
     misc_feature    100735..100995
                     /locus_tag="CNE_BB1p01010"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_oxidase; pfam01243"
                     /db_xref="CDD:250471"
     gene            101440..102396
                     /locus_tag="CNE_BB1p01020"
                     /db_xref="GeneID:10915084"
     CDS             101440..102396
                     /locus_tag="CNE_BB1p01020"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004687567.1"
                     /db_xref="GI:339327875"
                     /db_xref="GeneID:10915084"
                     /translation="MSQVDWLSQLLQMITITGRLEVRCVYGEPWRVAWPQSAAHEIPY
                     HVVLKGRAIIENPETETTMELVGGDVVLLPHGSAHVLHDGSGHAPGLTYNRQGSAGWM
                     LSQNDGQGDHLDLLCGRFFIEPPHDRLIRNYLPTNLVVRAMDGHDDDAIGSASNHLAS
                     LVGLMRIESTGDKLGGYAMLNALTSALFTLVLRAASESEQAPAGLLALAGHPRLAPAI
                     SAMFADPARPWNLPDLADLCSMSRATFMRHFQDKLGRSAIELLTDIRMSLAANELKKP
                     MMTTETVADSVGYRSVAAFRRVFTDTMGMTPGEWRRLAREGQ"
     misc_feature    101452..102030
                     /locus_tag="CNE_BB1p01020"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    102019..102393
                     /locus_tag="CNE_BB1p01020"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    102100..102225
                     /locus_tag="CNE_BB1p01020"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    102271..102375
                     /locus_tag="CNE_BB1p01020"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(102958..103497)
                     /locus_tag="CNE_BB1p01030"
                     /db_xref="GeneID:10915085"
     CDS             complement(102958..103497)
                     /locus_tag="CNE_BB1p01030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687568.1"
                     /db_xref="GI:339327876"
                     /db_xref="GeneID:10915085"
                     /translation="MPERGRIGIFNRSYYEEVLILRVHPEILRGEGLSLVSGSGESLW
                     HGRYRSIADLEAHLCRNGTRVVKFFLHLSKEEQRKRFLARIDDPNKNWKFSMADVEER
                     KFWTKYMTAYEKCLSATSTELAPWYVVPADDKEDARLIVSQIILDTLGELKLQYPKTT
                     AERKKELSEIREQLTKQRD"
     misc_feature    complement(102997..>103494)
                     /locus_tag="CNE_BB1p01030"
                     /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
                     cl11971"
                     /db_xref="CDD:245821"
     gene            103903..104199
                     /locus_tag="CNE_BB1p01040"
                     /db_xref="GeneID:10915086"
     CDS             103903..104199
                     /locus_tag="CNE_BB1p01040"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_004687569.1"
                     /db_xref="GI:339327877"
                     /db_xref="GeneID:10915086"
                     /translation="MTRRRRQFDASFKLEVVRMVRDQGLSVSEVCRSMELGETAVRRW
                     MAQYDAECAGGPGVGKPLTAEQQRIRQLEAENRQLREDNALLKKASAFFARELK"
     misc_feature    103903..104196
                     /locus_tag="CNE_BB1p01040"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    103909..104136
                     /locus_tag="CNE_BB1p01040"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            104196..105080
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /db_xref="GeneID:10915087"
     CDS             104196..105080
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase InsF for insertion sequence IS3"
                     /protein_id="YP_004687570.1"
                     /db_xref="GI:339327878"
                     /db_xref="GeneID:10915087"
                     /translation="MSYRVVAHLQQEAVSVSNACRVLQVSRSGYYAHRRAKPSMKTLQ
                     EQTHVKAAFAASGASYGSRRVMHAVREQGVRLGRYRIRRLMREAGLRATWKRKFVSTT
                     DSKHTLPVAENVLNRQFDVAEPNRAWTSDITYVRTAQGWLYLAVVLDLYSRKVVGWSM
                     APTMPADLVMSALSMALQQRRPAPGLVLHSDRGSQYASAEYQALLARHQIVCSMSRKG
                     NCWDNAVTERFFLNLKMERVWQRQYANHAEARRDITQYIVGFYNPVRLHSTLGYLSPA
                     AYEAKSTEKEPICLSEIT"
     misc_feature    104262..105035
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    104337..104489
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    104562..104897
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    104817..105020
                     /gene="insF1"
                     /locus_tag="CNE_BB1p01050"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            105253..106929
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /db_xref="GeneID:10915088"
     CDS             105253..106929
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter SulP"
                     /protein_id="YP_004687571.1"
                     /db_xref="GI:339327879"
                     /db_xref="GeneID:10915088"
                     /translation="MQNDRKGMKKYPCKASARVLAGHYLPDLRAGLSVAGLLVPEAIA
                     YSTIANLPPQTGVIALLAGLVAYGLLGNSRFAIVSATSSSAAVVAAVAVGMAGDSLPM
                     RMLLAAGLVLITGLIFVSASLARLGSASEFIAKPVLRGYAFGLAIVIIIRQIPSFLGV
                     SLKHTDSAGFLIELARSYPQWNVWQLATGLVALVLLFAFGRSRQVPGAFVVISLGIVA
                     SRWFGLHAHGVSVVGTIELSGQMPSLPSLDHHQWAQLGEFAFALALILYAESYSSIRT
                     LALKHGDLTVPNRELLALGAANMLSGLFHGLPVGAGYSASATSEAAGAQSRWAGWFAA
                     VVVAVIMLPLLPLVALTPTAVLAAVVCHALSHALNPSVFTPYLRLHRDRILVAAAVLA
                     VLVLGVLYGLLAAIGLSLLMLLRGLSVPNVSTLGRLGEGHDFLVLAAHSDARPVPGVI
                     VLRPEAPLFFGNVEVMMQHVRTLVVNAGDSAQSIVLSLEESPDLDSTSVEALMEFERF
                     AAARGKRLFFARLKEPALALLTLAGMPGLTPSYVHYSVDDAVAAALAQSS"
     misc_feature    105325..>105477
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    105331..106851
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    105619..106344
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    106570..106851
                     /gene="sulfP"
                     /locus_tag="CNE_BB1p01060"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            107270..107389
                     /locus_tag="CNE_BB1p01070"
                     /db_xref="GeneID:10915089"
     CDS             107270..107389
                     /locus_tag="CNE_BB1p01070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687572.1"
                     /db_xref="GI:339327880"
                     /db_xref="GeneID:10915089"
                     /translation="MPFGPLLLASSVHQSAAPDVTSSARARRQFTCCDELPQG"
     gene            107544..108230
                     /locus_tag="CNE_BB1p01080"
                     /db_xref="GeneID:10915090"
     CDS             107544..108230
                     /locus_tag="CNE_BB1p01080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687573.1"
                     /db_xref="GI:339327881"
                     /db_xref="GeneID:10915090"
                     /translation="MSDLRENISALIEQASPGKVWVPTDFAHLGSRDAIDKTLQRFVR
                     AGQLRRIDRGLYDLPKLNRLTGRPTMPDYRAVVEAIARRDNLRLLVDGMTAANDLGLT
                     DAVSARVTIHTDSRRRSLKLDNLTIVFKQTAPSRLYWAGRPAMRVVQALHWLKDTLAS
                     DSERIAAALRNVLEHPDHGQSIREDLMSGFGAMPAWMRTFVRDLLDCNGTGAATGECD
                     AKNGKVSHEG"
     misc_feature    107649..>107954
                     /locus_tag="CNE_BB1p01080"
                     /note="Domain of unknown function (DUF4095); Region:
                     DUF4095; pfam13338"
                     /db_xref="CDD:257668"
     gene            108220..109263
                     /locus_tag="CNE_BB1p01090"
                     /db_xref="GeneID:10915091"
     CDS             108220..109263
                     /locus_tag="CNE_BB1p01090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687574.1"
                     /db_xref="GI:339327882"
                     /db_xref="GeneID:10915091"
                     /translation="MKADYRQIIEASDTDRRDLFLTTATRLGTAVQHIEKDFWVCWAL
                     DVLFNGVSQPPRILFKGGTSLSKAFSLITRFSEDIDITVFREDLGQPVQVAELAALSG
                     KKRRVRLEEVRQAAQAHIAGPMREQFEALVLDQMPAGRYRIELDPADRDNQTILFWYP
                     AVTADVNAYIRSAVKIEAGAKSALDPHVTASITPYVANELAHLDLAVPNVTTVAPERT
                     FWDKVIIAHGLRQWHGHRGEIRHGGQRVTRHYYDLHSMLELAKRSGWHLRDDLANDCA
                     THADMFFGSPDLGLDQARRGSFMLAPTENMREALEKDYQAMSGMIFGEVPAFSKVITA
                     VEELERLVNSESQ"
     misc_feature    108343..109221
                     /locus_tag="CNE_BB1p01090"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            109474..109656
                     /locus_tag="CNE_BB1p01100"
                     /db_xref="GeneID:10915092"
     CDS             109474..109656
                     /locus_tag="CNE_BB1p01100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687575.1"
                     /db_xref="GI:339327883"
                     /db_xref="GeneID:10915092"
                     /translation="MEALMEFERFAAARGKRLFFARLKEPALALLTLAGMPGRTPSYV
                     HYSVDDAVAAALAQSS"
     misc_feature    <109474..109578
                     /locus_tag="CNE_BB1p01100"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain found in the C-terminal region of
                     sulphate transporters as well as in bacterial and archaeal
                     proteins involved in the regulation of sigma factors;
                     Region: STAS; cl00604"
                     /db_xref="CDD:260524"
     gene            complement(109972..110412)
                     /locus_tag="CNE_BB1p01110"
                     /db_xref="GeneID:10915093"
     CDS             complement(109972..110412)
                     /locus_tag="CNE_BB1p01110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687576.1"
                     /db_xref="GI:339327884"
                     /db_xref="GeneID:10915093"
                     /translation="MSAEADIYPLNAIDKADAIDAAIGEGSRFHETYGYYAQGVGPET
                     ACLPAGWQRRLQRIQTADTNGRVGYCLDVVDLFMAKAVAARDKDRVFCMALIQYGYVS
                     PRAALSRVEDMPIEKAAQGRLRARIKRWTKALRDQGHAVPDGDA"
     gene            complement(110534..111199)
                     /locus_tag="CNE_BB1p01120"
                     /db_xref="GeneID:10915094"
     CDS             complement(110534..111199)
                     /locus_tag="CNE_BB1p01120"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004687577.1"
                     /db_xref="GI:339327885"
                     /db_xref="GeneID:10915094"
                     /translation="MPAFTDTTSVLERHLLLQLGDRIKRLRKAQNFSTVEMAKRVGIS
                     RTTLASVEAGDPAPTMGTYLRVMSVLGVAGDLALLASDTFQPPPANSAAASSKRTRPQ
                     VQVMVTTDPSRHQAQDLQSMALHKEAIRMIHEDPALLGRTQEMLRRWRSQGDSRSDSL
                     WSEWETILANQSWRKALGRTRRAQELRQASPLPAILPDALRQDVLAQIQALKKGVVIG
                     DQE"
     misc_feature    complement(<110891..111148)
                     /locus_tag="CNE_BB1p01120"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(110984..111142)
                     /locus_tag="CNE_BB1p01120"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(111041..111043,111116..111118,
                     111128..111130))
                     /locus_tag="CNE_BB1p01120"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(111044..111046,111119..111121))
                     /locus_tag="CNE_BB1p01120"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(111038..111043,111053..111055,
                     111062..111064,111095..111100))
                     /locus_tag="CNE_BB1p01120"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            111447..111593
                     /locus_tag="CNE_BB1p01130"
                     /db_xref="GeneID:10915095"
     CDS             111447..111593
                     /locus_tag="CNE_BB1p01130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687578.1"
                     /db_xref="GI:339327886"
                     /db_xref="GeneID:10915095"
                     /translation="MHSGISAGPNLQFHDHEIIGGSGSGGGGGLYGAMDWSAKVGLHL
                     RCKP"
     gene            111862..112152
                     /locus_tag="CNE_BB1p01140"
                     /db_xref="GeneID:10915096"
     CDS             111862..112152
                     /locus_tag="CNE_BB1p01140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687579.1"
                     /db_xref="GI:339327887"
                     /db_xref="GeneID:10915096"
                     /translation="MTQTWQVRAGYYYDNVKQVANPVTNALLGNIANPWQVQVINNYY
                     LSKRTNLYLTTAYAKNASLNFDTSVGGLGTGYYLGAGKNSMFGAALGIRHIF"
     misc_feature    <111865..112149
                     /locus_tag="CNE_BB1p01140"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            complement(112264..112476)
                     /locus_tag="CNE_BB1p01150"
                     /db_xref="GeneID:10915097"
     CDS             complement(112264..112476)
                     /locus_tag="CNE_BB1p01150"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004687580.1"
                     /db_xref="GI:339327888"
                     /db_xref="GeneID:10915097"
                     /translation="MAGGVHSQQEGEPPETPPSLNEVVRLIARLGGFLARKGDGEPGV
                     KTIWQGLQRVMDFAAGIKYAREIGHE"
     misc_feature    complement(112276..>112449)
                     /locus_tag="CNE_BB1p01150"
                     /note="Transposase Tn5 dimerization domain; Region:
                     Dimer_Tnp_Tn5; pfam02281"
                     /db_xref="CDD:145436"
     gene            112547..112786
                     /locus_tag="CNE_BB1p01160"
                     /db_xref="GeneID:10915098"
     CDS             112547..112786
                     /locus_tag="CNE_BB1p01160"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_004687581.1"
                     /db_xref="GI:339327889"
                     /db_xref="GeneID:10915098"
                     /translation="MRQAATMNNASARSSRSERPHLMPVGQPFDGFVEHTTRVSPTCL
                     VTFERNRYSVPASFANRPISLRVDAARLVFVAEGH"
     gene            complement(112734..113060)
                     /locus_tag="CNE_BB1p01170"
                     /db_xref="GeneID:10915099"
     CDS             complement(112734..113060)
                     /locus_tag="CNE_BB1p01170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687582.1"
                     /db_xref="GI:339327890"
                     /db_xref="GeneID:10915099"
                     /translation="MNFNSDDFRVREGDTVLLTKWPTRVTPLHGSRDQYRTLLAEHIE
                     RLSKLQSLLYADNRYSVLLIFQAMDAAGKDGVIKHVMSGVNPQGCQVFSGLRPRTRAA
                     RHRRAG"
     misc_feature    complement(<112782..113045)
                     /locus_tag="CNE_BB1p01170"
                     /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
                     cl11971"
                     /db_xref="CDD:245821"
     gene            complement(113301..114044)
                     /locus_tag="CNE_BB1p01180"
                     /db_xref="GeneID:10915100"
     CDS             complement(113301..114044)
                     /locus_tag="CNE_BB1p01180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687583.1"
                     /db_xref="GI:339327891"
                     /db_xref="GeneID:10915100"
                     /translation="MRPCRASHDASSLAGWPTSSGNTRQFWWIGTYKEKEMALELLVL
                     TLDDTVSWHDDQNEDQFNGARPTTGAIDDRHAVSAAKALADAFRQYCHEAHLARGELA
                     RAHAKSLMSACEESFIAACEEGNFHIQRQALAWMEDAERTGGRLALASMLSSRMVCAI
                     MERALGRDWSERFSVVATADAMSAHQAEGEQYGLILRTTAIPAHQALLVTASAHCEKI
                     ARGIGIHAVRVNAQVPVAAPSQNNELYPG"
     misc_feature    complement(113358..113828)
                     /locus_tag="CNE_BB1p01180"
                     /note="Haloacid dehalogenase-like hydrolase; Region:
                     HAD_2; pfam13419"
                     /db_xref="CDD:257744"
     gene            114089..114370
                     /locus_tag="CNE_BB1p01190"
                     /db_xref="GeneID:10915101"
     CDS             114089..114370
                     /locus_tag="CNE_BB1p01190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687584.1"
                     /db_xref="GI:339327892"
                     /db_xref="GeneID:10915101"
                     /translation="MARQLTRISHCVLAYAEAEIIEFLLCTTLSSVVAEHRDVFEWIL
                     VDDLQESRDTGDVCLPGCFGGASGLADSLLGGNSVGGNVNTLHGVQIVG"
     gene            complement(114395..115513)
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /db_xref="GeneID:10915102"
     CDS             complement(114395..115513)
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /EC_number="5.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase Alr"
                     /protein_id="YP_004687585.1"
                     /db_xref="GI:339327893"
                     /db_xref="GeneID:10915102"
                     /translation="MENNAWVEVDLGKFEANVRGIQTRIGDRAEMCAVMKADACGHGI
                     ALLVPTLVALGVSSIGIARNDEARQVRQAGFTGRLLRVRAATLAEIEDGLPYGLEEIV
                     GNLDYARHIDALVHRYRRVARVHLELNSGGMSRNGFDLDSQPEREKCLAAAALPHLRV
                     VGIMTHFPVQEVSDVERGLARFRDEAAWLIASASMVRSQIQLHCANSFTTLEVPAAHL
                     DMVRTGAILFGCLPAYPDFQPIASLKSRVASVNAYAAGNTVAYDRTLCLSRDSRLANI
                     PVGYADGYRRALSNRGQALIRGRVYPVVGRVTMNTLMVDVTESPDILPGDEVVLFGTQ
                     GGSRIDVASIEAAAGTIYPDLCVGWGNSVTRVAVPANH"
     misc_feature    complement(114407..115513)
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /note="alanine racemase; Reviewed; Region: PRK13340"
                     /db_xref="CDD:183984"
     misc_feature    complement(114410..115504)
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes; Region: PLPDE_III; cl00261"
                     /db_xref="CDD:260308"
     misc_feature    complement(order(114839..114850,115016..115018,
                     115022..115024,115133..115135,115268..115270,
                     115406..115408,115412..115414))
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143484"
     misc_feature    complement(115406..115408)
                     /gene="alr"
                     /locus_tag="CNE_BB1p01200"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:143484"
     gene            complement(115571..116947)
                     /gene="astB"
                     /locus_tag="CNE_BB1p01210"
                     /db_xref="GeneID:10915103"
     CDS             complement(115571..116947)
                     /gene="astB"
                     /locus_tag="CNE_BB1p01210"
                     /EC_number="3.5.3.23"
                     /codon_start=1
                     /transl_table=11
                     /product="N-succinylarginine dihydrolase AstB"
                     /protein_id="YP_004687586.1"
                     /db_xref="GI:339327894"
                     /db_xref="GeneID:10915103"
                     /translation="MASLLDTSTSSTCEAREFNFDGLVGPSHHHAGLASGNVASMRHR
                     GTVSNPRLAALQGLEKMLALHRRGVPQAILPPLSRPNLRLLRQLGFRGNDAAVLAEAA
                     HADQRLLSAAYSASSMWVANAATVSPAADSADGKMHFTPANLSAKLHRSIEHPDTTRL
                     LRAIFADPARFVVHDAVPGATSLGDEGAANHTRLTAGHGLPGVQLFVYGGETFGAEPS
                     ARQRFDSRQYDEASRAVARLHCLDSSRVLFGKQSAAAIDAGVFHNDVIAVGNLDTLFY
                     HEAAFEDESGLIGALRRSCEAVGFTLRAIRVDSREVSLDDAVSTYLFNSQLLRDAQGR
                     TLIVVPQECLELPASRHYLEAISTPGGAVDEVLSFDLRESMRNGGGPACLRLRVVLDD
                     GQAAAIRANVFFSEELHARLTDWVCRHYRDRLLPQDLADPALLDEIRRALQELETILA
                     LPGFYAES"
     misc_feature    complement(115583..116905)
                     /gene="astB"
                     /locus_tag="CNE_BB1p01210"
                     /note="succinylarginine dihydrolase; Provisional; Region:
                     PRK13281"
                     /db_xref="CDD:237332"
     gene            complement(116931..117986)
                     /gene="astA1"
                     /locus_tag="CNE_BB1p01220"
                     /db_xref="GeneID:10915104"
     CDS             complement(116931..117986)
                     /gene="astA1"
                     /locus_tag="CNE_BB1p01220"
                     /EC_number="2.3.1.109"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine N-succinyltransferase subunit alpha"
                     /protein_id="YP_004687587.1"
                     /db_xref="GI:339327895"
                     /db_xref="GeneID:10915104"
                     /translation="MLVLRAIRFADLPALLSLAGRVGPGMTTLKADPDALARRIVTAE
                     ASFAGTIAPTERDYVFVLENTRNGDIAGVSAIKAAVGLDEAFYSFRLGQLVHSSREIG
                     VYSNKKTLFLSNDLTGCAELRTLFLDPSHRQGHNGKLLSKGRLMFAASFVDLLPDVLC
                     AELRGYLRPDGTSPFWESLGQHFFKMDFSVADDHSGGGAKSFIAELMPRFPIYADFLT
                     EEAQAVIGRVHASTEPARRMLEQEGMAYEGLVDIFDAGPVVQGHIRHLRITKESTLAI
                     AYPVPDGTRALHAGAPQLVCNTRLADFRAIVTDAAPAFGRLSLTHEECAALAVDAGNP
                     VRVATLKPGNIAHGQPT"
     misc_feature    complement(116967..117980)
                     /gene="astA1"
                     /locus_tag="CNE_BB1p01220"
                     /note="Arginine N-succinyltransferase beta subunit;
                     Region: AstA; cl11440"
                     /db_xref="CDD:264369"
     gene            complement(118006..119022)
                     /gene="astA2"
                     /locus_tag="CNE_BB1p01230"
                     /db_xref="GeneID:10915105"
     CDS             complement(118006..119022)
                     /gene="astA2"
                     /locus_tag="CNE_BB1p01230"
                     /EC_number="2.3.1.109"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine N-succinyltransferase subunit alpha"
                     /protein_id="YP_004687588.1"
                     /db_xref="GI:339327896"
                     /db_xref="GeneID:10915105"
                     /translation="MWIARPAADDDVPSLMALAEMAPPHVHTLPRTHDAIEEAIAHTR
                     EALARLVDAPADEHYQLVLEDDTGAIVGTAAIAATAGSAGAYFSYRNDVVHHVSRDLR
                     IANNVHVLTLNSDLTAHSQLSGLQVSSGHAAAATLLSRARLMLAAADRRRFADSFFAC
                     LPGQTFSDHTSPFWDAIGRKFFNMDYLSAERAVRGARNGTLIVELMPHYPVYVPLLPE
                     AACEVIGQLHPAASTAFDILAGEGFEVDRYVDIFDGGPVLEAHASRLRTLSTTRTLTV
                     AEAVDSRPGETCLIATATATQAFRCAMAPATVELDRGRILLSAATQDALHVGTGDAVI
                     VASA"
     misc_feature    complement(118024..119019)
                     /gene="astA2"
                     /locus_tag="CNE_BB1p01230"
                     /note="Arginine N-succinyltransferase beta subunit;
                     Region: AstA; cl11440"
                     /db_xref="CDD:264369"
     gene            complement(119152..120081)
                     /locus_tag="CNE_BB1p01240"
                     /db_xref="GeneID:10915106"
     CDS             complement(119152..120081)
                     /locus_tag="CNE_BB1p01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687589.1"
                     /db_xref="GI:339327897"
                     /db_xref="GeneID:10915106"
                     /translation="MDAPHGGSPWHRIVGAASIHVFLPGDPAYLPADVALLRQILELA
                     GTEHEALRVSTLTPQAATLAPPDVLILWQQEPDWLAAPQLESLVERATYVIAVGAAVL
                     WMIHTGRAKGIRVAPHWMQAAQLVAESDSILSPAIIEHAGRWTTCCGGAAVIDLALIF
                     LRDVLGTRAAADLQARLCVGQVRAPADLQRPADPVSAGHPPALVEAIALMEANLEEPL
                     QADEIARLAGVSRRQLERIFRQCLGTAPSRHYMELRLAHAQRLIRDSRHSLLQIALMC
                     GFSSGPHFSTAYRTVYGTTPREERQRILAGGAP"
     misc_feature    complement(119566..>119931)
                     /locus_tag="CNE_BB1p01240"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:260141"
     misc_feature    complement(119764..119766)
                     /locus_tag="CNE_BB1p01240"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153222"
     misc_feature    complement(119338..119454)
                     /locus_tag="CNE_BB1p01240"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(119176..119415)
                     /locus_tag="CNE_BB1p01240"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    complement(119179..119289)
                     /locus_tag="CNE_BB1p01240"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            120351..121139
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /db_xref="GeneID:10915107"
     CDS             120351..121139
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-binding periplasmic protein HisJ"
                     /protein_id="YP_004687590.1"
                     /db_xref="GI:339327898"
                     /db_xref="GeneID:10915107"
                     /translation="MNWNTKLLASLLAALGFAGTAGAQSAQVLRMGLNPTYPPFESKA
                     PSGELQGFDIDVGNAICKKLNAKCVWVENDFDGLIPALQARKFDVVNSAMNITEKRKQ
                     VIDFTAPIYVVPIQLVARKSTKLQPTPAGMKGKTVGVMRGTTQEAYLQKHWSKTGTEI
                     VSYQDQAQVFADLIAGRIDGAVQESQTALDGLLSKPEGRDFEFAGEPLVDPSTLGIGT
                     GLGIRKGDSALREKLQGAIVALKQDGTLSTLSQKYFKRDIIVKD"
     misc_feature    120402..121124
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /note="histidine ABC transporter substrate-binding protein
                     HisJ; Provisional; Region: PRK15437"
                     /db_xref="CDD:185334"
     misc_feature    120435..121112
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(120459..120461,120573..120575,120648..120650,
                     120780..120782,120900..120902)
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(120849..120851,120861..120863,120879..120881)
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    120990..121007
                     /gene="hisJ"
                     /locus_tag="CNE_BB1p01250"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            121193..122440
                     /gene="dadA1"
                     /locus_tag="CNE_BB1p01260"
                     /db_xref="GeneID:10915108"
     CDS             121193..122440
                     /gene="dadA1"
                     /locus_tag="CNE_BB1p01260"
                     /EC_number="1.4.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="YP_004687591.1"
                     /db_xref="GI:339327899"
                     /db_xref="GeneID:10915108"
                     /translation="MDADVVVIGAGIVGVSVGIHLAQRGRRVVVIDRRLPGEETSHGN
                     AGLIERASVVPYAFPRDLLTIVRYATNRQTAMRYDTRSLPSFAPWLFRYWRESAPARL
                     ARASADMLPLVANSVTEHDKLIELGGLGGLVKPDGWIEAYRTEAALERRLQVCRALGD
                     AHGLAMAALDQRGLEATEPGLGPGFIGGIHWIDPRSVTDPGRLTQGYARLFESLGGRI
                     ERDTVQALSKRAEGWQVRLQAGGDMLAAEVVVAQGPWSTELIAPLGYRIPLRPKRGYH
                     MHYQAETRHPQRYPIADAEVGYVVAPMQRGLRLTTGVEVTSPSRPPTTIQLDRAERQA
                     KPIFGLGRRLDDEPWMGNRPCTPDMRPVIGPASRHLGLWFAFGHNHHGLTLGPVTGRL
                     LAEMMTGEKPFTDPTPYRPARFG"
     misc_feature    121193..122437
                     /gene="dadA1"
                     /locus_tag="CNE_BB1p01260"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    121193..>121288
                     /gene="dadA1"
                     /locus_tag="CNE_BB1p01260"
                     /note="putative FAD-binding dehydrogenase; Reviewed;
                     Region: PRK12834"
                     /db_xref="CDD:183782"
     misc_feature    121253..122395
                     /gene="dadA1"
                     /locus_tag="CNE_BB1p01260"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            122472..123158
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /db_xref="GeneID:10915109"
     CDS             122472..123158
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ABC transporter permease"
                     /protein_id="YP_004687592.1"
                     /db_xref="GI:339327900"
                     /db_xref="GeneID:10915109"
                     /translation="MLHGYGAVIAEGTWQTVKLAFLSLLLAVLIGLLGASAKVARRKG
                     LNRVAALYTTLIRGVPDLVLMLLLFYSIQMWLNHLTDYAGIGQIDIDPFVAGVLTIGF
                     IYGAYFTETFRGAFLSVPAGQLEAGVSVGMTGFQVFRRILFPQMMRFALPGIANNWQV
                     LVKATALVSLIGLTDLVKVAQDAGKSTFSMFHFILVAAVIYLALTSASNLVLIWLGKR
                     YSLGVREARL"
     misc_feature    122472..123149
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="ABC-type arginine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     ArtQ; COG4215"
                     /db_xref="CDD:226670"
     misc_feature    122511..123101
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(122556..122561,122568..122573,122586..122588,
                     122616..122627,122631..122660,122667..122672,
                     122676..122678,122775..122780,122784..122786,
                     122790..122792,122799..122804,122808..122810,
                     122820..122825,122832..122834,122883..122885,
                     122925..122930,122937..122939,122958..122969,
                     122976..122981,123018..123023,123051..123056,
                     123063..123068,123072..123077,123084..123089,
                     123096..123101)
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(122634..122678,122958..122975)
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(122676..122678,122760..122762,122976..122978,
                     123012..123014,123021..123023,123051..123053)
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(122835..122873,122889..122894,122904..122906)
                     /gene="hisQ"
                     /locus_tag="CNE_BB1p01270"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            123158..123871
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /db_xref="GeneID:10915110"
     CDS             123158..123871
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ABC transporter permease"
                     /protein_id="YP_004687593.1"
                     /db_xref="GI:339327901"
                     /db_xref="GeneID:10915110"
                     /translation="MDMLFEYWKVYLYTDGGKMTGLAMTLWLLVLSLAIGFMAAVPLA
                     VARASSNRWLATPVRLYTYLFRGTPLYVQLLLIYSGVYGLATVRDIDVLNQFFRNGFN
                     CTILAFALNTCAYTTEIFAGAIASTAYGEVEAARAYGMSRWKLYLRVILPSALRRALP
                     NYGNEVILMLHATSVAFVATVPDLLKVARDVNAATYRSFEAFGLAAALYLVISLAVVH
                     LFKKAEYKWLAFLRPTEKT"
     misc_feature    123173..123856
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="ABC-type arginine/histidine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ArtM; COG4160"
                     /db_xref="CDD:226634"
     misc_feature    123221..123808
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(123269..123274,123281..123286,123299..123301,
                     123329..123340,123344..123373,123380..123385,
                     123389..123391,123485..123490,123494..123496,
                     123500..123502,123509..123514,123518..123520,
                     123530..123535,123542..123544,123593..123595,
                     123635..123640,123647..123649,123668..123679,
                     123686..123691,123728..123733,123761..123766,
                     123773..123778,123782..123787,123794..123799,
                     123806..123808)
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123347..123391,123668..123685)
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123389..123391,123470..123472,123686..123688,
                     123722..123724,123731..123733,123761..123763)
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123545..123583,123599..123604,123614..123616)
                     /gene="hisM"
                     /locus_tag="CNE_BB1p01280"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            123868..124701
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /db_xref="GeneID:10915111"
     CDS             123868..124701
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ABC transporter ATP-binding protein
                     HisP"
                     /protein_id="YP_004687594.1"
                     /db_xref="GI:339327902"
                     /db_xref="GeneID:10915111"
                     /translation="MMSTQALKMATPEPVPVRSTAVMPALAATGIHKRYGDHEVLSGV
                     SLAAASGDVISIIGSSGSGKSTFLRCLNFLEQPDAGDIVVSGESIRMHRGKDGKMYVS
                     DARQLRRIRTRLAMVFQHFNLWSHMTVLQNVMEAPRHVLGVARKEAEEWAAHCLDKVG
                     LNARTRQAYPAHLSGGQQQRVAIARALAMRPDVLLFDEPTSALDPELVGEVLKVMQQL
                     AAEGRTMVVVTHEMGFARSVSSQVMFLHRGKVEESGSGEKLFANPQSDRLRQFLSSNL
                     K"
     misc_feature    123928..124689
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="ABC-type histidine transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     HisP; COG4598"
                     /db_xref="CDD:226961"
     misc_feature    123949..124617
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    124039..124062
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(124048..124053,124057..124065,124222..124224,
                     124456..124461,124555..124557)
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    124213..124224
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    124384..124413
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    124444..124461
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    124468..124479
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    124543..124563
                     /gene="hisP"
                     /locus_tag="CNE_BB1p01290"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            124785..125453
                     /locus_tag="CNE_BB1p01300"
                     /db_xref="GeneID:10915112"
     CDS             124785..125453
                     /locus_tag="CNE_BB1p01300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687595.1"
                     /db_xref="GI:339327903"
                     /db_xref="GeneID:10915112"
                     /translation="MNRKRKTGNADVLVKRYAPISDGLALLFFPYAEVVIHDTASKKV
                     VYIANNLSRREVGDDSAIDELDIDPAKRLYGPYEKVNWDGRRMRSVSVTLEDDKGAMA
                     GVMCVNFNIAVFEEIGNVLELFVRGVGVAPSHPLDLFKDDWQERINVFLHRWLQERQL
                     AINSLSRDHKRELVEALYIEGAFKGKSAANYVANLLGMGRATVYKHLKALRGELIPEL
                     EVYK"
     misc_feature    124815..125423
                     /locus_tag="CNE_BB1p01300"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2964"
                     /db_xref="CDD:225512"
     misc_feature    124821..125153
                     /locus_tag="CNE_BB1p01300"
                     /note="YheO-like PAS domain; Region: PAS_6; pfam08348"
                     /db_xref="CDD:254749"
     misc_feature    125217..125408
                     /locus_tag="CNE_BB1p01300"
                     /note="HTH domain; Region: HTH_22; pfam13309"
                     /db_xref="CDD:257646"
     gene            125513..126010
                     /locus_tag="CNE_BB1p01310"
                     /db_xref="GeneID:10915113"
     CDS             125513..126010
                     /locus_tag="CNE_BB1p01310"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_004687596.1"
                     /db_xref="GI:339327904"
                     /db_xref="GeneID:10915113"
                     /translation="MTTQTIEMLTPYEKLAAMGIELDPILVPGAAFEMAVQSGNLVFV
                     SGHIARRSGASWQGKLGAGIGTEEGKAAARAAAVDLVATLHEFLGDLCRVKRIVKVMS
                     LVNSSTDYTEQHVVTNGASELLREVFGEVGRHARSAFGVAQLPLGACVEIEMVVELHD
                     PKVQS"
     misc_feature    125561..125983
                     /locus_tag="CNE_BB1p01310"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_1; cd02199"
                     /db_xref="CDD:100006"
     misc_feature    order(125606..125611,125618..125620,125624..125626,
                     125633..125635,125639..125641,125645..125650,
                     125798..125800,125804..125809,125813..125815,
                     125819..125821,125864..125866,125873..125875,
                     125885..125887,125909..125935,125963..125965,
                     125969..125971,125975..125977)
                     /locus_tag="CNE_BB1p01310"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100006"
     misc_feature    order(125606..125608,125852..125854,125864..125866,
                     125918..125920,125963..125965)
                     /locus_tag="CNE_BB1p01310"
                     /note="putative active site [active]"
                     /db_xref="CDD:100006"
     gene            complement(126110..127717)
                     /locus_tag="CNE_BB1p01320"
                     /db_xref="GeneID:10915114"
     CDS             complement(126110..127717)
                     /locus_tag="CNE_BB1p01320"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687597.1"
                     /db_xref="GI:339327905"
                     /db_xref="GeneID:10915114"
                     /translation="MPVKASLLSELLLQKRAWTPGAGTGDCMHRELYEFIKREILEGS
                     LSGGSRLPPSRLLGQELGVSRNTVLNAYDQLLAEGYVTATVGRGTFVAHVPLRTAHPA
                     PDPAGRIHGQLTTQSPSLSARGTQLLAHRGASNRQWGAFVAGVPDVSLFPRQIWLRLL
                     NRHWRRPGAETLSYNTVGGHPALRRALAEHLHLSRSVQCDPEQIVITSGIHQAIDVVA
                     RLLGDPGDRAWVEDPGYWGTRSVLTSNGIEVVPVAVDADGMAPSDAHLNGQAPRFVFT
                     TPSHQYPLGMAMSVSRRLMLIDYAQRAGCWIIEDDYDSEFRFEGRPLASLQGLDNNER
                     VIYMGTFSKTLFPGMRTGYMVLPRSIAKCAMHALAELYREGQLVQQAALADFMTEGHY
                     AAHIRRVRHVYAKRHGLLRQSIAAHLGPDWPVAAQDAGLHLVLLLPDDMDDVEISHQV
                     QARDVAARPLSHYYQSQNAHNFRKGLLLGYACVPDNAIDQGVQVIARAIREAQVPRCT
                     TAGHTQYHYPFRSERSPQESWPSPSPL"
     misc_feature    complement(126212..127633)
                     /locus_tag="CNE_BB1p01320"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(127442..127633)
                     /locus_tag="CNE_BB1p01320"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(127451..127462,127466..127471,
                     127499..127501,127508..127513,127517..127531,
                     127553..127558,127562..127564,127631..127633))
                     /locus_tag="CNE_BB1p01320"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(126227..127297)
                     /locus_tag="CNE_BB1p01320"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(126668..126670,126689..126694,
                     126698..126700,126779..126781,126872..126874,
                     127013..127015,127085..127093))
                     /locus_tag="CNE_BB1p01320"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(126572..126574,126581..126583,
                     126668..126676,126800..126802,126983..126985,
                     127082..127084))
                     /locus_tag="CNE_BB1p01320"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(126689..126691)
                     /locus_tag="CNE_BB1p01320"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(127730..128842)
                     /locus_tag="CNE_BB1p01330"
                     /db_xref="GeneID:10915115"
     CDS             complement(127730..128842)
                     /locus_tag="CNE_BB1p01330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687598.1"
                     /db_xref="GI:339327906"
                     /db_xref="GeneID:10915115"
                     /translation="MTLHAVHIPVRFEAWVEDQPGPQWRARFDRYWPAYRTWFLRTGT
                     VGRPSYLDCRRALRKHMPELVSVWESLVDLAGGGDIEARFLSLWCPPPYIGGCTQAIW
                     TDPAGHEEPALVRNYDYAPALLEGDWVATRWRGPRVVAMSDCLWGALDGLNESGLACS
                     LSFGGRTVSGEGFGVPLVLRYVLEVATTTREAIRLLERVPVSTTYSITLLDRQGDWAT
                     VFVAPDRATEVHRLAVVANHQKCVEWPEHAKATRSVERQQWLEGRMTQPGSARDMAMA
                     LTRPPMLQDSYQRGYGTLYTATYWPRSGAVEMQWPGREPWMQSVATFAESERTVLFSF
                     APGEPRQQWPADFKTNQTRARDTATGDRDIPTPFLS"
     misc_feature    complement(order(128396..128398,128489..128491,
                     128495..128497,128552..128554))
                     /locus_tag="CNE_BB1p01330"
                     /note="active site"
                     /db_xref="CDD:238884"
     misc_feature    complement(127904..128512)
                     /locus_tag="CNE_BB1p01330"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid.  N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:260443"
     gene            complement(128847..130343)
                     /locus_tag="CNE_BB1p01340"
                     /db_xref="GeneID:10915116"
     CDS             complement(128847..130343)
                     /locus_tag="CNE_BB1p01340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687599.1"
                     /db_xref="GI:339327907"
                     /db_xref="GeneID:10915116"
                     /translation="MPCRCQKKRGTNPMSQKIRTIADMLLMFHRNERPIYFISATNFN
                     LLGVDRWVNRFRYISYIDCFDGRHPNVFVPSETPHEEFESIEDINNYLLQHKEVIDLI
                     ERRGGRPVATFLMFDEKTEALAKEIGMDVWFPPAALRQRCDNKMETVRIGNKAGVQSV
                     PNTLQKVTSYEGLLCAAGAAGLGTDLVVQSAFGDSGHTTFFIASEADFEKHKDDIVGE
                     AEVKVMKRINCRGATLEACATQSGTLVGPLLTEVVGAQELTPYKGGWCGNEIFPGAFS
                     EEVRAKARDMAERFGNQLLEEGYRGYFDLDFLVDQDTGEVYLGELNPRICGASPMTNH
                     AAFAYADAPLFLFHLLEFSGMPFDLNVKEINDRWAQPQFIDSWSQLVIKSTQIQVDEL
                     VSAPPTGIYRMADDGTIGYQRFDYERRAIDSEREAFFLRISGPGDYRYQGADLGILIT
                     RGRAMKDNFRLNVRSRDWIRGIQQLYAGKPFVPAANEPAPAPGTFKIL"
     misc_feature    complement(128904..130322)
                     /locus_tag="CNE_BB1p01340"
                     /note="biotin carboxylase-like protein; Validated; Region:
                     PRK06524"
                     /db_xref="CDD:180605"
     misc_feature    complement(129357..129923)
                     /locus_tag="CNE_BB1p01340"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            complement(130346..131209)
                     /locus_tag="CNE_BB1p01350"
                     /db_xref="GeneID:10915117"
     CDS             complement(130346..131209)
                     /locus_tag="CNE_BB1p01350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687600.1"
                     /db_xref="GI:339327908"
                     /db_xref="GeneID:10915117"
                     /translation="MTLSNFGIAGVQMYVSASQDNVERMGGYMKHISKRFPWVRMVLF
                     PELCPLGPSREKAEALPGPTEERLRELARETGLWLIPGSMFESVATPDGTVVYNTTPV
                     IDPHGNVVTRCRKLFPFRPYEAGVDGGTEFCVFDVLDVGRFGVSICYDMWFPETTRSL
                     VALGAEVILHPTMTDTIDRDVELAIARASAVTNQVYFFDINGIGDGGVGRSIVCDPSG
                     YVLHESQAGDEIIAIEIDLQRVRRERERGLRSLGQPLKSFRDRACEFPVYARNGANGY
                     LHTLGPLTKPV"
     misc_feature    complement(130463..131188)
                     /locus_tag="CNE_BB1p01350"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cd07197"
                     /db_xref="CDD:143587"
     misc_feature    complement(order(130691..130693,130754..130759,
                     130763..130768,130841..130843,130853..130855,
                     130865..130867,131072..131074))
                     /locus_tag="CNE_BB1p01350"
                     /note="active site"
                     /db_xref="CDD:143587"
     misc_feature    complement(order(130766..130768,130865..130867,
                     131072..131074))
                     /locus_tag="CNE_BB1p01350"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143587"
     misc_feature    complement(order(130580..130585,130634..130639,
                     130643..130651,130655..130660,130733..130738,
                     130745..130759,130763..130765,130820..130828,
                     130844..130846,130853..130864))
                     /locus_tag="CNE_BB1p01350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143587"
     gene            complement(131251..132903)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /db_xref="GeneID:10915118"
     CDS             complement(131251..132903)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter ATP-binding protein
                     GsiA"
                     /protein_id="YP_004687601.1"
                     /db_xref="GI:339327909"
                     /db_xref="GeneID:10915118"
                     /translation="MPQKDPSQAPLLSIQQLSIPLPPGADRSYAVKDISFDLFPGEIL
                     CIVGESGSGKSMSSNAIMGLLPPGLVPESGRILFQGRDLLQLDEATLLSMRGKDMAMV
                     FQEPLSALNPLMTVGDQIAEVMRVHRSHEPEACERRVLELLEFVGLPDPATLRHSYPF
                     RLSGGQRQRVVIAMALALEPGLLIADEPTTALDVTTQAQILALIRRIQDEKGMGVMFV
                     THDFGVVAEIADRVAVMEKGRLVEIGPAEQVLNAPRHPYTRRLIGAVPRGRAQRTSST
                     QAETVLAVRNLRKTYATGGGWFAPKRVVHAVNDVSFSVRRGETLGIVGESGSGKSTIG
                     KCLLRLTDIDGGELLFDGCNLATLSERQFRPLRRDVQMIFQDPFASLNPRHTVGRIIS
                     DGPVANGVPVAAAHRRTRELLELVGLEASAFDRYPNQFSGGQRQRIGIARALALEPKL
                     IVADESVSALDVSVQAQVLELLGRLQKQLNLALIFITHDLRVAAQICHHVIVMHRGGV
                     VESGPPSRIFDDPQHEYTRRLIGSIPGQTWEPPVDAPAAACA"
     misc_feature    complement(131299..132879)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    complement(132172..132873)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(132739..132762)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(132244..132246,132343..132348,
                     132592..132594,132736..132744,132748..132753))
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132592..132603)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132391..132420)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132343..132360)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132325..132336)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132238..132258)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<132094..132183)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     misc_feature    complement(131368..132063)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(131911..131934)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(131440..131442,131539..131544,
                     131779..131781,131908..131916,131920..131925))
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131779..131790)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131587..131616)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131539..131556)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131521..131532)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131434..131454)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<131302..131379)
                     /gene="gsiA"
                     /locus_tag="CNE_BB1p01360"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(132913..133752)
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /db_xref="GeneID:10915119"
     CDS             complement(132913..133752)
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport system permease AppC"
                     /protein_id="YP_004687602.1"
                     /db_xref="GI:339327910"
                     /db_xref="GeneID:10915119"
                     /translation="MKSFLRRFSRNYGALFGVFIFLAVLFFAGTASLFYEESPWTMVS
                     SPLVEPFTDPSLPFGTDMLGRDVTAGMLYGARVSLLVGVVSTIVALVFGILIGAVAGY
                     SGGRIDDGLMRFTEFFQTIPQLAMAVVIVAIFSPSLVTIVGAIAVVSWPPVARLVRAE
                     FLSLKQREFVQAAVVIGQKPLRVILTQILPNALSPIIVTASFMVATAILTESSLSFLG
                     LGDRNMMSWGFMIGASRTMLREAWWMSVWPGVAILLTVLAINLIGEGLNDALNPQLRK
                     RGE"
     misc_feature    complement(132922..133752)
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(133039..133530)
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133063..133068,133105..133110,
                     133117..133128,133147..133149,133156..133161,
                     133201..133203,133252..133254,133261..133266,
                     133276..133278,133282..133287,133294..133296,
                     133300..133302,133306..133311,133360..133362,
                     133366..133371,133378..133407,133411..133422,
                     133450..133452,133465..133470,133477..133482))
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133111..133128,133360..133404))
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133063..133065,133072..133074,
                     133108..133110,133324..133326,133360..133362))
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133180..133182,133192..133197,
                     133213..133251))
                     /gene="appC"
                     /locus_tag="CNE_BB1p01370"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(133749..134750)
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /db_xref="GeneID:10915120"
     CDS             complement(133749..134750)
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport system permease DppB"
                     /protein_id="YP_004687603.1"
                     /db_xref="GI:339327911"
                     /db_xref="GeneID:10915120"
                     /translation="MNFLSFLSSRLAKALVVVLGVVILNFFLVRMAPGDPATVLAGEA
                     GAGDEVFVSQLREQFGLDKPLVIQLGTYLKGIAQLDLGYSYRNRLPVLDLILDRLPAT
                     FLLMGSAFLLSIVMGVALGVLAARTRYENRRRWLDSALMSGALLLYATPLFWLSLMAI
                     ILFSVVLGWLPAFGMESIGANLSGFDRMLDIAHHMVLPTLSLGCFFMAVYVRLTRASM
                     LEAMGMDFVKTARAKGVPARRVIRVHVLRNALLPVITFAGIQLGQMAGGAVLTETVFA
                     WPGIGRLMFDALLQRDYQLLLGIFFMTSVLVVTFNLVTDIVYRFVDPRIAAGQGAPA"
     misc_feature    complement(133776..134741)
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(133827..134456)
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133827..133829,133836..133841,
                     133848..133853,133857..133862,133869..133874,
                     133902..133907,133932..133937,133944..133955,
                     133974..133976,133983..133988,134028..134030,
                     134079..134081,134088..134093,134103..134105,
                     134109..134114,134121..134123,134127..134129,
                     134133..134138,134271..134273,134277..134282,
                     134289..134318,134322..134333,134376..134378,
                     134391..134396,134403..134408))
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133938..133955,134271..134315))
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133872..133874,133902..133904,
                     133911..133913,133935..133937,134151..134153,
                     134271..134273))
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(134007..134009,134019..134024,
                     134040..134078))
                     /gene="dppB"
                     /locus_tag="CNE_BB1p01380"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(134811..136409)
                     /gene="gsiB"
                     /locus_tag="CNE_BB1p01390"
                     /db_xref="GeneID:10915121"
     CDS             complement(134811..136409)
                     /gene="gsiB"
                     /locus_tag="CNE_BB1p01390"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter substrate binding
                     protein GsiB"
                     /protein_id="YP_004687604.1"
                     /db_xref="GI:339327912"
                     /db_xref="GeneID:10915121"
                     /translation="MSSLSLSSLRTVPALAFAAALLSATLAPAGNAHAQTRGGTLSAI
                     VQPEPPVLVSAINSQAPTQYVAGKIYQGLLTYSPDLKPQPELAKSWTISPDGLTYTFE
                     LQSGVKWHDGKPFTAADAAFTIGQLLPEVHVRTRAVLNKYVASVRAVSASTLEIKLKE
                     PFPPFIMMFEVGTMPMMPKHLYEGTDYRKNPANQTPVGTGPFMFKEWKKGAYIKLVRN
                     PNYWKKGLPYLDELVFNVIPDSASRAVAFERGDVQVLRGGDVDNVDVKRLRAISGVEY
                     TTKGWELFSPMAYLILNQRKPPFDNVKVRQAAMHALNRKLIAENIFFGLGKPATGPFT
                     SNTLFYDKNTPTFDFNLKKARELVKESGVDVAKYPVKILSTSYGANWDRLDEYIKQML
                     ESIGLKVSIESSDAGSWSGRVSNWDFDMTVTFAYQYGDPALGVERFYRSSNIVKGSPF
                     ANVQGYNNPKVDQLWMRGGSTQVAAERQSAYSEIQKLLTSEVANANLLEMEFPTLYRA
                     NVKNLVTTAIGLNESFDKVYIDKK"
     misc_feature    complement(134814..136316)
                     /gene="gsiB"
                     /locus_tag="CNE_BB1p01390"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(134871..136298)
                     /gene="gsiB"
                     /locus_tag="CNE_BB1p01390"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_13; cd08517"
                     /db_xref="CDD:173882"
     gene            complement(136446..137072)
                     /locus_tag="CNE_BB1p01400"
                     /db_xref="GeneID:10915122"
     CDS             complement(136446..137072)
                     /locus_tag="CNE_BB1p01400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687605.1"
                     /db_xref="GI:339327913"
                     /db_xref="GeneID:10915122"
                     /translation="MSVSPIPPELLARLRAVSFPTLGHLLEDGFVDSGIRALVPNVKV
                     VGRAVTLQVTDADAVAVNQALASLTPGDVLVIDMGGDHTHAPVGAVTACAAASAGAAA
                     IVVDGVVTDILELRETKLPVFARGTSLLTTKRLGAGRSQLNIPVRCGGAVARPGDLVL
                     ADDNGVMFLDADTAARVVDEALASDQAEPATLARLRAGEPVTRVLLGS"
     misc_feature    complement(136458..137000)
                     /locus_tag="CNE_BB1p01400"
                     /note="Demethylmenaquinone methyltransferase; Region:
                     Methyltransf_6; cl00480"
                     /db_xref="CDD:260452"
     gene            complement(137069..138418)
                     /gene="shiA1"
                     /locus_tag="CNE_BB1p01410"
                     /db_xref="GeneID:10915123"
     CDS             complement(137069..138418)
                     /gene="shiA1"
                     /locus_tag="CNE_BB1p01410"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate transporter ShiA"
                     /protein_id="YP_004687606.1"
                     /db_xref="GI:339327914"
                     /db_xref="GeneID:10915123"
                     /translation="MNRPVAAGEPAKATHSIKRIAVASVIGTTVEWYDLFIFATASAL
                     IFNKIFFPAFDPLVGTLLAFGTFASAYVARIVGAALFGHFGDKVGRKSMLLVSLVMMG
                     MATFAIGLLPDYKTIGVWAPILLLTLRVIQGLALGGEWGGAVLMAVEHAPSNRRGLYG
                     SWVQIGVPLGTLIANLVFLVSNTLMPAEDMLSWGWRIPFLASIVLVGVGMYIRLNIAE
                     TPSFNKVKAADEQVKVPLFEVFARNWRQVLLGGVATMSTGTSYNLLVAFGLTYGTQTL
                     GHTRNEMLVVVLAACALCVALLPLFGRLSDTFGRKPVILAGIAAEALLAFPLFWLMDS
                     HGFVGALLGYLLMMTAFAANYGPIATFLAELFGTKVRYSGLSIAYMLSGLLGSAATPI
                     ITTALLSATGRGSSIAWYMIGSAILSAISLWLLAETLGRERDEGAVTHSAATVGRVS"
     misc_feature    complement(137165..138340)
                     /gene="shiA1"
                     /locus_tag="CNE_BB1p01410"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    complement(137141..138313)
                     /gene="shiA1"
                     /locus_tag="CNE_BB1p01410"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(137261..137263,137270..137275,
                     137282..137287,137294..137299,137330..137332,
                     137339..137344,137354..137356,137363..137368,
                     137375..137377,137525..137527,137537..137539,
                     137546..137548,137558..137560,137570..137572,
                     137612..137614,137621..137626,137633..137638,
                     137645..137647,137906..137908,137924..137929,
                     137936..137941,137975..137977,137984..137989,
                     137996..138001,138008..138013,138173..138178,
                     138182..138187,138197..138199,138206..138211,
                     138218..138220,138269..138274,138278..138286,
                     138293..138295))
                     /gene="shiA1"
                     /locus_tag="CNE_BB1p01410"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(138489..139988)
                     /gene="puuC"
                     /locus_tag="CNE_BB1p01420"
                     /db_xref="GeneID:10915124"
     CDS             complement(138489..139988)
                     /gene="puuC"
                     /locus_tag="CNE_BB1p01420"
                     /EC_number="1.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl-gamma-aminobutyraldehyde
                     dehydrogenase PuuC"
                     /protein_id="YP_004687607.1"
                     /db_xref="GI:339327915"
                     /db_xref="GeneID:10915124"
                     /translation="MELHNLAYWRSRAEAMRFDGLAYIDGAYTPATDGATFACISPID
                     GRKLADVAACGEADVNRAVAAARRTFESRVWSGLAPRERKRRLQRLAALIEQHAEELA
                     LIEALDMGKPVRDALLFDVPETARCYAWYGEAVDQHYDEIAPTHEGALATITREPVGV
                     VAAVVPWNFPLMMSAWKVAPALAAGNSVVLKPAEQSSLSALRLAALTAEAGIPPGVFN
                     VVPGLGAVAGQALGLHPDVDCLAFTGSTLTGKRFMRYSADSNLKRVWLECGGKSPHII
                     FDDCPDLDRAALVAAQAIFVNQGEVCIAGSRLYVQEGIYDAFMERLTAHAQAMAPGDP
                     LDPEAPMGAIVDERQMQGVLARIEAGVREGARLRTGGQRVRNETGGYYIEPTIFDCAT
                     QDLSVVREEIFGPVLAVQRFATEEDAIRLANDSVYGLGAGLWTSSVGRAHRLSRRMRA
                     GLVWVNCYADGDITVPFGGVKQSGFGRDKSLHALEKYSDLKTTWIDLRD"
     misc_feature    complement(138504..139889)
                     /gene="puuC"
                     /locus_tag="CNE_BB1p01420"
                     /note="Escherichia coli NADP+-dependent
                     gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
                     PuuC-like; Region: ALDH_GABALDH-PuuC; cd07112"
                     /db_xref="CDD:143430"
     misc_feature    complement(order(138588..138590,138702..138704,
                     138780..138782,138786..138788,139083..139085,
                     139182..139190,139233..139238,139245..139247,
                     139254..139265,139407..139412,139416..139418,
                     139461..139463,139485..139499))
                     /gene="puuC"
                     /locus_tag="CNE_BB1p01420"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143430"
     misc_feature    complement(order(139083..139085,139092..139094,
                     139188..139190,139485..139487))
                     /gene="puuC"
                     /locus_tag="CNE_BB1p01420"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143430"
     gene            complement(140014..141270)
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /db_xref="GeneID:10915125"
     CDS             complement(140014..141270)
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /EC_number="3.5.1.87"
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamyl-L-cysteine amidohydrolase AtcC"
                     /protein_id="YP_004687608.1"
                     /db_xref="GI:339327916"
                     /db_xref="GeneID:10915125"
                     /translation="MSTFDNTQSLAINGQRLWQSLMDLARIGATPKGGNARLALTALD
                     GQGRDLVVGWMKDAGLEIHVDQIGNIFGRRAGRNNALPPVMTGSHIDTQPTGGKFDGC
                     YGVMAGLEVMRTLQERGVQTEAPLELIIWTNEEGSRFLPVMMGSGVFTGRFTLDTALN
                     ARDSAGLSVRDELAAIGYAGTEPVSERPVGAYFEAHIEQGPVLEAQNKVIGAVTGSLG
                     VRWYDVTVTGMEMHAGPTPMPVRKDALVAACEMVQTVIGIANDNLPHGRGTVGVLNVH
                     PSSRNVVPGRVDFTVDLRHIYAETLSAMDRHLRESFATIAQRHDVELDLRLAQYNMPT
                     PFAPELVDSVRESAVRRGLSTMDIVTGAGHDAVHMAMAHPTAMIFVPCKDGVSHNEIE
                     DAQPAHLEAGCNVLLDAMLARAGVAA"
     misc_feature    complement(140020..141252)
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /note="allantoate amidohydrolase; Reviewed; Region:
                     PRK12893"
                     /db_xref="CDD:237250"
     misc_feature    complement(140038..141222)
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /note="M20 Peptidase beta-alanine synthase, an
                     amidohydrolase; Region: M20_bAS; cd03884"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(140107..140109,140182..140187,
                     140389..140391,140608..140610,140614..140616,
                     140674..140676,140683..140685,140845..140847,
                     140866..140871,140968..140973,141004..141006))
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /note="active site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(140107..140109,140683..140685,
                     140866..140871,140971..140973,141004..141006))
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(140188..140190,140389..140391,
                     140395..140397,140419..140430,140434..140439,
                     140449..140472,140491..140496,140500..140505,
                     140509..140517,140521..140529,140533..140538,
                     140548..140550,140557..140559,140563..140577,
                     140608..140610,140653..140658,140665..140676))
                     /gene="atcC"
                     /locus_tag="CNE_BB1p01430"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193505"
     gene            complement(141288..143024)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /db_xref="GeneID:10915126"
     CDS             complement(141288..143024)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /EC_number="2.2.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit"
                     /protein_id="YP_004687609.1"
                     /db_xref="GI:339327917"
                     /db_xref="GeneID:10915126"
                     /translation="MTSTLHSTPATLPRRNGGQILMQQLRIHGTRRVFLVPGESYLPC
                     IDALNEHKGAIEPIVCRQESGAAYMAEAMGKLTGEPGICFVTRGPGATNASIGVHTAF
                     QDSTPMILFIGQVGNDFYEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEYISRAFSI
                     ATSGRPGPVVLALPEDTLWGTAEVADLPRYTRAHSHPGADDMQRMAELLETAERPFMI
                     VGGTGWTREAISHVEDFAVRFQLPVGTAWRRLECFDQRSPNAAGHVGWAMTPELRQRL
                     RDADVVLAVGTRLGEATTEGYTVIESPMPRQKLIHVYPDASELGRVFAPTQAIVADVS
                     SFANALASLTPLQPLQRKAWVDSARAEYLASLNPLPAKGPFSLDEAAAIAAEQLPRDA
                     CITVGAGNYALYPHRYRQYTGPGTSLTPTVGSMGYGLPAAISAKLENPDRTVVCYAGD
                     GCFQMNLQELGVALQYRVGVVVLVFNNGIWGTIRAHQEREFPGRDIALSFSNPDFAAL
                     IRSYGGHGEVVERTEDFSAALARACAFADREKLPALIELRYDADGIAPGETLAGIREA
                     AYIRQQAATSSN"
     misc_feature    complement(141324..143003)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="thiamine pyrophosphate protein; Validated; Region:
                     PRK08199"
                     /db_xref="CDD:181285"
     misc_feature    complement(142500..142970)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(142713..142718,142725..142727,
                     142737..142739,142758..142760,142794..142802,
                     142806..142811,142818..142823,142830..142832,
                     142839..142859,142887..142889,142899..142901,
                     142911..142916,142929..142931))
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(142617..142619,142626..142628,
                     142728..142730,142737..142742,142746..142751,
                     142758..142760,142833..142835,142839..142850,
                     142854..142856,142887..142889,142899..142901,
                     142908..142916))
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(142746..142748,142758..142760,
                     142836..142838,142914..142916))
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(142005..142418)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(141381..141869)
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cd00568"
                     /db_xref="CDD:238318"
     misc_feature    complement(order(141588..141590,141594..141596,
                     141669..141680,141750..141752))
                     /gene="ilvI"
                     /locus_tag="CNE_BB1p01440"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(143057..143950)
                     /gene="citE"
                     /locus_tag="CNE_BB1p01450"
                     /db_xref="GeneID:10915127"
     CDS             complement(143057..143950)
                     /gene="citE"
                     /locus_tag="CNE_BB1p01450"
                     /EC_number="4.1.3.34"
                     /EC_number="4.1.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit beta"
                     /protein_id="YP_004687610.1"
                     /db_xref="GI:339327918"
                     /db_xref="GeneID:10915127"
                     /translation="MIMRPTPSRRPVTLRRSWLFTSGMDERAQAAALASGADVLVPDL
                     EEFTAPADRLVARPRVAALMSRCRALGIVAAVRINRLTGDGWDDLRGVMPGSPDAVFL
                     PYVESADEIATLDRAISALEAELGLPKGTTEIVPTIESALGFIHIQHILAASERVRAC
                     LLAAEDLTADLGAERGPDSLELNHLRSRFHVECRAAGRVAIDCPYNYRDMQAQAEDLA
                     WARRIGLKAKCAVYPEQVAQIHAAFTPSIAQVELAKELVARFEAARRGEPIGDALVES
                     PDYHTARRLLTRDAEFKTWTA"
     misc_feature    complement(143087..143902)
                     /gene="citE"
                     /locus_tag="CNE_BB1p01450"
                     /note="HpcH/HpaI aldolase/citrate lyase family; Region:
                     HpcH_HpaI; cl17231"
                     /db_xref="CDD:266573"
     gene            complement(143947..145206)
                     /locus_tag="CNE_BB1p01460"
                     /db_xref="GeneID:10915128"
     CDS             complement(143947..145206)
                     /locus_tag="CNE_BB1p01460"
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite ATP-independent periplasmic
                     (TRAP-type) transporter large permease"
                     /protein_id="YP_004687611.1"
                     /db_xref="GI:339327919"
                     /db_xref="GeneID:10915128"
                     /translation="MGVFMLTMLVDLPIVYGMVLSGLAYLALFDAAPVAVAAQQYVSG
                     LDSFTLLAIPLFILAAQLMNGAGLTQRIVRLCAAIVGDIKGGLAVVAVMSCLVFGALS
                     GSGVADVVAIGSLLLPAMARAGYDKGFSCSLVGCAGTTATIVPPSIVLIIYGTTTNTS
                     VGKLFMAGIVPAVLLSLSLIVIAVWQARKYNWSGGKPFEWAELRASLVDSLPALMVPV
                     LIIGGIRLGVFTASEAASSAIAYSLLIGLFWYRTLSLSAIWKSLKSAGEGSASILLMI
                     GASGFFAWILVAEQVPQALASLLANWTDSRTTVLLLLTAVLLLLGTFMEAIPIIIIVA
                     PVVMPVLAHYQIDPVHFGILLTINMAIGAVSPPVGVDLMAACKVGGITMMQTLRPLTW
                     MMLAMVGVLMLVTFVPDLVMFLPRHVQ"
     misc_feature    complement(143977..145203)
                     /locus_tag="CNE_BB1p01460"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     misc_feature    complement(143959..145083)
                     /locus_tag="CNE_BB1p01460"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; COG1593"
                     /db_xref="CDD:224509"
     gene            complement(145234..145728)
                     /locus_tag="CNE_BB1p01470"
                     /db_xref="GeneID:10915129"
     CDS             complement(145234..145728)
                     /locus_tag="CNE_BB1p01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687612.1"
                     /db_xref="GI:339327920"
                     /db_xref="GeneID:10915129"
                     /translation="MLTRLSYALSALSKAFVAVACAVLAVLVTVVVFQRFVTHDTPRW
                     AEELPRLVLVWSAFIGGVACSRDRSHLMAGLLPFIVKNPRVLGMVDRVNHVLIIAGLV
                     ALGWAGWQLAQMTMDQMLPAINVSAGVVYLALPIACALTAVVHVAQLFEPWPPAHAES
                     FSLE"
     misc_feature    complement(145273..145632)
                     /locus_tag="CNE_BB1p01470"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            complement(145728..146714)
                     /gene="dctP"
                     /locus_tag="CNE_BB1p01480"
                     /db_xref="GeneID:10915130"
     CDS             complement(145728..146714)
                     /gene="dctP"
                     /locus_tag="CNE_BB1p01480"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate family transporter subunit
                     DctP"
                     /protein_id="YP_004687613.1"
                     /db_xref="GI:339327921"
                     /db_xref="GeneID:10915130"
                     /translation="MRLLKSRLSTLLAATAFAVATPPAHALDIKLGHVLAASHSWHKA
                     AEGFAAEVKDKTAGRVNFILFPSGQLGNEKTMVEGMQIGSQGAAVIGSGSLQPVDARF
                     GVVELPYTWNNAAQAYRAYDGDLGKALEKIADGKNLVLLSWWENGFRHITNNRGPIKT
                     PADLKGLKTRVTPDKMRLDTFTLLGAAPAPLAFGELYSALQQKVFDAQENPLSIIYTS
                     SFFEVQKYLSLTGHVWSPASLVVSKSVWNRISPDDRKAIKAAADHWRDEQRRMITESD
                     KQYLTQLKDKGMSINEVDKAPFATAIAPVWKSYEATFGPELMGLVKKYRETK"
     misc_feature    complement(145731..146714)
                     /gene="dctP"
                     /locus_tag="CNE_BB1p01480"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            complement(146764..147546)
                     /locus_tag="CNE_BB1p01490"
                     /db_xref="GeneID:10915131"
     CDS             complement(146764..147546)
                     /locus_tag="CNE_BB1p01490"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687614.1"
                     /db_xref="GI:339327922"
                     /db_xref="GeneID:10915131"
                     /translation="MHHLEAVSAQRLYRLIAERIAEKIRSGEFLVGTRLPAERDLADI
                     LQVSRSSVREALIALELSGYVEVRVGSGVYVMATRGNEASFVTDAARCITELASDIGP
                     FELLETRLLIEPECAAQAAQKGTDQQLAKIREAQESLSEAGAPSHYDRAFHAAIAAAC
                     GNAALDAVVSHVWDLAEASPVYERLDKHFVDSKVWDVALLEHDRIADAILERDPIRAR
                     HAMYAHLIAIMARLREDLAGSLPDIAARPAASGKVHQLRLSR"
     misc_feature    complement(146833..147540)
                     /locus_tag="CNE_BB1p01490"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(147322..147513)
                     /locus_tag="CNE_BB1p01490"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(147328..147339,147343..147348,
                     147376..147378,147385..147390,147394..147408,
                     147430..147435,147439..147441,147508..147510))
                     /locus_tag="CNE_BB1p01490"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(146872..147237)
                     /locus_tag="CNE_BB1p01490"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            147983..149245
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /db_xref="GeneID:10915132"
     CDS             147983..149245
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /EC_number="2.6.1.19"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase GabT"
                     /protein_id="YP_004687615.1"
                     /db_xref="GI:339327923"
                     /db_xref="GeneID:10915132"
                     /translation="MNADLQQRRTAATPRGVGVMCNFYADRAENALLWDVEGREYIDF
                     AAGIAVLNTGHRHPRIVQAVEEQLRRFTHTAYQIVPYESAVALAERINALAPIEGPAK
                     TAFFTTGAEAVENAIKIARAHTGRPGVVAFGGGFHGRTLMGMALTGKVAPYKLGFGPF
                     PSDVFHVPYPAALQGVSTNDALAAIESLFKTDIDPQRVAAIILEPVQGEGGFNVAPAE
                     LMRGLRTLCDQHGILLIADEIQTGFGRTGKIFAMEHYDVRPDLITMAKSLAGGLPLSG
                     VCGRAEVMDAPAPGGLGGTYAANALAVAAAHAVLDVLAEEKLCERSQKLGAQLTQRLE
                     ALRERCPVIAEVRGLGSMVAIEFRDPQTAKPDAARLQQVQRNAMEEGLLLLSCGMHGN
                     AIRFLYPLTIDDALFAKALDIIERAVQA"
     misc_feature    147995..149236
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    148061..149242
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(148304..148312,148388..148393,148397..148399,
                     148592..148594,148691..148693,148697..148702,
                     148778..148780)
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(148307..148312,148388..148393,148592..148594,
                     148691..148693,148700..148702,148778..148780)
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    148778..148780
                     /gene="gabT"
                     /locus_tag="CNE_BB1p01500"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            149256..150746
                     /locus_tag="CNE_BB1p01510"
                     /db_xref="GeneID:10915133"
     CDS             149256..150746
                     /locus_tag="CNE_BB1p01510"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP+ dependend succinate-semialdehyde
                     dehydrogenase GabD"
                     /protein_id="YP_004687616.1"
                     /db_xref="GI:339327924"
                     /db_xref="GeneID:10915133"
                     /translation="MTKIHLTLDGLADPSLLKTDALINGQWVPGASRFDVHDPATGEK
                     LADVANLKAVDAHSAIAAANAAWPAWRRLGAKARSQVLRKWFDLLIAHQDDLAHLMTA
                     EQGKPLAEARGEVAYGASFVEWFAEQAKRVSGETLSQFDENRRQLVLKQPIGVCAAIT
                     PWNFPLAMITRKVAPALAAGCTVVVKPAELTPLTALAAGELAIRAGIPAGVLNIVTAD
                     SGNSIAVGQVLCASDVVRHLSFTGSTEVGRILMAQCAPTVKKLSLELGGNAPFIVFDD
                     ADIDSAVEGAFASKYRNAGQTCVCSNRFYVQDGVYDEFVRKFADRVRRARVGNGFEAG
                     VEQGPLIEEAAVAKVERHLADALAKGARIVTGGNRLAQLGAGQFFQPTVVADATPDML
                     CAREETFGPFAPVFRFGTEQEAIDAANDTEFGLASYFYSRDVGRIFRVGEALEYGMVG
                     VNSGMISMEHVPFGGVKQSGLGREGSEHGIEEYVELKYLCLGDIAA"
     misc_feature    149361..150728
                     /locus_tag="CNE_BB1p01510"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(149475..149477,149502..149504,149625..149627,
                     149634..149639,149643..149669,149685..149693,
                     149706..149708,149961..149963,149997..149999,
                     150009..150011,150018..150020,150189..150191,
                     150201..150203,150339..150341,150549..150551,
                     150555..150560,150570..150572,150576..150578,
                     150585..150587,150591..150611,150627..150629,
                     150636..150641,150657..150659,150672..150674,
                     150708..150728)
                     /locus_tag="CNE_BB1p01510"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(149730..149744,149766..149768,149811..149813,
                     149817..149822,149973..149984,149991..149993,
                     150000..150005,150045..150053,150147..150149,
                     150444..150446,150450..150452,150528..150530,
                     150642..150644)
                     /locus_tag="CNE_BB1p01510"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(149742..149744,150045..150047,150138..150140,
                     150147..150149)
                     /locus_tag="CNE_BB1p01510"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            150774..152504
                     /gene="ldhA"
                     /locus_tag="CNE_BB1p01520"
                     /db_xref="GeneID:10915134"
     CDS             150774..152504
                     /gene="ldhA"
                     /locus_tag="CNE_BB1p01520"
                     /EC_number="1.1.1.28"
                     /codon_start=1
                     /transl_table=11
                     /product="D-lactate dehydrogenase"
                     /protein_id="YP_004687617.1"
                     /db_xref="GI:339327925"
                     /db_xref="GeneID:10915134"
                     /translation="MHLPVFPPHQANDAEFVERLRRIVGPRNVLTERRRTQRYRRGFR
                     SGEGEALAVVFPTKLLEQWQVLQACVAAGKAVVMQAANTGLTEGSTPHGGAEDYGRQV
                     VVINTLLMTTIRVIDQGRQAICFPGATLHGLERALQPFGREPHSEIGSSCIGASVVGG
                     ICNNSGGMLVRRGPAYTELALFARVDASGVLQLVNHLGIRLGDTPESILTRLDHGDFT
                     ETDIDSAVNGKGSCSDYEARVRDFAAPTPARFNNDPARLYETSGSAGKLAVFAVRVDT
                     FEADEQTQVFCIGVRDPAMLSVLRHRLLAPEMALPVACEYMHRDIFDLSARYAKDMFS
                     VIERFGTDAIPSIFAWKSQIDRLLGRFRFLPANPADRIAQMVGQLLPEHVPVRLRTLR
                     ERYEHIVLLKVAGGDVAPILEQLARLLRDPDDGEWFACDPQEGQKAFLHRFVAGGAAI
                     RYNAIHRSDVEGVFSLDFALPRNSSDWVEHLPADIEAQLVGRYRYAHFLCHVFHHDYI
                     VKKGGNLEAIKQRVLDLIAAKGGEYPAEHNVGHVYCAKPALAAFYRDVDPTNTFNPGV
                     GQMSKRRSYM"
     misc_feature    150810..152498
                     /gene="ldhA"
                     /locus_tag="CNE_BB1p01520"
                     /note="D-lactate dehydrogenase; Provisional; Region:
                     PRK11183"
                     /db_xref="CDD:236872"
     misc_feature    150921..151340
                     /gene="ldhA"
                     /locus_tag="CNE_BB1p01520"
                     /note="FAD binding domain; Region: FAD_binding_4; cl19922"
                     /db_xref="CDD:268275"
     misc_feature    151626..152498
                     /gene="ldhA"
                     /locus_tag="CNE_BB1p01520"
                     /note="D-lactate dehydrogenase, membrane binding; Region:
                     Lact-deh-memb; pfam09330"
                     /db_xref="CDD:117872"
     gene            152598..153941
                     /gene="ndh"
                     /locus_tag="CNE_BB1p01530"
                     /db_xref="GeneID:10915135"
     CDS             152598..153941
                     /gene="ndh"
                     /locus_tag="CNE_BB1p01530"
                     /EC_number="1.6.99.3"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase Ndh"
                     /protein_id="YP_004687618.1"
                     /db_xref="GI:339327926"
                     /db_xref="GeneID:10915135"
                     /translation="MSLIPQTTAPDGLHRIVIVGGGAGGLELATLLGDRLGKRGQAHV
                     TLIDKKRTHFWKPHLHEIAAGSMNLGMHELCYMAQGHWHGFTDRIGEVIGLDRSRRVV
                     HLAPHVDEFGDAVTPLRDVPYDTLVFAVGSRTNDFGTPGVREHAIALETPADGERFHR
                     RLVNACIRAHAQSEQLQPHQLQVAIIGAGATGVELAAELKHTTRELLSYGLERLDPAQ
                     LGIHLIEAGPRILPALPERLSAGAAKQLRALNVTIHTGARVSEVRQHGVQLADGRSIA
                     AELVVWAAGVKAPEFARGLDGLEVNGIHQLRVGPTLQTTLDEHVFAIGDCAACPWLGR
                     EAGVLVPPRAQAAHQQASHLAEGLIRRLAGKPLKPWRYRDFGSLVSLGRHSTVGNLMG
                     GLIRGNLWLEGYFARLMYMSLYQMHQRALHGLPRAALDTLARLFSRGTRPRVKMH"
     misc_feature    152637..153899
                     /gene="ndh"
                     /locus_tag="CNE_BB1p01530"
                     /note="NADH dehydrogenase, FAD-containing subunit [Energy
                     production and conversion]; Region: Ndh; COG1252"
                     /db_xref="CDD:224172"
     misc_feature    153144..153413
                     /gene="ndh"
                     /locus_tag="CNE_BB1p01530"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(153985..154881)
                     /locus_tag="CNE_BB1p01540"
                     /db_xref="GeneID:10915136"
     CDS             complement(153985..154881)
                     /locus_tag="CNE_BB1p01540"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687619.1"
                     /db_xref="GI:339327927"
                     /db_xref="GeneID:10915136"
                     /translation="MLFNLEAVSAQRLYRLIAEKIAEKIRAGEFPVGSRLPAERDLAE
                     ALNVSRSSVREALIALELSGYVEVRLGSGVYVTTPKEGTAVGSPPPTESTASSSSRPA
                     GDVGPFELLEARLLVEPEVAALAAQHASNQQLSVIREAQEAMSASGAPSHLDRVFHAA
                     IAAACGNAALEAVVLSLRDLSEASPVYQRLDKHFIGRKAWNAALVEHDRITSAILERD
                     PIRARHEMYAHLIAIMARLREDFGDSLSSSRRKVTPKKRAPSVSDRSSRNATTEVEDA
                     TDLVDAEALARHASRTAARRKV"
     misc_feature    complement(154153..154875)
                     /locus_tag="CNE_BB1p01540"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(154651..154845)
                     /locus_tag="CNE_BB1p01540"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(154660..154671,154675..154680,
                     154708..154710,154717..154722,154726..154740,
                     154762..154767,154771..154773,154840..154842))
                     /locus_tag="CNE_BB1p01540"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(154192..154557)
                     /locus_tag="CNE_BB1p01540"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(155641..155769)
                     /locus_tag="CNE_BB1p01550"
                     /db_xref="GeneID:10915137"
     CDS             complement(155641..155769)
                     /locus_tag="CNE_BB1p01550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687620.1"
                     /db_xref="GI:339327928"
                     /db_xref="GeneID:10915137"
                     /translation="MRILQEIRKIERYLEMGYLSEIEVIKREFRLWSPSQPLMSNE"
     gene            156412..157221
                     /locus_tag="CNE_BB1p01560"
                     /db_xref="GeneID:10915138"
     CDS             156412..157221
                     /locus_tag="CNE_BB1p01560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687621.1"
                     /db_xref="GI:339327929"
                     /db_xref="GeneID:10915138"
                     /translation="MDSTHHIRKTSTTEVARHADGSYTIKTRTVEKNGNGTEQTDSVD
                     KDGKITNGEPKTVKGGKIVAGPTAGNADGSEGSDDSGDGDHNDNADSNVADNANDSGP
                     PDDDHPDPDADAQTGLPAGDGDDGDQEGNPDGRLAGMDRDTLLALVGRAWRGEEGVDS
                     LGDTNARYGRWLGALRAVVAAGGTIGSTGEELDSLGAPIPGFDFSGGGGSHQDEDLDS
                     LGRPVIDLDIVPRPRPGPDGMTRLGSLLDLCAQLAAGSATVGASVNLLRQA"
     gene            158038..158319
                     /locus_tag="CNE_BB1p01570"
                     /db_xref="GeneID:10915139"
     CDS             158038..158319
                     /locus_tag="CNE_BB1p01570"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_004687622.1"
                     /db_xref="GI:339327930"
                     /db_xref="GeneID:10915139"
                     /translation="MKPSQVKPISYLKSHAAEIVRDITESGEPMLITQNGEAKVVVQD
                     AQSYEDMQQTVALLKILAMGQNDIETGNFTPTDEVFAELERMDREEGIE"
     misc_feature    158050..158244
                     /locus_tag="CNE_BB1p01570"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            159266..160546
                     /locus_tag="CNE_BB1p01580"
                     /db_xref="GeneID:10915140"
     CDS             159266..160546
                     /locus_tag="CNE_BB1p01580"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004687623.1"
                     /db_xref="GI:339327931"
                     /db_xref="GeneID:10915140"
                     /translation="MTPLLSQQFRAFVGIDWADAKHDICLQPAGDDTREFACIPHQVA
                     RIDEWVAALHKRFGGPIAVALELSRGPIVSVLQRHSFLTLFPINPSMLAKYREAFKPS
                     RAKDDPTDAELALDLLLRHPDRFSALNPQSADMRSLLSLIEQRRELVGDKIRFTNRLT
                     HALKQYYPQALEWFEDIDTIQFCDFLTRWPTLPAAKRARRTTLEDFFHAHNCRRAQLI
                     ERRLASIRGAMPMTDDPGVVAPNRLLALMLVAQLRTVLAAIDVFDKEIARIARTLPDF
                     DLFDSLPGAGPHLTPRLLAAFGEQRDRYNGAEELQKYSGIAPVTERSGKKRWVHWRWQ
                     CPTFLRQTFVEWAGQTINKSSWAGAYYRQQRAKGSSYQAAVRALAFKWIRILYRCWQT
                     GTRYDEDLYLNALKRRGSPLIGHLEARPDTKLNR"
     misc_feature    159299..159739
                     /locus_tag="CNE_BB1p01580"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    160094..160351
                     /locus_tag="CNE_BB1p01580"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(160768..161400)
                     /locus_tag="CNE_BB1p01590"
                     /db_xref="GeneID:10915141"
     CDS             complement(160768..161400)
                     /locus_tag="CNE_BB1p01590"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687624.1"
                     /db_xref="GI:339327932"
                     /db_xref="GeneID:10915141"
                     /translation="MTENSQGRRGRPANEALRQTIVDTACELFVELGFQATTMDKVAQ
                     RAKISKLSIYRHFENKEALFSAAMVARCEQFAPQALFEGVDGSAEDQLMAVGSSLLRT
                     LLSPDVRSVEAMVLADKTNQKSLSKLHYEAGPAHVIAQIEAVLRQLHAKAILNVPDAL
                     QSARLFAALFKGSDLLLIARFDEARAEDDNEIESYCRSAVAMFIAAHGGI"
     misc_feature    complement(160822..161379)
                     /locus_tag="CNE_BB1p01590"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(161200..161340)
                     /locus_tag="CNE_BB1p01590"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(160783..160941)
                     /locus_tag="CNE_BB1p01590"
                     /note="AefR-like transcriptional repressor, C-terminal
                     region; Region: TetR_C_7; pfam14246"
                     /db_xref="CDD:258436"
     gene            161682..162575
                     /locus_tag="CNE_BB1p01600"
                     /db_xref="GeneID:10915142"
     CDS             161682..162575
                     /locus_tag="CNE_BB1p01600"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004687625.1"
                     /db_xref="GI:339327933"
                     /db_xref="GeneID:10915142"
                     /translation="MNDVIIIGGSFAGLAAALQLGRARRKVTVLDTGRPRNRFAGHSH
                     GLLGHDHKPPLDILVEARQQLARYPTIRLVNARAESVSGAIDDFCVVTDDHESLRARR
                     LILSYGVADQMPDVPGFAESWGTSIVPCPYCDGFEVAGQHWGLVWSGPQSHQSARLFR
                     DWTDKLTVFADGHDIAADIQADLARRNIPVVDGRIVEIAHHKGHITTVNLDTRRNVAV
                     DVLFAHPRNKPSASLHESLGLATVDTPTGIVLKVDERRQTSIPGIYAAGDLATPFLPS
                     VTQASSQGAMAGIFAQQSMVV"
     misc_feature    161682..162566
                     /locus_tag="CNE_BB1p01600"
                     /note="Thioredoxin reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region: TrxB;
                     COG0492"
                     /db_xref="CDD:223566"
     misc_feature    161688..>161945
                     /locus_tag="CNE_BB1p01600"
                     /note="Anaerobic glycerol-3-phosphate dehydrogenase [Amino
                     acid transport and metabolism]; Region: GlpB; cl17730"
                     /db_xref="CDD:248284"
     gene            162672..163535
                     /gene="phcB1"
                     /locus_tag="CNE_BB1p01610"
                     /db_xref="GeneID:10915143"
     CDS             162672..163535
                     /gene="phcB1"
                     /locus_tag="CNE_BB1p01610"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine (SAM)-dependent
                     methyltransferase PhcB"
                     /protein_id="YP_004687626.1"
                     /db_xref="GI:339327934"
                     /db_xref="GeneID:10915143"
                     /translation="MAEQSADQVGDWNGQSGERWVANQARLDAMVAVFGQAAIEAAAP
                     ATGERVLDIGCGAGASSLALAARVGAGGQVLGVDISEPLIGRARALAQRDTPALFQVA
                     DASSAELPEAAFDILFSRFGVMFFDDPIAAFAHMRRALRPGGRVAFVCWRGAAENDWV
                     RLPMGALKGIVPPSALPDPEAPGPFSFGDRGRVARILTAAGFTDIAIAPFDASVPFGE
                     GGTRDAAIDDAVKMTLEVGPLSRALADQPDDIRARASAAVRAAFAGLPGERSVMINGA
                     AWIVMARNPVG"
     misc_feature    162816..163130
                     /gene="phcB1"
                     /locus_tag="CNE_BB1p01610"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(162828..162848,162903..162908,162975..162983,
                     163029..163031)
                     /gene="phcB1"
                     /locus_tag="CNE_BB1p01610"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            164339..164857
                     /gene="msrB"
                     /locus_tag="CNE_BB1p01620"
                     /db_xref="GeneID:10915144"
     CDS             164339..164857
                     /gene="msrB"
                     /locus_tag="CNE_BB1p01620"
                     /EC_number="1.8.4.12"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase MsrB"
                     /protein_id="YP_004687627.1"
                     /db_xref="GI:339327935"
                     /db_xref="GeneID:10915144"
                     /translation="MRINRRFLLSGGTLAATLAAMGGWRALAGGAAIAGETRKAAERF
                     EVTMSDEAWRRKLSPAQYAVLRNEGTERPFSSPLNGEHRNGIFACAGCELDLFSSKTK
                     FDSGTGWPSFWAPLENAVGTTEDRTLGMLRTEVHCRRCGGHLGHVFDDGPKPTGLRYC
                     MNGVAMTFRPAA"
     misc_feature    164468..164848
                     /gene="msrB"
                     /locus_tag="CNE_BB1p01620"
                     /note="methionine sulfoxide reductase B; Provisional;
                     Region: PRK00222"
                     /db_xref="CDD:234692"
     gene            164898..166730
                     /gene="ccdA"
                     /locus_tag="CNE_BB1p01630"
                     /db_xref="GeneID:10915145"
     CDS             164898..166730
                     /gene="ccdA"
                     /locus_tag="CNE_BB1p01630"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein CcdA"
                     /protein_id="YP_004687628.1"
                     /db_xref="GI:339327936"
                     /db_xref="GeneID:10915145"
                     /translation="MLLLILAYLGGALTILSPCILPVLPFVFARADQPFARSGLPLLA
                     GMGITFALVATLAAVGGGRVAQANQYGRWLAIALLAVFGLTLLLPQLAERLMRPLVSA
                     GSRLSNFAQADGRAASPASSFLLGIATGLLWAPCAGPILGLVLTGAALQGANLGTTLL
                     LLAYAAGAATSLAVALLIGGRVFAAMKRSLDTGEWIRRGIGAAMLVGVVAIGLGLDTG
                     VLARVSTIATGGLEEHLVNRLAGNKAAEKQDGTMMMSANSKGPVPGDANGGAMMIRAG
                     GRAAALPVEGLFPGLNGAVEWLNSPPLTAEGLRGKVVLVDFWTYSCINCLRTLPYVKA
                     WANKYKDEGLVVIGVHAPEFAFERNIDNVKRASRELGVTYPVAIDNNFAIWRAFGNQY
                     WPAHYFIDAQGRIRFHHFGEGEYEHSEAVIRQLLEEAGHADVAKIAMAMPATLNDKTG
                     GGVQMAADNGAIRSPETYVGYERAENFGSPGGAAHDRPKDYTAPAKPDLNQWGLAGNW
                     RIGAERATLDRPNGRIVYRFHARDLHLVLGPAQDDKPVRFRVTIDGAEPGTSHGTDTA
                     PDGTGEVTAQRLYQLVRQDGEIRDRTFAIEFLDPGVEAYAFTFG"
     misc_feature    164898..165542
                     /gene="ccdA"
                     /locus_tag="CNE_BB1p01630"
                     /note="Cytochrome c biogenesis protein [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcdA;
                     COG0785"
                     /db_xref="CDD:223856"
     misc_feature    165762..166136
                     /gene="ccdA"
                     /locus_tag="CNE_BB1p01630"
                     /note="TlpA-like family, DipZ-like subfamily; composed
                     uncharacterized proteins containing a TlpA-like TRX
                     domain. Some members show domain architectures similar to
                     that of E. coli DipZ protein (also known as DsbD). The
                     only eukaryotic members of the TlpA...; Region:
                     TlpA_like_DipZ_like; cd03012"
                     /db_xref="CDD:239310"
     misc_feature    order(165861..165863,165870..165872)
                     /gene="ccdA"
                     /locus_tag="CNE_BB1p01630"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239310"
     gene            166755..167489
                     /gene="msrA"
                     /locus_tag="CNE_BB1p01640"
                     /db_xref="GeneID:10915146"
     CDS             166755..167489
                     /gene="msrA"
                     /locus_tag="CNE_BB1p01640"
                     /EC_number="1.8.4.11"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="YP_004687629.1"
                     /db_xref="GI:339327937"
                     /db_xref="GeneID:10915146"
                     /translation="MNAIAALQRWTHATALKLMGVVMLVAVAAIWGRPALSAEDAVRI
                     PAPSQDEKPGDDHAATAVFAGGCFWGVQGVFQHVRGVTRVTSGYAGGAASTAQYEKVG
                     SGTTGHAESVEIRYDPAQVSYGKLLQVFFSVAHNPTQLNYQGPDHGTQYRSAIFPVTP
                     AHRAIAEAYIAQLGAAKSFRAPIVTRLEDYKGFYPAEAYHQDFLTKNPRHPYIVINDL
                     PKIGNLKQIFPDLYRNDPVLLSRSGA"
     misc_feature    166929..167465
                     /gene="msrA"
                     /locus_tag="CNE_BB1p01640"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK13014"
                     /db_xref="CDD:237269"
     gene            167885..168940
                     /locus_tag="CNE_BB1p01650"
                     /db_xref="GeneID:10915147"
     CDS             167885..168940
                     /locus_tag="CNE_BB1p01650"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687630.1"
                     /db_xref="GI:339327938"
                     /db_xref="GeneID:10915147"
                     /translation="MAVATLVFRSFTRIRVALFRQALSCGHLNGDVEPEIKSGKSISP
                     SALDRLGNVDFHTLFALAALLRGRSVSRAAAQMEVSQPAMSRTLDRLRIVFQDALLVR
                     EGNHMLLTAHGKELLPIVEKLLETTAQLAGVNAPFDAATQVRHFSLACNEHIQLSLAP
                     SLLTALRTAAPSITAQFSPLHRSGAVDALASGELDLCIGSAIPSAPGIHTSLLYSEAF
                     VCVMRKPRHTGGKVRISLKDFCALPHLDVSPTGLTLLGELINRTIRKQGGSRQVVYTI
                     SSFMAAPQIVSETDMICAIPARTARRLALPDNVVVAELAFEAPATDVSMYWHNLTHRD
                     AACDWLRAEIRRALPAR"
     misc_feature    168044..168937
                     /locus_tag="CNE_BB1p01650"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    168047..168226
                     /locus_tag="CNE_BB1p01650"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    168317..168925
                     /locus_tag="CNE_BB1p01650"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    order(168335..168337,168341..168346,168356..168358,
                     168530..168532,168650..168652,168851..168853)
                     /locus_tag="CNE_BB1p01650"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    order(168338..168340,168347..168352,168359..168364,
                     168371..168376,168380..168385,168392..168397,
                     168401..168415,168419..168421,168611..168613,
                     168701..168715,168722..168727,168734..168739,
                     168746..168748)
                     /locus_tag="CNE_BB1p01650"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            169075..170043
                     /gene="bugT1"
                     /locus_tag="CNE_BB1p01660"
                     /db_xref="GeneID:10915148"
     CDS             169075..170043
                     /gene="bugT1"
                     /locus_tag="CNE_BB1p01660"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004687631.1"
                     /db_xref="GI:339327939"
                     /db_xref="GeneID:10915148"
                     /translation="MNRRTSLRLAAAASLLSLALPFSAGAYPDKPIRLVVSFPPGSGA
                     DTTARYVAQKLGERLGKPVVVENRPGANSFIAAQAVAGADPDGHTIFLASNSPMATNV
                     AIFKRLPYDPVKDFAPVARLTRGVMAVVVPASSGAITIGELAERSRAQPGTLNYGAGA
                     ASYQIATELFLHLAGGRATPVPYKGVAPALSDLAGGQLDFAFADLGAVVPFLQSGKVR
                     MLAVSADRRVDAFPKVPTLQESGFRDYYMINWTAAFVPARTPAPIANLLGEHLQAIYR
                     LPEGVAKVRQSYGEPFFGDANELRRFQIEEISRWEQAARQAGMQKQ"
     misc_feature    169216..170028
                     /gene="bugT1"
                     /locus_tag="CNE_BB1p01660"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            170054..171277
                     /gene="frc1"
                     /locus_tag="CNE_BB1p01670"
                     /db_xref="GeneID:10915149"
     CDS             170054..171277
                     /gene="frc1"
                     /locus_tag="CNE_BB1p01670"
                     /EC_number="2.8.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl-coenzyme A transferase Frc"
                     /protein_id="YP_004687632.1"
                     /db_xref="GI:339327940"
                     /db_xref="GeneID:10915149"
                     /translation="MTTNPTTSVTNDLPARDLPLAGLTVLDLGQIYQGPYCGFLLAMA
                     GADVIKIEPPHGEPVRSRRESLLPLAMLNSNKRGITLNFKTEQGRSVFRDLVAKADVV
                     LENFMPGVMERLGLGAEALLEINPRLIYASASGYGTSGPNRDHLAMDLTIQAMSGAMH
                     VTGYADRPPVKAGPAISDFLGGIHLYGAIVTALLERERTGRGRTAEIAMQDAMYPTLA
                     SNLTLYYEDPKRNPRTGNKHGALAMAPYNSYLAKDGYIAIICVTEGHWPALCEAMGHP
                     ELGKHERYATHTSRCEVMSEVDELVTSWTSNLTRAEIMAASQAYRFPCAPVRTLDEVV
                     HDRHMHERGMLSYVDHPELGEVVLPNSPLRFHQSAPLVLKPNPGLGEHNNAVLSELLG
                     LSAAAIDTLRQQGAF"
     misc_feature    170093..171271
                     /gene="frc1"
                     /locus_tag="CNE_BB1p01670"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            171316..171744
                     /locus_tag="CNE_BB1p01680"
                     /db_xref="GeneID:10915150"
     CDS             171316..171744
                     /locus_tag="CNE_BB1p01680"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004687633.1"
                     /db_xref="GI:339327941"
                     /db_xref="GeneID:10915150"
                     /translation="MSDFVQTVREDGIAILTLNRPQTRNAIADDASIQAIVTALAEIS
                     ADTTLRAAILTGAGPAFCAGGSLQSLGQLAAGEPIVNEQRYRTGIQRIPRAFQQIDIP
                     VIARSTAPPLVPDWTSPACATSALPRPALPLPRVSSSLAW"
     misc_feature    171328..>171630
                     /locus_tag="CNE_BB1p01680"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(171385..171387,171391..171393,171490..171492,
                     171502..171516)
                     /locus_tag="CNE_BB1p01680"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    171508..171510
                     /locus_tag="CNE_BB1p01680"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     gene            171675..172097
                     /locus_tag="CNE_BB1p01690"
                     /db_xref="GeneID:10915151"
     CDS             171675..172097
                     /locus_tag="CNE_BB1p01690"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_004687634.1"
                     /db_xref="GI:339327942"
                     /db_xref="GeneID:10915151"
                     /translation="MRDIRIASTRATFAESFVKLGLVAGDGGAWLLARILPLARAYEM
                     ALTGNAIDAQQAMEWGLVSRLAEPEALMETALTLARAIAANPGHAVRMTKRLVDASLL
                     NTLDAVLDLSASMQALAHTTEAHRQALCLLTERVGSKS"
     misc_feature    <171681..171920
                     /locus_tag="CNE_BB1p01690"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(171681..171692,171726..171737,171753..171755,
                     171759..171767,171771..171776,171789..171794,
                     171798..171803,171807..171812,171819..171821,
                     171852..171854,171861..171863,171906..171908,
                     171915..171920)
                     /locus_tag="CNE_BB1p01690"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            172094..172942
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /db_xref="GeneID:10915152"
     CDS             172094..172942
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase PaaG"
                     /protein_id="YP_004687635.1"
                     /db_xref="GI:339327943"
                     /db_xref="GeneID:10915152"
                     /translation="MSVTSPSPTASIRCEVADQIAVITLNRPDRLNAWNAEMEAGLRA
                     ALERCRDDREVRVIVLTGAGKAFCAGADLSAARARLTASGPQCAVGTAAPMPDDATAR
                     EDFDQRYSYLLAIGKPIICALNGAAAGVGLVLALYCDIRYASHDARLVPAFVRRGLAA
                     EHGIAWILPRLIGLSRALEWLISGRSMSAQEADQAGLVSAVLEADGFLPAVLERAATL
                     ATLCSPSAMAAAKRQSYLALGQTLGESVALAEREIAASLQGSDFREGVAAFLDKRQPS
                     FLGLGR"
     misc_feature    172124..172933
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK06210"
                     /db_xref="CDD:180472"
     misc_feature    172127..172747
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(172184..172186,172190..172192,172286..172288,
                     172298..172312,172469..172471,172475..172483,
                     172547..172552,172559..172561)
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(172304..172306,172481..172483)
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(172430..172432,172445..172447,172508..172519,
                     172553..172564,172580..172582,172586..172594,
                     172598..172603,172616..172621,172625..172630,
                     172634..172639,172646..172648,172679..172681,
                     172688..172690,172733..172735,172742..172747)
                     /gene="paaG1"
                     /locus_tag="CNE_BB1p01700"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            173262..174860
                     /locus_tag="CNE_BB1p01710"
                     /db_xref="GeneID:10915153"
     CDS             173262..174860
                     /locus_tag="CNE_BB1p01710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687636.1"
                     /db_xref="GI:339327944"
                     /db_xref="GeneID:10915153"
                     /translation="MNRSAQALLEYHERSKHRVNRYAPGPGWLDWATQPDPFRAFHGS
                     PRIVLPLAADTLPTRYNALRCGALPPAQGFSLRTLAILFELSLGLSAWKAFGAQRWAL
                     RCNPSSGNLHPTEGYLLCPALPDLPGGVYHYLSRDHVLEQRAALDDPRWTEAFPGGGI
                     LVGISSIHWREAWKYGMRAWRYCQHDCGHAIAAVSYAAAALGWQTRLIETAADDALAA
                     LLGLDRSDDFGAAEREVPDVVLWIGNAETRPDLERLWSTLDKAHWYGYANQLSAGHVS
                     WPDIDSVDRATRKSLTSEPTPLNPEPPLRPAAPAFDLSFARIARQRRSATSFDGTAHI
                     TATAFFTMLASLLARRDTPPWNALMSPAAVHLALLVHRVDGLEPGLYVLVRNSGALHG
                     LKQAMRPEWLWQRIGPDHLPLYLLLPYDLRAVAKLICCHQDIAADSYFALGMLANFEI
                     ALKQPWRYRHLFWECGILGQALYLEAEATGERATGIGCFFDDEMHAVLGIKDHTWQSL
                     YHFTVGCAMVDQRLSTLAPYEVQA"
     misc_feature    173481..>173828
                     /locus_tag="CNE_BB1p01710"
                     /note="This family is the oxydase domain of NRPS
                     (non-ribosomal peptide synthetase) and other proteins that
                     modify polypeptides by cyclizing a thioester to form a
                     ring. These include epoB, part of the epothilone
                     biosynthesis pathway; tubD, part of the tubulysin...;
                     Region: mcbC-like_oxidoreductase; cd02142"
                     /db_xref="CDD:239056"
     misc_feature    173574..173576
                     /locus_tag="CNE_BB1p01710"
                     /note="NADPH bind site [chemical binding]; other site"
                     /db_xref="CDD:239056"
     misc_feature    174219..174803
                     /locus_tag="CNE_BB1p01710"
                     /note="This family is the oxydase domain of NRPS
                     (non-ribosomal peptide synthetase) and other proteins that
                     modify polypeptides by cyclizing a thioester to form a
                     ring. These include epoB, part of the epothilone
                     biosynthesis pathway; tubD, part of the tubulysin...;
                     Region: mcbC-like_oxidoreductase; cd02142"
                     /db_xref="CDD:239056"
     misc_feature    order(174225..174227,174231..174233,174237..174239,
                     174720..174725,174786..174788)
                     /locus_tag="CNE_BB1p01710"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239056"
     misc_feature    order(174237..174239,174339..174341)
                     /locus_tag="CNE_BB1p01710"
                     /note="NADPH bind site [chemical binding]; other site"
                     /db_xref="CDD:239056"
     gene            176085..176213
                     /locus_tag="CNE_BB1p01720"
                     /db_xref="GeneID:10915154"
     CDS             176085..176213
                     /locus_tag="CNE_BB1p01720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687637.1"
                     /db_xref="GI:339327945"
                     /db_xref="GeneID:10915154"
                     /translation="MKVIWQLDAFCKGTGQSSQVSCLHWRSKRRMHFGRKNLIELG"
     gene            complement(176731..177144)
                     /locus_tag="CNE_BB1p01730"
                     /db_xref="GeneID:10915155"
     CDS             complement(176731..177144)
                     /locus_tag="CNE_BB1p01730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687638.1"
                     /db_xref="GI:339327946"
                     /db_xref="GeneID:10915155"
                     /translation="MFFGDEFLSITEIQTQWDNWKSLEDENLNEELASSMSSQPPGVV
                     KPHYLNSRWVPFTHDGGGNHSALDFDPDSEGHIGQVIAFGRDEDEKKLLGSSFEDFLS
                     QFQRRLLSVRWSLVEGYWKFEEPQYRCHYHAWPVL"
     misc_feature    complement(176788..>177045)
                     /locus_tag="CNE_BB1p01730"
                     /note="SMI1 / KNR4 family (SUKH-1); Region: SMI1_KNR4;
                     cl01747"
                     /db_xref="CDD:261048"
     gene            complement(177658..178002)
                     /gene="pemK"
                     /locus_tag="CNE_BB1p01740"
                     /db_xref="GeneID:10915156"
     CDS             complement(177658..178002)
                     /gene="pemK"
                     /locus_tag="CNE_BB1p01740"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PemK"
                     /protein_id="YP_004687639.1"
                     /db_xref="GI:339327947"
                     /db_xref="GeneID:10915156"
                     /translation="MGQTEGYASDAGPVPRPFNERTSIVIGLPMTTAAYNETNPFAIK
                     FQGPKEKVSYVLAHQPKSFDWRARNAKAHSQTPRRSARACCWRSIFLLATPLCALTGQ
                     SQAAASGPQERN"
     misc_feature    complement(<177790..>177960)
                     /gene="pemK"
                     /locus_tag="CNE_BB1p01740"
                     /note="PemK-like protein; Region: PemK; cl00995"
                     /db_xref="CDD:260736"
     gene            178058..178210
                     /locus_tag="CNE_BB1p01750"
                     /db_xref="GeneID:10915157"
     CDS             178058..178210
                     /locus_tag="CNE_BB1p01750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687640.1"
                     /db_xref="GI:339327948"
                     /db_xref="GeneID:10915157"
                     /translation="MAGKLWVPERRDIIWIDCNPQGGRETWRQAPLEVFAAACEQLNQ
                     IIAIAE"
     misc_feature    178073..>178132
                     /locus_tag="CNE_BB1p01750"
                     /note="PemK-like protein; Region: PemK; cl00995"
                     /db_xref="CDD:260736"
     gene            complement(178434..178673)
                     /locus_tag="CNE_BB1p01760"
                     /db_xref="GeneID:10915158"
     CDS             complement(178434..178673)
                     /locus_tag="CNE_BB1p01760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687641.1"
                     /db_xref="GI:339327949"
                     /db_xref="GeneID:10915158"
                     /translation="MLLPHQMGSADAYDRAGEACGALSLALHGALSGRAAAFGFTGTA
                     MGAFLGQRNAQGVKQDGRPSDNYLGRLAGMVVRKL"
     gene            178715..179122
                     /locus_tag="CNE_BB1p01770"
                     /db_xref="GeneID:10915159"
     CDS             178715..179122
                     /locus_tag="CNE_BB1p01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687642.1"
                     /db_xref="GI:339327950"
                     /db_xref="GeneID:10915159"
                     /translation="MAEHRDGSSGHEGTRYYRHDQAFWREMVAQWNNSGLGIRAFCRQ
                     HGLAVSTSGLWRKRVDHDQPAVMPLTVTADTAFIAAATGTAPAVQAVADIAPSRGRDH
                     VVIALAGARIELTGAHAERIVRFVLGQLGGGRC"
     gene            complement(179478..181013)
                     /gene="phrA"
                     /locus_tag="CNE_BB1p01780"
                     /db_xref="GeneID:10915160"
     CDS             complement(179478..181013)
                     /gene="phrA"
                     /locus_tag="CNE_BB1p01780"
                     /EC_number="4.1.99.3"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photo-lyase PhrA"
                     /protein_id="YP_004687643.1"
                     /db_xref="GI:339327951"
                     /db_xref="GeneID:10915160"
                     /translation="MPRPLSPASETAGTGRMPYRIDREFARGLVWFRRDLRADDHAAL
                     HYALKHCRQVWCVFVFDREILDPLIARGRKVDRRVEFILRSLEPLRRTLTDAGGGLIV
                     LDDTARDAIPRLAAELDAEAVFTNHDYEPAAKRRDTAVSQALASDFRVLFTFKDQVIF
                     EADDLMTGQGQPFSVFTPYKNAWLRGVQPFDLRPYPVDKYLGALAPVPRQYQKVSPML
                     DDLGFAVSNLVEIAMPTGSDGARALFDEFIDRIGDYGNRRDFPSLRGPSYLSVHLRFG
                     TISIRTLARAALDAVLRGGSKSAGAAVWLSELIWRDFYFMILHHHPRVADGKSFRPEY
                     DALRWVDSVTGDRYFQAWCDAQTGYPLVDAAMLQIHQSGYMHNRLRMVTASFLVKDLG
                     VDWRRGEQYFADQLNDFDFSANNGGWQWAASTGCDAQPYFRIFNPVMQSEKFDPQGRF
                     IRKYLPVLAQMPDKYIHAPWTAPVNVLATAGVKLGENYPPPIVQHDVARKETLERYAA
                     IKK"
     misc_feature    complement(179484..180929)
                     /gene="phrA"
                     /locus_tag="CNE_BB1p01780"
                     /note="Deoxyribodipyrimidine photolyase [DNA replication,
                     recombination, and repair]; Region: PhrB; COG0415"
                     /db_xref="CDD:223492"
     misc_feature    complement(180459..180929)
                     /gene="phrA"
                     /locus_tag="CNE_BB1p01780"
                     /note="DNA photolyase; Region: DNA_photolyase; pfam00875"
                     /db_xref="CDD:250195"
     misc_feature    complement(179484..180308)
                     /gene="phrA"
                     /locus_tag="CNE_BB1p01780"
                     /note="FAD binding domain of DNA photolyase; Region:
                     FAD_binding_7; pfam03441"
                     /db_xref="CDD:251955"
     gene            181211..181834
                     /gene="tnpA1"
                     /locus_tag="CNE_BB1p01790"
                     /db_xref="GeneID:10915161"
     CDS             181211..181834
                     /gene="tnpA1"
                     /locus_tag="CNE_BB1p01790"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase TnpA"
                     /protein_id="YP_004687644.1"
                     /db_xref="GI:339327952"
                     /db_xref="GeneID:10915161"
                     /translation="MQVTTIGIDLAKNVFQIHGVNELGKATLRKQLKRAQVAEFFATL
                     PPGVIGMEACGSAHHWARKLQSFGHTVRLMAPQFVKPYVKTNKNDAADAEAICEAVAR
                     PNMRFVPIKYVEQQAVSALHRARQGFVKAHTSQANQIRGLLAEFGLVVPQGIGSIARQ
                     VPELIEDATNELPGSFRLLIQRLLEHLKDAGASGRRNWRAGRGMASG"
     misc_feature    181220..>181780
                     /gene="tnpA1"
                     /locus_tag="CNE_BB1p01790"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    181226..181624
                     /gene="tnpA1"
                     /locus_tag="CNE_BB1p01790"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     gene            complement(182153..182500)
                     /locus_tag="CNE_BB1p01800"
                     /db_xref="GeneID:10915162"
     CDS             complement(182153..182500)
                     /locus_tag="CNE_BB1p01800"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_004687645.1"
                     /db_xref="GI:339327953"
                     /db_xref="GeneID:10915162"
                     /translation="MGRTEIDRLVVVVGHAIARHRIAANLTQEQVAERLGIGNEAVSR
                     MERGVVMPTIARLAELADIFQCDTSELLTEASTRSSDQANHLARLLTKVSSPDRAMIV
                     AMVETLTARLARR"
     misc_feature    complement(182177..182464)
                     /locus_tag="CNE_BB1p01800"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(182288..182461)
                     /locus_tag="CNE_BB1p01800"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(182360..182362,182435..182437,
                     182447..182449))
                     /locus_tag="CNE_BB1p01800"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(182363..182365,182438..182440))
                     /locus_tag="CNE_BB1p01800"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(182357..182362,182372..182374,
                     182381..182383,182414..182419))
                     /locus_tag="CNE_BB1p01800"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(182533..183018)
                     /locus_tag="CNE_BB1p01810"
                     /db_xref="GeneID:10915163"
     CDS             complement(182533..183018)
                     /locus_tag="CNE_BB1p01810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687646.1"
                     /db_xref="GI:339327954"
                     /db_xref="GeneID:10915163"
                     /translation="MWRCVARNRREAWARPQTVIVQDICWTATARHADIVLPVTTALE
                     RNDIGGSSRNRHVLAMHQAIAPLHRAPAATSLRRVRRRGRITADEGGLFIPATRAGDL
                     VHEGASIGDTLKLDASLTAVKPFTHDGIPIGLRSDPVVHTGERLAFVETQLVKHFIQK
                     R"
     misc_feature    complement(182809..>183000)
                     /locus_tag="CNE_BB1p01810"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     misc_feature    complement(182590..>182766)
                     /locus_tag="CNE_BB1p01810"
                     /note="M14 family of metallocarboxypeptidases and related
                     proteins; Region: Peptidase_M14_like; cl11393"
                     /db_xref="CDD:264346"
     gene            complement(183108..184391)
                     /gene="metC"
                     /locus_tag="CNE_BB1p01820"
                     /db_xref="GeneID:10915164"
     CDS             complement(183108..184391)
                     /gene="metC"
                     /locus_tag="CNE_BB1p01820"
                     /EC_number="4.4.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase MetC"
                     /protein_id="YP_004687647.1"
                     /db_xref="GI:339327955"
                     /db_xref="GeneID:10915164"
                     /translation="MSTNGRHEPCDVSHNREPPHRPTMTKALPTRLAHAGRISAVSGG
                     QPVNPAVVRASTVLFESVAQQREMRARRDTERLFTYGARGNPTNFALEDMVTMLEGGY
                     RTRLFPSGLAAAAMTILAYVRPGEHVLLPDCVYEPVRNLANGFLRQHSIAADFYAADG
                     SDLDAKLRPETRLVYAEAPGSLVYEMCDLPALAERAHANGALVAADNTWGSGLLYRPL
                     ELGADISLMAATKYLCGHSDVMMGTVCTTEAAWQPLATMSDSFGMAVSPDDSYLVQRG
                     IRSLGARLAQHQESALAVAQWLLDRPEVAQVFCPALPHDPNHTLWQRHCHGTNGLLSF
                     TLHSQAPVAPERFVDSLQLFGIGASWGGFESLAVLADMRRARSISDWSSHGTVIRLHI
                     GLEAVSDLMSDLDQAFAAIAHIESTEQESSHAHHR"
     misc_feature    complement(183156..184310)
                     /gene="metC"
                     /locus_tag="CNE_BB1p01820"
                     /note="Cystathionine beta-lyases/cystathionine
                     gamma-synthases [Amino acid transport and metabolism];
                     Region: MetC; COG0626"
                     /db_xref="CDD:223699"
     misc_feature    complement(order(183699..183701,183708..183710,
                     183765..183767,183774..183776,183861..183863,
                     184050..184052,184059..184064))
                     /gene="metC"
                     /locus_tag="CNE_BB1p01820"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(183699..183701)
                     /gene="metC"
                     /locus_tag="CNE_BB1p01820"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(184381..185382)
                     /locus_tag="CNE_BB1p01830"
                     /db_xref="GeneID:10915165"
     CDS             complement(184381..185382)
                     /locus_tag="CNE_BB1p01830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687648.1"
                     /db_xref="GI:339327956"
                     /db_xref="GeneID:10915165"
                     /translation="MSRPMSSRFPQLLVAALTFTMFGAATAQPLAPVNDYPSQSLRIV
                     SPFPAGGGNDAVTRVVATRLSQVLGQSAVTDNRGGAGGNIGTRYVAESKPDGYTVLTS
                     QVSIMAVNPTLYRAPGFDPIKQFIPVTQINAAPLAIVVSSNAPWKSFEELAAQAKAQP
                     QKITFATPGNGTLSHLVGAVLDKDSKVSLQHVPYKGAGPAINDLLGGQVDVLITSTSS
                     VAGFIQTGRMRALAVTSPRRLGVFTKVPTLEELGYRNARFEDWYGFFVPAGTPPERVA
                     LLNRAIVQVLQMPDVVKTIRDSGSDVIANSSEAFAVQLNQDISRWSQIVKLSGAHVD"
     misc_feature    complement(184393..185217)
                     /locus_tag="CNE_BB1p01830"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(185444..187057)
                     /locus_tag="CNE_BB1p01840"
                     /db_xref="GeneID:10915166"
     CDS             complement(185444..187057)
                     /locus_tag="CNE_BB1p01840"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like protein"
                     /protein_id="YP_004687649.1"
                     /db_xref="GI:339327957"
                     /db_xref="GeneID:10915166"
                     /translation="MSQASYTAADAVTLKGWLHDADEIALFDVREHGQYGEGHPFYAV
                     PLPYSRLELDIGRLAPRTDARMVLADDGDGVAQAAAAALARLGYTNLFVLDGGMPAWQ
                     AAGYALFAGVNVPSKTFGELAEHHYRTPRVTAQELAAMQAGANAPVVLDGRPTGEFRK
                     MNIPGAISCPNGELAYRLRDLVPDSTTPIVINCAGRTRSIIGAQSLINFGVSNPVYAL
                     ENGTQGWYLNDFTLEHGGTARYPENASPRELDAARNAAQALAARFDVPRIAAAQAIAW
                     LADRSRTTFLCDVRTPEEYATQTLPGAQHTPGGQLMQATDQYVGVRRARLVLFDAEGV
                     RAIVVASWLRQMGHDAVVLDGGLQAGLAAGVKAAHGPAYQVTTPAIINVAQLAAGMAT
                     QSMLALDLRGSMTYRAGQIAGSYWSTRARLAQDLRGVPHDTTLVLIGDADGDDPADLA
                     FADLHTLGYRDVRRLHGGFGAWRDAGHAVSRGAQTLPDARCIDYLFFVHDRHDGNKAA
                     ARQYLAWETGLIGQLDAQELATFRFKPLD"
     misc_feature    complement(186749..187006)
                     /locus_tag="CNE_BB1p01840"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(186848..186850)
                     /locus_tag="CNE_BB1p01840"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    complement(186371..186697)
                     /locus_tag="CNE_BB1p01840"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(186479..186481)
                     /locus_tag="CNE_BB1p01840"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    complement(185972..186223)
                     /locus_tag="CNE_BB1p01840"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily, repeat 3. This CD includes putative
                     rhodanese-related sulfurtransferases which contain 4
                     copies of the Rhodanese Homology Domain. This CD aligns
                     the 3rd repeat which does not contain the putative...;
                     Region: 4RHOD_Repeat_3; cd01534"
                     /db_xref="CDD:238792"
     misc_feature    complement(186068..186070)
                     /locus_tag="CNE_BB1p01840"
                     /note="active site residue [active]"
                     /db_xref="CDD:238792"
     misc_feature    complement(185465..185902)
                     /locus_tag="CNE_BB1p01840"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(185741..185743)
                     /locus_tag="CNE_BB1p01840"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(187170..187757)
                     /locus_tag="CNE_BB1p01850"
                     /db_xref="GeneID:10915167"
     CDS             complement(187170..187757)
                     /locus_tag="CNE_BB1p01850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687650.1"
                     /db_xref="GI:339327958"
                     /db_xref="GeneID:10915167"
                     /translation="MSITQQRQAAVGETIESIKNIVDKGAVTRASLADVLSHVEELAA
                     RTELWGETDFPPPEPGERQARYLIAEDPDQTYALYLNVMRPGKRIPPHNHTTWACVAG
                     VSGIEFNDVYTRTDDGSQAGVGTLEYSHTVEVGPRCGIALLPDDIHSVEIQGEDVIRH
                     LHMYGRALETLTERLTFDLETGRCQIMNVGVQTRR"
     misc_feature    complement(187218..187715)
                     /locus_tag="CNE_BB1p01850"
                     /note="Predicted metal-dependent enzyme of the
                     double-stranded beta helix superfamily [General function
                     prediction only]; Region: COG5553"
                     /db_xref="CDD:227840"
     gene            187883..188749
                     /locus_tag="CNE_BB1p01860"
                     /db_xref="GeneID:10915168"
     CDS             187883..188749
                     /locus_tag="CNE_BB1p01860"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687651.1"
                     /db_xref="GI:339327959"
                     /db_xref="GeneID:10915168"
                     /translation="MRNLDLDLLRTLVAIADNETFGAAAEAVQRTQSAVTQQMQRLEE
                     QLGLTLFERQGRGKQMTRHGKKLLEYARQLLTINDETLRMLREGDLTGSLRIGAPHDV
                     ADTILPVLLSHIARSSPALRLEIHVGRSPFLMESLRRGEIDLTVSTREDNTLEGIVLR
                     TTPTIWVCSADFVYEHGTPVPLILADEPSLFRKLSLEALTHAGVPWRIAYLAPSLIGI
                     KAALRGGLGITARSIDLLTADMRILGENDGLPRLPDVTYYLWARPNAVNPVARHVFSM
                     LKTALQRGLVSA"
     misc_feature    187892..188731
                     /locus_tag="CNE_BB1p01860"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    187898..188077
                     /locus_tag="CNE_BB1p01860"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    188162..188713
                     /locus_tag="CNE_BB1p01860"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(188204..188209,188213..188218,188225..188227,
                     188237..188239,188243..188263,188507..188524,
                     188540..188545,188549..188554)
                     /locus_tag="CNE_BB1p01860"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            188855..189139
                     /locus_tag="CNE_BB1p01870"
                     /db_xref="GeneID:10915169"
     CDS             188855..189139
                     /locus_tag="CNE_BB1p01870"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687652.1"
                     /db_xref="GI:339327960"
                     /db_xref="GeneID:10915169"
                     /translation="MTASLHTTASGPSVGQFVAENAERLRLIWLPGYCPELNPDELLN
                     QDVKTDAMGKGRPTSKAEMIDSVRRHLHRLQKQPHVIRNLFQEKHVCYAA"
     misc_feature    <188861..189046
                     /locus_tag="CNE_BB1p01870"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     cl19249"
                     /db_xref="CDD:267602"
     gene            complement(190133..190714)
                     /locus_tag="CNE_BB1p01880"
                     /db_xref="GeneID:10915170"
     CDS             complement(190133..190714)
                     /locus_tag="CNE_BB1p01880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687653.1"
                     /db_xref="GI:339327961"
                     /db_xref="GeneID:10915170"
                     /translation="MPTKSTTPNGRNYGITDAQAVPTAAAGPAAPQQFVRDPVCGMEI
                     SPQEAAASTEVDQKRYWFCSPHCEQAFLANPAKYILHPVDRRSSAGPSSSPSPPDVAP
                     IPAARPALASRAAKQLAKDPICGMMVDKATALSAERGNRVARFTLNRRRRERFFSNTR
                     RDTYIGIIGTTAAARRYRLPFKGGKHEPRPQRS"
     misc_feature    complement(190472..190612)
                     /locus_tag="CNE_BB1p01880"
                     /note="Ribosomal protein L24e/L24 is a ribosomal protein
                     found in eukaryotes (L24) and in archaea (L24e, distinct
                     from archaeal L24). L24e/L24 is located on the surface of
                     the large subunit, adjacent to proteins L14 and L3, and
                     near the translation factor...; Region:
                     Ribosomal_L24e_L24; cl00909"
                     /db_xref="CDD:242184"
     gene            complement(190956..192140)
                     /gene="metK"
                     /locus_tag="CNE_BB1p01890"
                     /db_xref="GeneID:10915171"
     CDS             complement(190956..192140)
                     /gene="metK"
                     /locus_tag="CNE_BB1p01890"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase MetK"
                     /protein_id="YP_004687654.1"
                     /db_xref="GI:339327962"
                     /db_xref="GeneID:10915171"
                     /translation="MSIMENIAISISRWSSWRGEQTEMCEHKGIGHPDSLCDGAVEAA
                     ARALCHAYLEAYGAIQHFNLDKALLIGGISTPKFGGGKVLRPTRLILSGPVTELPSAK
                     AELVVEQAIREYLATSLGSIGNDIRIEPILRPSAPNLRRVTNAASLPLSNDTSFGVGY
                     APPSSLERAVLLVADLLRSRAARGVFEAAGLDYKVMGCRLGEHHRLTLALAFVDRRVH
                     GVDEYFILKGRIGQYLAERIGTECEIAINTLDSRDACDESGIYLTVTGLSAEHGDDGQ
                     VGRGNRVNGLITPYRPMSLEAAAGKNPASHVGKLYNVLAHRLATHIQASVDGADEVIV
                     RLLSGIGRPIDQPQLFAIDVVAERGLSSAQAQQVRELARQQLAEFPALVNELIHGTVA
                     VF"
     misc_feature    complement(190974..192128)
                     /gene="metK"
                     /locus_tag="CNE_BB1p01890"
                     /note="S-adenosylmethionine synthetase (AdoMet
                     synthetase); Region: AdoMet_Synthase; pfam01941"
                     /db_xref="CDD:250984"
     misc_feature    complement(191625..>191885)
                     /gene="metK"
                     /locus_tag="CNE_BB1p01890"
                     /note="Anti-Mullerian hormone, N terminal region; Region:
                     AMH_N; pfam04709"
                     /db_xref="CDD:252752"
     gene            192416..193015
                     /gene="lemA"
                     /locus_tag="CNE_BB1p01900"
                     /db_xref="GeneID:10915172"
     CDS             192416..193015
                     /gene="lemA"
                     /locus_tag="CNE_BB1p01900"
                     /codon_start=1
                     /transl_table=11
                     /product="protein LemA"
                     /protein_id="YP_004687655.1"
                     /db_xref="GI:339327963"
                     /db_xref="GeneID:10915172"
                     /translation="MRQWLAIGLTGCGYNAIQTQDEQVKAGWSEVVNQYQRRADLVPS
                     LVHTVKGYASHEREVLTQVTEARARVGAIQVTPELLNNPQAFAQFQAAQQALSGSLSR
                     LLAVSENYPQLKADAGFRDLQSQLEGTENRITVARNRYIQSVQAYNVTVRSFPSNLTA
                     MVFGYKEKPNFTVASEATIAKPPLVDFGAAPASAPGGAK"
     misc_feature    192428..192970
                     /gene="lemA"
                     /locus_tag="CNE_BB1p01900"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: LemA; COG1704"
                     /db_xref="CDD:224618"
     gene            193012..193857
                     /locus_tag="CNE_BB1p01910"
                     /db_xref="GeneID:10915173"
     CDS             193012..193857
                     /locus_tag="CNE_BB1p01910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687656.1"
                     /db_xref="GI:339327964"
                     /db_xref="GeneID:10915173"
                     /translation="MKWLSAARGLFLVFLVFASLGAAADVAVPSLTARVTDLTATLTS
                     AQQAALEQELQAFEEQKGSQVAVLMVPTTQPEAIEQYSIRVVEKWKLGRKGTDDGALL
                     IIAKDDRTVRIEVGYGLEGVLTDAMSKRIISDDIVPRFKQGDFYGGVTAGVERIMGVI
                     SGEPLPTPRREGGERDPVRQLMPVILVLTVVLGGLLRSFLGRGPGAVAAGGAVGFIGW
                     LLSGALAVGLMAGAIALFFTLFGGSHIGWRGIGGRGGFGGRSGRGGFGGGGGGFGGGG
                     ASGKW"
     misc_feature    193039..>193620
                     /locus_tag="CNE_BB1p01910"
                     /note="Beta-propeller domains of methanol dehydrogenase
                     type [General function prediction only]; Region: COG1512"
                     /db_xref="CDD:224429"
     gene            193857..194357
                     /locus_tag="CNE_BB1p01920"
                     /db_xref="GeneID:10915174"
     CDS             193857..194357
                     /locus_tag="CNE_BB1p01920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687657.1"
                     /db_xref="GI:339327965"
                     /db_xref="GeneID:10915174"
                     /translation="MENVKRIVRHLLMTHWRVGRSFPEDVLREVEQAIAKSESSHFGQ
                     LCFVVEGALSLASLFAGQSARDRAVEVFSQMRVWDTEHNNGVLIYLLLADRSVEIVAD
                     RGIHAKVGASDWDAICREMEATFRRGEYQHGLIDGILAISQHLRQHFPVRDSGKNELS
                     NKPVVL"
     misc_feature    <194040..194354
                     /locus_tag="CNE_BB1p01920"
                     /note="TLP18.3, Psb32 and MOLO-1 founding proteins of
                     phosphatase; Region: TPM; cl01535"
                     /db_xref="CDD:260987"
     gene            complement(194458..194574)
                     /locus_tag="CNE_BB1p01930"
                     /db_xref="GeneID:10915175"
     CDS             complement(194458..194574)
                     /locus_tag="CNE_BB1p01930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687658.1"
                     /db_xref="GI:339327966"
                     /db_xref="GeneID:10915175"
                     /translation="MSRMATYLAMDSQAGDAPPFRKFAFMPTTLQTNQEANS"
     gene            complement(195437..196492)
                     /gene="qorA"
                     /locus_tag="CNE_BB1p01940"
                     /db_xref="GeneID:10915176"
     CDS             complement(195437..196492)
                     /gene="qorA"
                     /locus_tag="CNE_BB1p01940"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase QorA"
                     /protein_id="YP_004687659.1"
                     /db_xref="GI:339327967"
                     /db_xref="GeneID:10915176"
                     /translation="MKHTRIIVTHYGGPDALQVVEEERPEPKAGEVRVRVLAAGVGQP
                     DLMMREGFHPETPPLPFTPGWDLVGLVDKLGCDVSGVEPGQIVAALPINGAYAEFVCL
                     AQRELVPVPSGLDAAEAVSLVLNYVTAYQMLHRCAIVKPGQRVLIHGAAGGVGSALMQ
                     LGSLVGLEMYGTCSSQDAIAVSGLGGIPIDYQKLDFVGEIRRLTGKGVDVVFDGIGGT
                     HIWRSRDALRLGGRVVAYGLTASLRGGRLASGRPGRRNRFQRLAIFGLYIAGSWLLPG
                     RKRVVPYSIQWLKRLKPALFRQDLIALLDLLQQKKIKPLIARKLPLVEARLAHELLGE
                     KGVAGKIVLVGNETLMR"
     misc_feature    complement(195464..196492)
                     /gene="qorA"
                     /locus_tag="CNE_BB1p01940"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    complement(195461..196486)
                     /gene="qorA"
                     /locus_tag="CNE_BB1p01940"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR8; cd08273"
                     /db_xref="CDD:176234"
     misc_feature    complement(order(195635..195643,195782..195787,
                     195842..195844,195848..195853,195920..195922,
                     195962..195964,195971..195976,196028..196033,
                     196037..196048,196109..196111,196121..196123,
                     196352..196354,196361..196369))
                     /gene="qorA"
                     /locus_tag="CNE_BB1p01940"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176234"
     gene            complement(196647..197102)
                     /gene="gltI1"
                     /locus_tag="CNE_BB1p01950"
                     /db_xref="GeneID:10915177"
     CDS             complement(196647..197102)
                     /gene="gltI1"
                     /locus_tag="CNE_BB1p01950"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate ABC transporter permease
                     GltI"
                     /protein_id="YP_004687660.1"
                     /db_xref="GI:339327968"
                     /db_xref="GeneID:10915177"
                     /translation="MPESRLVSRRVPNEKVLRKYSADNNIDIKIVSGKDYADALQLVE
                     SERASALVLDDVLLFGLRANSRNPSSLVIVGDPLQVEPYASMVRKDDAEFKKLVDGTI
                     TRLIRSGEFTRLYKKWFESPIPPTGVNLNMPMSEPLRANLKSRSDKPAQ"
     misc_feature    complement(196746..>197048)
                     /gene="gltI1"
                     /locus_tag="CNE_BB1p01950"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(196962..196964,196980..196982,
                     196992..196994))
                     /gene="gltI1"
                     /locus_tag="CNE_BB1p01950"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(196845..196862)
                     /gene="gltI1"
                     /locus_tag="CNE_BB1p01950"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(197838..198686)
                     /gene="phcB2"
                     /locus_tag="CNE_BB1p01960"
                     /db_xref="GeneID:10915178"
     CDS             complement(197838..198686)
                     /gene="phcB2"
                     /locus_tag="CNE_BB1p01960"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine (SAM)-dependent
                     methyltransferase PhcB"
                     /protein_id="YP_004687661.1"
                     /db_xref="GI:339327969"
                     /db_xref="GeneID:10915178"
                     /translation="MADSRVKSNLRNTWESAAPGWSKWEHVFATNLSCATDTLIDMAG
                     IRPGMRVLDLACGAGSQSIQAAMRVGAGGEVVASDISGTMLEHVRRNAARAGLQNIQT
                     LECAADELDETLAPFDAAMCRLGLMLFPSPSEALEAVRRALKPGARFAALVFTTPANN
                     PFMAQPMAILLRHAGKSPPAPGQPGIFALGGDGVLERLMNDSGLSDVKTQHVRAQLVL
                     PSAFDALQLMQEAAGAYRAVIADLDVAAKLSAWNDVYECLKQFDVGEGFKAELELIIG
                     SGARPR"
     misc_feature    complement(198222..198539)
                     /gene="phcB2"
                     /locus_tag="CNE_BB1p01960"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(198318..198320,198369..198371,
                     198372..198374,198447..198452,198507..198527))
                     /gene="phcB2"
                     /locus_tag="CNE_BB1p01960"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(198991..199401)
                     /locus_tag="CNE_BB1p01970"
                     /db_xref="GeneID:10915179"
     CDS             complement(198991..199401)
                     /locus_tag="CNE_BB1p01970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687662.1"
                     /db_xref="GI:339327970"
                     /db_xref="GeneID:10915179"
                     /translation="MRKRATVAVRSGVTAWADAAPSTSWRDSAWLARITPRGLGFAAP
                     ILADWTASAHANKAMRQVANAARRQARRDTMWAASRGACPTWSVATGWEVIEAIAPAD
                     CDVQRRRVLALQDGRPWCWLYRASDAGRVLAGGS"
     gene            complement(199556..200578)
                     /locus_tag="CNE_BB1p01980"
                     /db_xref="GeneID:10915180"
     CDS             complement(199556..200578)
                     /locus_tag="CNE_BB1p01980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687663.1"
                     /db_xref="GI:339327971"
                     /db_xref="GeneID:10915180"
                     /translation="MSDTRLTWHVGMRAALSVALAYGIARVRAQCLHPHDLPPPGARP
                     PTMVALLERTGGADVAAFARLLGETPEVFQWSTLGALQSWLSAALVVPQPRLCFASLA
                     AGYHTAHFSVALLDACPIHGTPLVNRCHCGAPFHATLHSLEDYAAAGSCRCGRLHFIA
                     HETCRRPTLAPETTHALDPVAAWLDAMSRLIRSARLDEALCQHAPGGLEWVITAAQAL
                     GLAYPACLRPIRLVPLPIGTVWYTPRPRQTPSRAHAPPPPGKREQGKPSYWQPTPATT
                     LYRALARHVRRHLAPGGARWMARFIASCDPFAIGTWIGGSPRARQAFIDMLWGRAAEP
                     GIEQRR"
     gene            201434..202027
                     /locus_tag="CNE_BB1p01990"
                     /db_xref="GeneID:10915181"
     CDS             201434..202027
                     /locus_tag="CNE_BB1p01990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687664.1"
                     /db_xref="GI:339327972"
                     /db_xref="GeneID:10915181"
                     /translation="MRMRRILSTLATLALLTQPVIASAQETTGQSMTAPGKAAFSQTV
                     KETTTVVGIDPATRIITLKGSKGVSNLVAGEEVRNFDQLKVGDKVVAEYKQALSLDLK
                     KGGGSVAGQTERESADRTPLGAKPGGSATREVTLVASVVAVDTRRQLVTLRGPKGNTV
                     DLNVKDPDQLKNIKKGDQVQAVYTEAVVVSVEPASKK"
     gene            202179..202562
                     /locus_tag="CNE_BB1p02000"
                     /db_xref="GeneID:10915182"
     CDS             202179..202562
                     /locus_tag="CNE_BB1p02000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687665.1"
                     /db_xref="GI:339327973"
                     /db_xref="GeneID:10915182"
                     /translation="MLMKLRLRAAMAVGCVTLAVVSGTLRAEEIPLITGKQWTESSEQ
                     TKKAYLVGIANLAQVDIAFHAGKPPADSQSVIPRLAKGLKGQTLDTVREGLDRWYAAH
                     SDRLQRPVIETIWFEMVVPGLQSNK"
     gene            complement(202881..203864)
                     /locus_tag="CNE_BB1p02010"
                     /db_xref="GeneID:10915183"
     CDS             complement(202881..203864)
                     /locus_tag="CNE_BB1p02010"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha amylase"
                     /protein_id="YP_004687666.1"
                     /db_xref="GI:339327974"
                     /db_xref="GeneID:10915183"
                     /translation="MATKNGPLLLAYGRDPYFDGWPDTLQLNNGNPHLQQAMIGELER
                     IADQCKGVRYDMAMLVLSEVFERTWGIRPDLFWPKATGSVRRQHPGFLVIAEVYWDME
                     WTLQQQGFDYAYDKRLYDRLREQRARPVREHLGADMAYQNKLARFLENHDEPRAASTF
                     APKVHAAAAVLTFLSPGLRFFHQGQFAGRRTRISPHLVRAPEEAVDGVLAQFHELLLA
                     VLRQPLVRDGNWSLLECVPVRADNTTSDNFIAFRWVPAPHEWMFVAVNYSPQQSQCFM
                     RAPFAELAGRTVRLQDRLSPAVYDRPGEDLRARGLFLDVPPWGYHVFDAMD"
     misc_feature    complement(203169..>203849)
                     /locus_tag="CNE_BB1p02010"
                     /note="Alpha amylase catalytic domain family; Region:
                     AmyAc_family; cl07893"
                     /db_xref="CDD:263509"
     misc_feature    complement(order(203409..203414,203577..203579,
                     203700..203702,203706..203708))
                     /locus_tag="CNE_BB1p02010"
                     /note="active site"
                     /db_xref="CDD:200451"
     misc_feature    complement(order(203409..203411,203577..203579,
                     203700..203702))
                     /locus_tag="CNE_BB1p02010"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200451"
     gene            complement(204276..204698)
                     /locus_tag="CNE_BB1p02020"
                     /db_xref="GeneID:10915184"
     CDS             complement(204276..204698)
                     /locus_tag="CNE_BB1p02020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687667.1"
                     /db_xref="GI:339327975"
                     /db_xref="GeneID:10915184"
                     /translation="MVTTTVSLAPTLISRTYAVGRALLGSLFLFSGLLKIGSFAAYSA
                     WIASAELPSPDLLLVLTIVIEIGGGLTVISGWNARLGALLLALFLVPTTIIFHGFWRA
                     DPADFLNQLNHILKNVSILGGMLVVFAIESSRMQARAA"
     misc_feature    complement(204312..204650)
                     /locus_tag="CNE_BB1p02020"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(204931..205380)
                     /locus_tag="CNE_BB1p02030"
                     /db_xref="GeneID:10915185"
     CDS             complement(204931..205380)
                     /locus_tag="CNE_BB1p02030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687668.1"
                     /db_xref="GI:339327976"
                     /db_xref="GeneID:10915185"
                     /translation="MVGSRMSIASPARSTPNGLITLLFHLSHAASQGQLDPVLVRDLG
                     KRIYIEIDACRTDEAKSQVELKLLSEAMFRFEDTLLAARSHMLLASIRRLGSTERPHP
                     EADRGAGQHEGGPPIPTNRPPNPSPVTARCTDYLEPLATLDQGDSPL"
     gene            complement(205558..206052)
                     /locus_tag="CNE_BB1p02040"
                     /db_xref="GeneID:10915186"
     CDS             complement(205558..206052)
                     /locus_tag="CNE_BB1p02040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687669.1"
                     /db_xref="GI:339327977"
                     /db_xref="GeneID:10915186"
                     /translation="MHDSKVMRTAAAALVLATAPLLHAQALAAHPKPPEIHQSSGVRY
                     VSGGIGREAVRQMQSIAGQFNVRLSFQDPSEGRPVSGVMLILANEKGKRLLRLVTDGP
                     LAYLKLPHGSYYLTVIYQGADHEQWITAEDEPMDLTFLFNLIDLEQYWLQAGTHTPQY
                     PTPT"
     gene            complement(206268..207071)
                     /locus_tag="CNE_BB1p02050"
                     /db_xref="GeneID:10915187"
     CDS             complement(206268..207071)
                     /locus_tag="CNE_BB1p02050"
                     /EC_number="3.6.3.8"
                     /codon_start=1
                     /transl_table=11
                     /product="calcium P-type ATPase"
                     /protein_id="YP_004687670.1"
                     /db_xref="GI:339327978"
                     /db_xref="GeneID:10915187"
                     /translation="MQNRSSALQTDRPRSHEEPYGTRDGIDPAHVPPGLTTAQARARL
                     AEVGRNVLPQAAPRSVVAVFLRQFLSPLIYILLAAAAVSLALGDLKDALFIGAVLLIN
                     SVIGTAQEHTADKATVALRKMEQVRASVLEPYAGKSLHSNHGQRVIIGQRLMQTASDV
                     FLGWIRGKNGRDFYIRQLRDMKLSAVIEDWDTGMLRQYGRMCAHALARAHARSGDAAM
                     IAGYMGSGQTFDDAICEFATEYCSQNRNDYRAFLAAIRKGRIEARMDQE"
     misc_feature    complement(<206679..206972)
                     /locus_tag="CNE_BB1p02050"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: MgtA; COG0474"
                     /db_xref="CDD:223550"
     misc_feature    complement(206847..>206972)
                     /locus_tag="CNE_BB1p02050"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; pfam00690"
                     /db_xref="CDD:250059"
     misc_feature    complement(206310..>206705)
                     /locus_tag="CNE_BB1p02050"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2252); Region: DUF2252; cl19860"
                     /db_xref="CDD:268213"
     gene            207548..207726
                     /locus_tag="CNE_BB1p02060"
                     /note="transposase mutator type"
                     /pseudo
                     /db_xref="GeneID:10915188"
     gene            complement(208774..209034)
                     /locus_tag="CNE_BB1p02090"
                     /db_xref="GeneID:10915189"
     CDS             complement(208774..209034)
                     /locus_tag="CNE_BB1p02090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687671.1"
                     /db_xref="GI:339327979"
                     /db_xref="GeneID:10915189"
                     /translation="MRLIEPDEQQDFLATLQRNGLAADDFELVETDTTDPKGDENIGL
                     QGYVTVTRLSTQVTREYPIGDETDWVQHFRKDLEAGIFDKSE"
     gene            complement(209157..209537)
                     /locus_tag="CNE_BB1p02100"
                     /db_xref="GeneID:10915190"
     CDS             complement(209157..209537)
                     /locus_tag="CNE_BB1p02100"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_004687672.1"
                     /db_xref="GI:339327980"
                     /db_xref="GeneID:10915190"
                     /translation="MSENTAVTKQAETASPEAALMPPVNVYEDAAGITLYADLPGVPK
                     DKLAVQVQGGILTIKGEVVLDLPEGMEASYTEVSLPRYRRVFTLSKELDAEKVVAEFN
                     HGVLKLRIPKAELTQPSRIEVKVA"
     misc_feature    complement(209166..>209474)
                     /locus_tag="CNE_BB1p02100"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(209202..209465)
                     /locus_tag="CNE_BB1p02100"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(209223..209228,209286..209288,
                     209415..209420,209424..209426,209430..209432,
                     209451..209465))
                     /locus_tag="CNE_BB1p02100"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(209555..209989)
                     /locus_tag="CNE_BB1p02110"
                     /db_xref="GeneID:10915191"
     CDS             complement(209555..209989)
                     /locus_tag="CNE_BB1p02110"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_004687673.1"
                     /db_xref="GI:339327981"
                     /db_xref="GeneID:10915191"
                     /translation="MMYRSLFPRDIFSELERLQREWQQPFELSPSIRGRVSFPAMNVG
                     GTPHSVEIYAFAPGVDPASIDVQLVQSVLTIVGERKPDLPDKDEQTSVHIDERFAGRF
                     RRVVSLPSDVNPKAVEARYRDGVLHISIQRLEAAQPRQISIQ"
     misc_feature    complement(209561..209989)
                     /locus_tag="CNE_BB1p02110"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(209594..209854)
                     /locus_tag="CNE_BB1p02110"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(209615..209620,209678..209680,
                     209816..209821,209825..209827,209831..209833,
                     209852..209854))
                     /locus_tag="CNE_BB1p02110"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(209961..210101)
                     /locus_tag="CNE_BB1p02120"
                     /db_xref="GeneID:10915192"
     CDS             complement(209961..210101)
                     /locus_tag="CNE_BB1p02120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687674.1"
                     /db_xref="GI:339327982"
                     /db_xref="GeneID:10915192"
                     /translation="MMSNTSQIKTLKSAGEAVPLQPGASEYGAHAKANGGKHDVSIVV
                     SP"
     gene            210151..211104
                     /locus_tag="CNE_BB1p02130"
                     /db_xref="GeneID:10915193"
     CDS             210151..211104
                     /locus_tag="CNE_BB1p02130"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein DnaJ family"
                     /protein_id="YP_004687675.1"
                     /db_xref="GI:339327983"
                     /db_xref="GeneID:10915193"
                     /translation="MEFHDYYKTLRVARDATAEDIKKAFRKLARKFHPDVSKESDAEL
                     RMRQLNEAYAVLSDPDKRAAYDQLGRGYQPGQEFRPPPDWDTGFEFSSRGFSPQEEAD
                     FSDFFAELFGHVGGRHRGSHAHGGSFQSRGVDHHAKVLLDLEDAFTGATRQLSLRLPS
                     MDAQGVVQLRSRTLSVKIPKGVREGQLIRLAGQGAPGMGGAPAGDLFLEVHFNPHDRL
                     KVKGRNLHLTLPVAPWEAALGAVVPINLPGGELKVRIPSGAQSGSELRVRGKGIPANP
                     PGDLLLDIQVVLPPANTPKAREFYETMAREMIFNPRPNRRA"
     misc_feature    210151..211092
                     /locus_tag="CNE_BB1p02130"
                     /note="curved DNA-binding protein CbpA; Provisional;
                     Region: PRK10266"
                     /db_xref="CDD:182347"
     misc_feature    210163..210324
                     /locus_tag="CNE_BB1p02130"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    order(210247..210255,210277..210279,210286..210291,
                     210298..210303)
                     /locus_tag="CNE_BB1p02130"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    210550..211017
                     /locus_tag="CNE_BB1p02130"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    order(210559..210561,210604..210621,210661..210663,
                     210733..210735)
                     /locus_tag="CNE_BB1p02130"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    order(210847..210852,210859..210864,210922..210933,
                     211012..211017)
                     /locus_tag="CNE_BB1p02130"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            211300..211416
                     /locus_tag="CNE_BB1p02140"
                     /db_xref="GeneID:10915194"
     CDS             211300..211416
                     /locus_tag="CNE_BB1p02140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687676.1"
                     /db_xref="GI:339327984"
                     /db_xref="GeneID:10915194"
                     /translation="MRQLERDFDAIPELAALVADLLEEMDDLQARLRCTSRG"
     misc_feature    211300..>211380
                     /locus_tag="CNE_BB1p02140"
                     /note="Zinc peptidases M18, M20, M28, and M42; Region:
                     Zinc_peptidase_like; cl14876"
                     /db_xref="CDD:265470"
     gene            211859..212407
                     /locus_tag="CNE_BB1p02150"
                     /db_xref="GeneID:10915195"
     CDS             211859..212407
                     /locus_tag="CNE_BB1p02150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687677.1"
                     /db_xref="GI:339327985"
                     /db_xref="GeneID:10915195"
                     /translation="MKIPNSGSHAAPFDIPNVDHFRFHRPHAHLAPAFGNDRFALKAE
                     AFARFFGTPVFLGAQTVIVAIWIGVNALGFTRFDVYPFILLNLAFSLQAAYAAPLILL
                     AQTRQAARDNAHAEADAQHREALAVANEQRQAIAAQNAAQLLELLQRNTELTELTQKL
                     TVRVETLTVELHEKLLQKDSKP"
     misc_feature    212006..212323
                     /locus_tag="CNE_BB1p02150"
                     /note="Protein of unknown function (DUF1003); Region:
                     DUF1003; pfam06210"
                     /db_xref="CDD:253620"
     gene            212564..213133
                     /locus_tag="CNE_BB1p02160"
                     /db_xref="GeneID:10915196"
     CDS             212564..213133
                     /locus_tag="CNE_BB1p02160"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_004687678.1"
                     /db_xref="GI:339327986"
                     /db_xref="GeneID:10915196"
                     /translation="MRRDEEEIALHGHRFPAAIISCAVRWYFRFNLSLRDIEELLFEG
                     GVVVTYETIRRWCEKFGAGFAHRAKVARRKPGSTWHLDEMFVKLRGEPYVLWRAVDEH
                     GAELDILLQKRRDKAAAKRFFLRVLCSCPAPRKIVTDQLRSYPAAKADIPELACVKHV
                     FVKATARVNNRAENSHRPTRDCLVSLSAS"
     misc_feature    212597..>213103
                     /locus_tag="CNE_BB1p02160"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    212777..213112
                     /locus_tag="CNE_BB1p02160"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(213152..213613)
                     /locus_tag="CNE_BB1p02170"
                     /db_xref="GeneID:10915197"
     CDS             complement(213152..213613)
                     /locus_tag="CNE_BB1p02170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687679.1"
                     /db_xref="GI:339327987"
                     /db_xref="GeneID:10915197"
                     /translation="MLFHKCEIILSQWRPGCRQESAPANKHFAEARSGGMAMAKSRGA
                     PKRIAKEITLRQFRYFAAAGFGVLTDMVYRPWSLEGKQIEVRAIASAVPDMEVGMMWQ
                     AGRKLDKPADALREFLIHACGSRARCSRSAGARAGRLPRATVAAMPVVNAS"
     misc_feature    complement(213263..>213442)
                     /locus_tag="CNE_BB1p02170"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            213612..213983
                     /locus_tag="CNE_BB1p02180"
                     /db_xref="GeneID:10915198"
     CDS             213612..213983
                     /locus_tag="CNE_BB1p02180"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687680.1"
                     /db_xref="GI:339327988"
                     /db_xref="GeneID:10915198"
                     /translation="MENRLLAGFPSARTAPMPRSLPDPTPPSRATIRTIHQLGDRIRA
                     SRAGKGMPIDQAARHSGVSIGMLSKLENGKGVNLEHALRVLDGLGLTMLVVPKAHAPW
                     LEQAAAHAAKIGEDVAWDQNA"
     misc_feature    213720..>213887
                     /locus_tag="CNE_BB1p02180"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    213726..213887
                     /locus_tag="CNE_BB1p02180"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(213738..213740,213750..213752,213825..213827)
                     /locus_tag="CNE_BB1p02180"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(213747..213749,213822..213824)
                     /locus_tag="CNE_BB1p02180"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(213768..213773,213804..213806,213813..213815,
                     213825..213830)
                     /locus_tag="CNE_BB1p02180"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(214064..214843)
                     /locus_tag="CNE_BB1p02190"
                     /db_xref="GeneID:10915199"
     CDS             complement(214064..214843)
                     /locus_tag="CNE_BB1p02190"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687681.1"
                     /db_xref="GI:339327989"
                     /db_xref="GeneID:10915199"
                     /translation="MCAGAPPIGLDFGLWTRQIVATLIDEKFGVKMGVTAVGRLLAGL
                     DLSPQKPWQRAYQRDPQAVERWQRESFPGIAAAAKQSGADIYFWDESGFRADAVHGKT
                     WAVKGETPVIERPGQRQSNSAASAVNAEGAFWFATYKGALTAELFIELLKKMMTGRNR
                     PVHLIVDGLPAHKKANVREYIESTKGKLTMHVLPGYAPDPNPDEFVWSHLKRTGVARD
                     PLRAGEKLEIRVEQHLHDVKKNRRLVRSFFDAPSVAYISDR"
     misc_feature    complement(214637..214813)
                     /locus_tag="CNE_BB1p02190"
                     /note="Winged helix-turn helix; Region: HTH_33; pfam13592"
                     /db_xref="CDD:257907"
     misc_feature    complement(214163..214594)
                     /locus_tag="CNE_BB1p02190"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            215156..216217
                     /locus_tag="CNE_BB1p02200"
                     /db_xref="GeneID:10915200"
     CDS             215156..216217
                     /locus_tag="CNE_BB1p02200"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS605 OrfB family"
                     /protein_id="YP_004687682.1"
                     /db_xref="GI:339327990"
                     /db_xref="GeneID:10915200"
                     /translation="MSGMIRVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWG
                     KTWPSGFDLNVLTTGSSKELGIHSGTVNATCEQYAKSRSQHRRPYLRYRGRKSLGWVP
                     MKGRDLKREGEAFRFAGHTFRVFNSRLLPEGKVRDGSNFAQDSRGNWFLNIVIEVADM
                     PARPIQTGVGIDLGLKDFATLSTGEKLPNDRFGRQAAERLAKAQRARKHKRHIAKLHA
                     KVANARADFQHKLALELVRRFDYIAVGNVSALKLAKTKMAKSVYDASWSSFRDKLRYK
                     AIAHGATFEEVNESGSTQSCSACGSKDSTTRPKGIAGLRIREWTCSRCGVVHDRDTNA
                     ALNILRCGRASPGVGIPCL"
     misc_feature    215426..215896
                     /locus_tag="CNE_BB1p02200"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    <215516..216175
                     /locus_tag="CNE_BB1p02200"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    215951..216175
                     /locus_tag="CNE_BB1p02200"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            216353..217375
                     /locus_tag="CNE_BB1p02210"
                     /db_xref="GeneID:10915201"
     CDS             216353..217375
                     /locus_tag="CNE_BB1p02210"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004687683.1"
                     /db_xref="GI:339327991"
                     /db_xref="GeneID:10915201"
                     /translation="MNATTYGLDLAKSIFQLYWVDPETGETHSRRLSKTQLISFLSNR
                     TPGKFVLEACGGAHWWARKIISLGHEAILLHPKYVRPFVRTNKTDAADARAIWTAAQQ
                     PGMRPIPVKTEAQQALLGLHRIRSELVDSRTRQVNQIRGLLGEYGLHFVLGRKAAMAQ
                     FVTRLSEIEQTIPAPLWRLLSRQLQRLRQLDAEILAAEQEIAAWLKTEPAAQCVDAIP
                     GIGPITATALVATMGSPQAYRSGRAFAASLGLVPTQSGTGGKVHLGHISKRGDPYLRK
                     LLIHGARIVLTRSKRRPCWAEALLVRRPTNVAIVALANKMARTAWALLAHRRVYEPGY
                     ISARPA"
     misc_feature    216371..216766
                     /locus_tag="CNE_BB1p02210"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    216431..217324
                     /locus_tag="CNE_BB1p02210"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    216983..217225
                     /locus_tag="CNE_BB1p02210"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            217849..218655
                     /gene="istA"
                     /locus_tag="CNE_BB1p02220"
                     /db_xref="GeneID:10915202"
     CDS             217849..218655
                     /gene="istA"
                     /locus_tag="CNE_BB1p02220"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IstA"
                     /protein_id="YP_004687684.1"
                     /db_xref="GI:339327992"
                     /db_xref="GeneID:10915202"
                     /translation="MIGLEDRHTMVRHIETAQAGGARLRQACEVAGITVRTLQRWKAH
                     DGLVVGDPRPGAERPTPAHALTIEERERILAVANEPRFADMPPARIVPMLADEGVYLA
                     SESSFGRVLRAHGQTRHRGRAKAPRQSRPPTTHVATGPRQLWCWDMTYLPAEVAGRWF
                     YLYLILDVYSRKIAGFEVHDRDDANHAAHLVKRTALAEGIHAMATKQVLHGDNGATLK
                     ATTVLAMLHWLGVKPSYSRPRVSDDNAFVESLFRTAKYQPNPTLLLAGRR"
     misc_feature    217903..218193
                     /gene="istA"
                     /locus_tag="CNE_BB1p02220"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    217957..218181
                     /gene="istA"
                     /locus_tag="CNE_BB1p02220"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    218257..218613
                     /gene="istA"
                     /locus_tag="CNE_BB1p02220"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(218948..219940)
                     /locus_tag="CNE_BB1p02230"
                     /db_xref="GeneID:10915203"
     CDS             complement(218948..219940)
                     /locus_tag="CNE_BB1p02230"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687685.1"
                     /db_xref="GI:339327993"
                     /db_xref="GeneID:10915203"
                     /translation="MWYGAISSGFFDMIQIDVCNICSEIEIKTMIDVRQLQCFLAVAE
                     ELHFAKAADRLGVAQSGLSTQIQRLEQDLGVTLLNRNKRKPVSLTDAGHLFQAEAVAA
                     LRHIERADQVGRLAARGLAGVIRVGYVASGASSGLLSMMLSEFRKSHEMVRIEVVPME
                     TPRQLEALSDGQIDVGIVRPRRLYPAGVVTKVVQTERLLAAMTESHPLARRTTIPARA
                     LADQSFIVPQFADEEGFGSALSALGEVGGFTPHLEYRVQDFISAICLASGGYGVAIVP
                     ESMQNFSQPGIFYAQISDFKFSVQLVLAHRRREISPAVRAFVQLGTQMFNGRAS"
     misc_feature    complement(218966..219850)
                     /locus_tag="CNE_BB1p02230"
                     /note="DNA-binding transcriptional regulator HcaR;
                     Provisional; Region: PRK09906"
                     /db_xref="CDD:182137"
     misc_feature    complement(219662..219841)
                     /locus_tag="CNE_BB1p02230"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(218981..219574)
                     /locus_tag="CNE_BB1p02230"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators involved in the
                     catabolism of aromatic compounds and that of other related
                     regulators, contains type 2 periplasmic binding fold;
                     Region: PBP2_LTTR_aromatics_like; cd08414"
                     /db_xref="CDD:176106"
     misc_feature    complement(order(219083..219085,219137..219142,
                     219146..219151,219167..219172,219227..219232,
                     219332..219334,219467..219469,219473..219475,
                     219479..219481,219503..219505,219512..219517,
                     219521..219526,219533..219535,219557..219559))
                     /locus_tag="CNE_BB1p02230"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176106"
     misc_feature    complement(order(219236..219238,219257..219262,
                     219404..219406,219554..219556))
                     /locus_tag="CNE_BB1p02230"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176106"
     gene            219956..220885
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /db_xref="GeneID:10915204"
     CDS             219956..220885
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /codon_start=1
                     /transl_table=11
                     /product="protein CsiD"
                     /protein_id="YP_004687686.1"
                     /db_xref="GI:339327994"
                     /db_xref="GeneID:10915204"
                     /translation="MNAPLPAAVLASQDECRFQLSAHPDHHRILHVTVERDALLGFLH
                     DVRKVDVQNLEYVPFMRYELADVLAKHVGEDFATTINKIVKDRQHGGFTVGLQGLTTD
                     ADDFVRFGTAIGHLLGPSNHDSMSGTYYARFVVKHTDNSDSYLRQAYRLFTMHTDGTF
                     VTEATDWLLMMKFAEQNAVGGESRFLHLDDWEGRDRFVSHRLGTQPFLYKAPGSKNVS
                     DKVERPLFFQNEFGLSMSFIDQFVQPRNREEAAFLNDLSTSMEASPGTREVSLPVGDL
                     VVLNNYFYLHGRAPFEKSEALFRELMRQRGTFA"
     misc_feature    219965..220882
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /note="carbon starvation induced protein; Validated;
                     Region: PRK02963"
                     /db_xref="CDD:235092"
     misc_feature    order(220328..220330,220427..220429,220433..220435,
                     220448..220450,220589..220591,220862..220864,
                     220868..220870)
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238154"
     misc_feature    order(220418..220420,220424..220426,220502..220504,
                     220811..220813,220850..220852)
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /note="active site"
                     /db_xref="CDD:238154"
     misc_feature    order(220418..220420,220424..220426,220811..220813)
                     /gene="csiD"
                     /locus_tag="CNE_BB1p02240"
                     /note="iron coordination sites [ion binding]; other site"
                     /db_xref="CDD:238154"
     gene            220949..222223
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /db_xref="GeneID:10915205"
     CDS             220949..222223
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /EC_number="1.1.2.3"
                     /note="cytochrome"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="YP_004687687.1"
                     /db_xref="GI:339327995"
                     /db_xref="GeneID:10915205"
                     /translation="MMTSQTEVARSQAVPGAGTPAKPAYGVNRQLPRRLRPILSLADF
                     EVAAKRVLPRPIFGYIAGAAEDEKSLAANRTAFDEVRFRPKVLVDVSGRSQATEIFGQ
                     RYAAPFGVAPVGISAIAAYRGDVVLAQTAREEQIPAIMSGTSLIPMETVHAAAPGTWF
                     QAYLPGDATRRDALIDRIEAAGFKTLVLTVDIPVWANRENNVRTGFSLPLRPSVRLAF
                     DGVSRPRWLAGTFARTLISSGMPHFENSFASRGAPILSASAIRDTAGRDHLNWTDIER
                     IRKRWRGNLVIKGILHTSDAERAVALGADGIIVSNHGGRQLDGAVEPLAVLPEICEAV
                     AHKITVMMDSGIRRGGDVLKALALGARFVFLGRPFVYAAAIGGAEGIRHAITLLRDEV
                     DRNMAMLGATTIADVNDTVIVQGHGTGRVTSG"
     misc_feature    221072..222175
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="Family of homologous FMN-dependent
                     alpha-hydroxyacid oxidizing enzymes. This family occurs in
                     both prokaryotes and eukaryotes. Members of this family
                     include flavocytochrome b2 (FCB2), glycolate oxidase
                     (GOX), lactate monooxygenase (LMO), mandelate...; Region:
                     alpha_hydroxyacid_oxid_FMN; cd02809"
                     /db_xref="CDD:239203"
     misc_feature    221093..222187
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="FMN-dependent dehydrogenase; Region: FMN_dh;
                     pfam01070"
                     /db_xref="CDD:250340"
     misc_feature    order(221123..221125,221369..221371,221435..221437,
                     221519..221521,221540..221542,221810..221812,
                     221882..221884,221891..221893,222047..222049)
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="active site"
                     /db_xref="CDD:239203"
     misc_feature    order(221123..221125,221435..221437,221540..221542,
                     221882..221884,221891..221893)
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239203"
     misc_feature    order(221369..221371,221435..221437,221519..221521,
                     221810..221812,221882..221884,221891..221893,
                     222047..222049)
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239203"
     misc_feature    order(221435..221437,221540..221542,221882..221884)
                     /gene="lldD"
                     /locus_tag="CNE_BB1p02250"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239203"
     gene            complement(222320..222460)
                     /locus_tag="CNE_BB1p02260"
                     /db_xref="GeneID:10915206"
     CDS             complement(222320..222460)
                     /locus_tag="CNE_BB1p02260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687688.1"
                     /db_xref="GI:339327996"
                     /db_xref="GeneID:10915206"
                     /translation="MYAARGSAYSTPSRNVLTWLRPCARFRLVARCITAQIRRSKGVG
                     SH"
     gene            complement(222574..223554)
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /db_xref="GeneID:10915207"
     CDS             complement(222574..223554)
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase Qor"
                     /protein_id="YP_004687689.1"
                     /db_xref="GI:339327997"
                     /db_xref="GeneID:10915207"
                     /translation="MAKAVKFYETGGPEVLRFEDVGVGEPGPGEVRVRHVAAGLNFAD
                     TYFRSGTYKVPLPSGIGNEAAGVIEAVGAGVTHLAVGDRVTYTGFTNTLGAYSTERLI
                     SADPLIKLPQAISCEIAAAMTMRGLSAAYLMRRIYPFKAGDSILLHAAAGGVGLIVSQ
                     WAKLLGLTVIGTVSTDAKAEVARAHGCDHTINYSHEDVAKRVRELTDGVGVSVVFDSV
                     GKDTFMASLDSLKRRGLLVCVGFASGPVTGFDPAILARKGSLFLTRPGLADYIADPAE
                     KAELVGELFGHVAAGRIHIGINQRYALEDAVQAHRDLESRKTTGSSIFVI"
     misc_feature    complement(222580..223554)
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    complement(222577..223548)
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /note="Quinone oxidoreductase (QOR); Region: QOR2;
                     cd05286"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(222607..222609,222613..222615,
                     222754..222765,222826..222840,222901..222906,
                     222976..222978,223021..223023,223033..223038,
                     223093..223101,223108..223110,223162..223164,
                     223171..223173,223183..223185,223417..223419,
                     223429..223434))
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(222745..222750,222757..222780,
                     222802..222819,222856..222861,223147..223149))
                     /gene="qor1"
                     /locus_tag="CNE_BB1p02270"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            complement(223975..224526)
                     /gene="gno1"
                     /locus_tag="CNE_BB1p02280"
                     /db_xref="GeneID:10915208"
     CDS             complement(223975..224526)
                     /gene="gno1"
                     /locus_tag="CNE_BB1p02280"
                     /EC_number="1.1.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="YP_004687690.1"
                     /db_xref="GI:339327998"
                     /db_xref="GeneID:10915208"
                     /translation="MRLALDDIQQSMPPLWALVNNAGVGGRAALFDVDEKMFDRVFDV
                     NTKAALLMSTAFARRLIDRQLPGRIINICSLAAQTHSPHLGIYGSSKAALEHLTRTMA
                     HEWACHGINVNAISPGYIETDINRAMFQSPAGRKIVEGLPRRRLGTPEALDGALLTLA
                     SPASAFMTGSTLVVDDGQGFSIC"
     misc_feature    complement(224002..>224517)
                     /gene="gno1"
                     /locus_tag="CNE_BB1p02280"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(224158..224163,224167..224178,
                     224254..224256,224266..224268,224305..224313,
                     224395..224397,224458..224466))
                     /gene="gno1"
                     /locus_tag="CNE_BB1p02280"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(224254..224256,224266..224268,
                     224305..224307,224392..224394))
                     /gene="gno1"
                     /locus_tag="CNE_BB1p02280"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(224823..224975)
                     /locus_tag="CNE_BB1p02290"
                     /db_xref="GeneID:10915209"
     CDS             complement(224823..224975)
                     /locus_tag="CNE_BB1p02290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687691.1"
                     /db_xref="GI:339327999"
                     /db_xref="GeneID:10915209"
                     /translation="MEHMISCPAHGLRFDIRNGQCTASPSLRIRTYEVVMEDKQLWLR
                     PPGLNC"
     misc_feature    complement(224844..>224975)
                     /locus_tag="CNE_BB1p02290"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(order(224934..224936,224940..224942,
                     224946..224951,224955..224957))
                     /locus_tag="CNE_BB1p02290"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    complement(order(224940..224942,224946..224948,
                     224955..224957))
                     /locus_tag="CNE_BB1p02290"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            complement(225145..225924)
                     /locus_tag="CNE_BB1p02300"
                     /db_xref="GeneID:10915210"
     CDS             complement(225145..225924)
                     /locus_tag="CNE_BB1p02300"
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA-like thioredoxin"
                     /protein_id="YP_004687692.1"
                     /db_xref="GI:339328000"
                     /db_xref="GeneID:10915210"
                     /translation="MSALGMSVTSTLHPNTAPGRPLRNDCVNCSELSGAVPAPAPSQT
                     LRVDFYLDLICPWCWIGLRNLRSAWASLRQQHPGLALETVCHANALLPQIPAQGIPYQ
                     AFYEARLGGQRAVAMRRAQIRAVAESVDLSLNFESIATFPNSSLACALVNAAQSRLMP
                     EAMYQLVESIYCAFFSQGQDIGSAQTLQALAQASGFSWDARASSALQSSMGADPAEGV
                     PHLVFNGQWPVTGAVPASELVRVMQQAVLTGRLHSECKSNA"
     misc_feature    complement(225196..225786)
                     /locus_tag="CNE_BB1p02300"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(226334..227344)
                     /locus_tag="CNE_BB1p02310"
                     /db_xref="GeneID:10915211"
     CDS             complement(226334..227344)
                     /locus_tag="CNE_BB1p02310"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-containing alcohol dehydrogenase
                     superfamily"
                     /protein_id="YP_004687693.1"
                     /db_xref="GI:339328001"
                     /db_xref="GeneID:10915211"
                     /translation="MTVSKAIYLEPPGGLDRLVPGTVETRPPGPAEITVRIHASSLNY
                     HDFGVVSRGVGPVRCIPMSDGAGVVTEVGAGVKEFSAGDHVVSTFFPTWLDGEPSLSD
                     FATVPGDGIDGFARETVTLPVTAFTHAPAAYSHVEAATLTTAGLTAWRALFVDGALKP
                     GETVLILGTGGVSVFALQFAKAAGATVIATSGSGDKLARLRSLGADHVINYRDDPRWG
                     HTVLTLTGGAGVDHVIEVGGAATLEQSVAAARTGGHVAIIGVLSGADSPFNVRQILRK
                     QLRITGQLVGSRRHQLDMVRALDATGIRPIIDRHFPLDEIADAFRYQAAQRHFGKIVL
                     SI"
     misc_feature    complement(226337..227332)
                     /locus_tag="CNE_BB1p02310"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR7; cd08276"
                     /db_xref="CDD:176237"
     misc_feature    complement(226337..227332)
                     /locus_tag="CNE_BB1p02310"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    complement(order(226490..226498,226568..226573,
                     226628..226630,226634..226639,226712..226714,
                     226757..226759,226769..226774,226826..226843,
                     226904..226906,226916..226918,227201..227203,
                     227210..227218))
                     /locus_tag="CNE_BB1p02310"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176237"
     gene            complement(227404..227571)
                     /locus_tag="CNE_BB1p02320"
                     /db_xref="GeneID:10915212"
     CDS             complement(227404..227571)
                     /locus_tag="CNE_BB1p02320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687694.1"
                     /db_xref="GI:339328002"
                     /db_xref="GeneID:10915212"
                     /translation="MVLPRGNATRLSALPACHLQESDLTIGEVARLMGPSSQNSFGHW
                     FRAAFGCTMTQ"
     misc_feature    complement(227416..>227517)
                     /locus_tag="CNE_BB1p02320"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            complement(227538..228743)
                     /locus_tag="CNE_BB1p02330"
                     /db_xref="GeneID:10915213"
     CDS             complement(227538..228743)
                     /locus_tag="CNE_BB1p02330"
                     /codon_start=1
                     /transl_table=11
                     /product="general substrate transporter"
                     /protein_id="YP_004687695.1"
                     /db_xref="GI:339328003"
                     /db_xref="GeneID:10915213"
                     /translation="MFCLLLSDYMSRQAINALFPLLKVQWQISDTQLGSISSVVPLMV
                     GVLTLPFSILADRWGRVKSIALMVSVWSVATLGCAIAANYHEMFVARLFVGVGEAAYG
                     SVGFAMLVSIFPKHMRSTIAGGFTSAAAFGSVLGVSLSGLIATHLGWRWSMALMAIIG
                     FVLVIIYCSVVTEKKLASVRLDNGNRTPAYGHVKLTPRAFFSGLFPSPSVFCAYLGCA
                     LQIFVQGTLFVWLPSYLNRYWGMPVSEAAVLAAGLVLVSGLGQLLCGVMTDRISGDSL
                     LKRWNMAIGYCLVLGTLLAIAFRMPQGNLQLALLAPGVFFLASSFGTCSAIIAGATPP
                     AIHGSAFATLTLFNNILGLAAGPFITGMAADAVGLQVALRWLPLAAVLPFTVFLIGRW
                     CYLAETRRG"
     misc_feature    complement(227577..228743)
                     /locus_tag="CNE_BB1p02330"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(227640..228719)
                     /locus_tag="CNE_BB1p02330"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(227685..227687,227697..227702,
                     227709..227714,227721..227726,227757..227759,
                     227766..227771,227781..227783,227790..227795,
                     227802..227804,227961..227963,227973..227975,
                     227982..227984,227994..227996,228006..228008,
                     228048..228050,228057..228062,228069..228074,
                     228081..228083,228345..228347,228363..228368,
                     228375..228380,228414..228416,228423..228428,
                     228435..228440,228447..228452,228588..228593,
                     228597..228602,228612..228614,228621..228626,
                     228633..228635,228684..228689,228693..228701,
                     228708..228710))
                     /locus_tag="CNE_BB1p02330"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            228946..229101
                     /locus_tag="CNE_BB1p02340"
                     /db_xref="GeneID:10915214"
     CDS             228946..229101
                     /locus_tag="CNE_BB1p02340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687696.1"
                     /db_xref="GI:339328004"
                     /db_xref="GeneID:10915214"
                     /translation="MVADASCRAMAYRLDFAMHRRTVAEQASQVCLRRKRRATSRQVR
                     EQIAADE"
     gene            complement(229685..230245)
                     /locus_tag="CNE_BB1p02350"
                     /db_xref="GeneID:10915215"
     CDS             complement(229685..230245)
                     /locus_tag="CNE_BB1p02350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687697.1"
                     /db_xref="GI:339328005"
                     /db_xref="GeneID:10915215"
                     /translation="MTATAPTVLIVPGLRDHVPEHWQTLLAAKLPRVVSVAPLEQDKL
                     SCAARVDAIDRALATIEGPVIIVAHSAGAMMVAHWAARGATREILGALLAAPADLETP
                     MPLGYPTTDTLSDHGWLPIPRGPLPFPSIVAASSNDPLTRLDRARDLAQAWGSRFVEL
                     GEVGHLNPASGYGEWPRAEAFIRELS"
     misc_feature    complement(229751..230227)
                     /locus_tag="CNE_BB1p02350"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     misc_feature    complement(229718..230224)
                     /locus_tag="CNE_BB1p02350"
                     /note="Serine hydrolase; Region: Ser_hydrolase; pfam06821"
                     /db_xref="CDD:253928"
     gene            complement(230255..231166)
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /db_xref="GeneID:10915216"
     CDS             complement(230255..231166)
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /EC_number="1.14.11.17"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate-dependent taurine
                     dioxygenase TauD"
                     /protein_id="YP_004687698.1"
                     /db_xref="GI:339328006"
                     /db_xref="GeneID:10915216"
                     /translation="MIQRLKAAPAVVRATSLGNSIQVEQVTCTIGAELSNVNLGAAAE
                     DDQQMAEIRALLLKHRVLFFRDQDITRAQHVAFARRFGELEDHPVVGSHPDYPGLVQI
                     YKTPDSPPDRNENSWHTDATWREKPPLGCVLRCIECPPVGGDTMWVNMVEAYNQLPEE
                     IKTKIAALRARHGIEASFGAAMPIEKRLALKAQFPDAEHPVVRTHPETGEKILFVNGS
                     FTTHFTNYNVPANVRFGIDKAPGAANLLSYLVSQATIPEYQVRFRWKKNSVAFWDNRS
                     TQHYAVMDYPPCHRKMERTAIIGDAPY"
     misc_feature    complement(230258..231112)
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
                     trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
                     carrying out three reactions in the biosynthesis of
                     clavulanic acid, an inhibitor of class A serine
                     beta-lactamases. In general, Fe(II)-2OG oxygenases...;
                     Region: CAS_like; cl00184"
                     /db_xref="CDD:260242"
     misc_feature    complement(230258..231106)
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /note="Probable taurine catabolism dioxygenase [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: TauD; COG2175"
                     /db_xref="CDD:225086"
     misc_feature    complement(order(230330..230332,230732..230734,
                     230807..230809,230813..230815))
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /note="active site"
                     /db_xref="CDD:238154"
     misc_feature    complement(order(230330..230332,230807..230809,
                     230813..230815))
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /note="iron coordination sites [ion binding]; other site"
                     /db_xref="CDD:238154"
     misc_feature    complement(order(230642..230644,230783..230785,
                     230798..230800,230804..230806))
                     /gene="tauD1"
                     /locus_tag="CNE_BB1p02360"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238154"
     gene            complement(231388..231546)
                     /locus_tag="CNE_BB1p02370"
                     /db_xref="GeneID:10915217"
     CDS             complement(231388..231546)
                     /locus_tag="CNE_BB1p02370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687699.1"
                     /db_xref="GI:339328007"
                     /db_xref="GeneID:10915217"
                     /translation="MVRYLSEVSRKHAEIALLLGFSGPSSFSLSRWFRHEFGYKVQDW
                     TGGSTPSV"
     misc_feature    complement(231433..>231510)
                     /locus_tag="CNE_BB1p02370"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            complement(231567..232340)
                     /locus_tag="CNE_BB1p02380"
                     /db_xref="GeneID:10915218"
     CDS             complement(231567..232340)
                     /locus_tag="CNE_BB1p02380"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004687700.1"
                     /db_xref="GI:339328008"
                     /db_xref="GeneID:10915218"
                     /translation="MAAPLPSPLERLQLPPALSGAAGSKKLGRGHRDWRPFAGPLSPA
                     SVRHALVILNALFAWLTEAGYLAGNPLALARRRRAPNRPRITRYLSHDLWDAVKETVA
                     AMPVATERERLHPARCRWVQTVLYPGGLRAAEVTGTPMGTFWTRTSGVLHFSTHLLRQ
                     SLFSHRVELGAAFNGIVFFQSHLQTPLSTYSSLDQYARQYVESVSARSGQTADEKVRQ
                     MIVALMPSGECSLARIAGLLGVDVRTIRRRLGARRTTSF"
     gene            232508..233188
                     /locus_tag="CNE_BB1p02390"
                     /db_xref="GeneID:10915219"
     CDS             232508..233188
                     /locus_tag="CNE_BB1p02390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687701.1"
                     /db_xref="GI:339328009"
                     /db_xref="GeneID:10915219"
                     /translation="MRKGSKRQAHAATQARLEAGRAEKAAGRQLTELRTQFSTGLERA
                     REHVTIAQERAEASERRALRGLDAERTARQKSERAAEELRGELAAARQEARDSAVAQA
                     EVRARLEAQAAALAERLNERLAAAEAAQRQAAGERDAAQTELAAAQRRAERAEAEAVL
                     ARQLLAELRLPREQERRHKFGGPASTDSEAPDEKPADEHGAPTGSNPEDGSDSSDRND
                     NENDDSKN"
     gene            233172..233462
                     /locus_tag="CNE_BB1p02400"
                     /db_xref="GeneID:10915220"
     CDS             233172..233462
                     /locus_tag="CNE_BB1p02400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687702.1"
                     /db_xref="GI:339328010"
                     /db_xref="GeneID:10915220"
                     /translation="MTAKIERAAAVRWIQDRMADYDLTMEKLRAAGCFDRPPPTTAAG
                     AGAARTPASAASAAAGGLLPQRRGPSWDGAGEMPDWLRRAVNAGQSAEFYRV"
     misc_feature    <233373..233459
                     /locus_tag="CNE_BB1p02400"
                     /note="DNA-binding protein H-NS [General function
                     prediction only]; Region: Hns; COG2916"
                     /db_xref="CDD:225468"
     gene            233722..234873
                     /locus_tag="CNE_BB1p02410"
                     /db_xref="GeneID:10915221"
     CDS             233722..234873
                     /locus_tag="CNE_BB1p02410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687703.1"
                     /db_xref="GI:339328011"
                     /db_xref="GeneID:10915221"
                     /translation="MEFFRREELATNLAKKVLEVSPTSASSSGLFLAAPRRTGKSTFL
                     REDLRPALEKEGALVLYVDLWEDRSADPGETIVHMVRAELAKHEGVITRLARSAGMEK
                     VAVGGLSFSLDRIGLGDGISLSTALAELSDEVKRPIALVIDEAQQAIASEKGNDALFA
                     LKAARDELNSSRHFGLRVVATGSNRDKLAMLRAGRDQAFMGAPLINFPTLGMDYVQWF
                     CHRLNLGAPLDPARVYELFKRASFRPELLGAAADAVRFEFGLPPDQVSTRFAEAIDEQ
                     IAESEREQLRVVHNLTPPQSTVLRVMAVRGEKFAPFEAATIESYNAVLQATSPNVDAK
                     IDVSGAQQALAALQEKALVWRAARGVYALEETGLATLMASAGMLDDVPR"
     misc_feature    233722..>234243
                     /locus_tag="CNE_BB1p02410"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1672"
                     /db_xref="CDD:224586"
     misc_feature    233728..>234270
                     /locus_tag="CNE_BB1p02410"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            235074..235292
                     /locus_tag="CNE_BB1p02420"
                     /db_xref="GeneID:10915222"
     CDS             235074..235292
                     /locus_tag="CNE_BB1p02420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687704.1"
                     /db_xref="GI:339328012"
                     /db_xref="GeneID:10915222"
                     /translation="MPIDQAARHCGVSIGMLSKLENGKGVNLERALRVMDGLGLTMLV
                     VPKTHAPWLEQAAAHALKTGELAAWEQP"
     misc_feature    <235080..235199
                     /locus_tag="CNE_BB1p02420"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(235080..235085,235116..235118,235125..235127,
                     235137..235142)
                     /locus_tag="CNE_BB1p02420"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    235134..235136
                     /locus_tag="CNE_BB1p02420"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     gene            235438..236463
                     /locus_tag="CNE_BB1p02430"
                     /db_xref="GeneID:10915223"
     CDS             235438..236463
                     /locus_tag="CNE_BB1p02430"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma54 specific transcriptional regulator Fis
                     family"
                     /protein_id="YP_004687705.1"
                     /db_xref="GI:339328013"
                     /db_xref="GeneID:10915223"
                     /translation="MNAPLQLVGDHPSIAALRDLIARVAASQARTVLLYGETGTGKSL
                     VARMLHQQSSRAWAEFIDINCAAIPAQLLESELFGHERGAFTGAVGKKEGLIEAGNGG
                     TVFLDEVRELDLVMQSKLLTLLDTRRFRRVGAVKPISVDVRFIAATNKILLSEVNAGK
                     FREDLYYRLQVIAINIPPLRERGDDILLLAHSALHRYNLQYGSRMEQLDPEVERIFRA
                     YPWPGNVRELENLLERICLLEQGDCVLPVHLPARILRAVGVMAAAPADPADAAATVVE
                     VNASLATAATDDGLDYYSATARFQAELIEQTLAACKGNVARAAQRLGLSRHALRHQMI
                     KLGLASN"
     misc_feature    235456..236442
                     /locus_tag="CNE_BB1p02430"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    235483..235971
                     /locus_tag="CNE_BB1p02430"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    235543..235566
                     /locus_tag="CNE_BB1p02430"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(235546..235569,235756..235758,235882..235884)
                     /locus_tag="CNE_BB1p02430"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    235744..235761
                     /locus_tag="CNE_BB1p02430"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    235939..235941
                     /locus_tag="CNE_BB1p02430"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    236332..236445
                     /locus_tag="CNE_BB1p02430"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            236668..238029
                     /locus_tag="CNE_BB1p02440"
                     /db_xref="GeneID:10915224"
     CDS             236668..238029
                     /locus_tag="CNE_BB1p02440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687706.1"
                     /db_xref="GI:339328014"
                     /db_xref="GeneID:10915224"
                     /translation="MQSLKIICPNGHLGFAPLRTGSFEIGVAAGPDYIAADSGSDDVG
                     PVPLGSDTSTSPEAWQRHDLEHMLLASRRLGVPMIIGSAGDTGTNSRVDLYVNIIREL
                     AQKHGLKRFRIGYFYSEVPKSLLREKLGAGETIRGLDGFADLTLSELDGTDRIVAMAG
                     VHPYLELLAQGADVIIGGRSSDAAVFAAPALHHGFAADHAYYLGKVLECASFCAEPYG
                     GKETVLGEISRDAVRVTAMHPEQRCTVASVAGHAMYERSNPFEEFVAGGRLDMSQCHY
                     EQVDPRTTRITGSRFEPDEVIRVKLEGSGKVGERYVGLCGIRDPYTIANVDRVIAWAK
                     DQVRARFGETGYELHYNVYGRDGVMGELEPLRDRPGHELCVMVQGVAPTREMAEEVAM
                     IGLRQMFYARLPDVKGTAGSVSFPLDEVLHASSAYRWTLNHTVEVHDPLALFPTHLVE
                     AGV"
     misc_feature    236707..237729
                     /locus_tag="CNE_BB1p02440"
                     /note="Protein of unknown function (DUF1446); Region:
                     DUF1446; pfam07287"
                     /db_xref="CDD:254140"
     misc_feature    <237766..237960
                     /locus_tag="CNE_BB1p02440"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Csb3; Region: Csb3_I-U; cd09764"
                     /db_xref="CDD:187733"
     gene            238058..238411
                     /locus_tag="CNE_BB1p02450"
                     /db_xref="GeneID:10915225"
     CDS             238058..238411
                     /locus_tag="CNE_BB1p02450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687707.1"
                     /db_xref="GI:339328015"
                     /db_xref="GeneID:10915225"
                     /translation="MTTANPSAPSLAPTQKLHELAKTIRSKNAGVNKITFDVIFREAA
                     QYERVKRSRVLSRESMAALFHVPVERISDFVEYDPAFAIKFTMYRKRPSGSAGDGDIF
                     GAQQYAPLLELEIPA"
     misc_feature    238106..238402
                     /locus_tag="CNE_BB1p02450"
                     /note="Domain of unknown function (DUF4387); Region:
                     DUF4387; pfam14330"
                     /db_xref="CDD:206498"
     gene            238531..239577
                     /locus_tag="CNE_BB1p02460"
                     /db_xref="GeneID:10915226"
     CDS             238531..239577
                     /locus_tag="CNE_BB1p02460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687708.1"
                     /db_xref="GI:339328016"
                     /db_xref="GeneID:10915226"
                     /translation="MNSDPHMDKTFLKRIWTLLARSLPGTVILATLAVAPWPAGAARA
                     QSATAVPPLMRIVVPFSAGASNDVIARAIAPALAKRLGNTVIVENRPGVAGVLGADYV
                     AKAPRDGSVLLLTSSTFLTAAATQARSPYDPLSAFAPVALVADGPLLLAVSSTIASSK
                     SIHTPVDLIAAARAKPGTITYGSAGVGSLGQLATELMCDTAKVQMMHVPYKGAANALI
                     DLAAGQIDVMMSNYSSIATQIKAGKVKPLAVTSVTPNPAFPGLPPLAASVPGYGIEIW
                     VGVLAPAGTPAALVQRLNREIAEIAASHDVRVVLEPDGSHPLAASPAEFGVRIRQDLA
                     QWKRIAADRKIVAE"
     misc_feature    238735..239547
                     /locus_tag="CNE_BB1p02460"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(240252..242228)
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /db_xref="GeneID:10915227"
     CDS             complement(240252..242228)
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /EC_number="4.2.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_004687709.1"
                     /db_xref="GI:339328017"
                     /db_xref="GeneID:10915227"
                     /translation="MNVLEPNGRVLYLVHSTAAMEKQLQGERLTPADCEPLRNDVSTD
                     EITPVPILTHYDDALGRYPYTGYKVGATLPFKPDSVRQGKFYITVAGNRYGKGSSREH
                     SPAAEKLAGIRLVIAKSFERIYRQNADNIGLYTSTDFSLVPRLEAGEAIPLDELVGGR
                     DALAASILKHGGLLKFGQQYLTNVTPAAKVDAQRPQTLFEKIVRRNLLATPVTSSDPK
                     PGDGIFVQAHWRFIHEYYTGMCAHMLHATFGKPVKLKHADHIVVFEDHTSYVTESPAH
                     VRNGLVENVVQMRFAQRDFVKTYGLTFHRTLTDEELSKDDGNNVAGISHAMMAEQYAL
                     PGQVVVGTDSHTPHSGALGCVAFGVGTTDMANAFVTGAVRMTLPESIRVHLGGKLQAG
                     VTAKDVVLQLLAQPAIKAGAGVGKVFEFAGPVVSAMSVDERATLTNMCAELGGFTGIV
                     APDAETVRFLLERRGVEFQLEPWMHSDEGAKYAANLEVDCSVLSPMVARPGDPGNGLP
                     LATLDETVKVDIAYGGSCTAGKREDFDQYHAVFQWAAERGLRIPEHVTLYLQFGTTDV
                     RDYCQNKGYLKAFEAVGARILQPSCGACANCGPGSSTSPEQVTVSSINRNFPGRSGPG
                     QVWLASPPTVAASAIAGKLVSFKELQLNQPASSH"
     misc_feature    complement(241701..242114)
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /note="Aconitase swivel domain. Aconitase (aconitate
                     hydratase) catalyzes the reversible isomerization of
                     citrate and isocitrate as part of the TCA cycle. This is
                     the aconitase swivel domain, which undergoes swivelling
                     conformational change in the enzyme...; Region:
                     Aconitase_swivel; cl00215"
                     /db_xref="CDD:260268"
     misc_feature    complement(241929..241937)
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238236"
     misc_feature    complement(240300..241472)
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /note="Aconitase catalytic domain; Aconitase catalyzes the
                     reversible isomerization of citrate and isocitrate as part
                     of the TCA cycle; Region: Aconitase; cl00285"
                     /db_xref="CDD:260326"
     misc_feature    complement(order(240369..240371,240384..240386,
                     240444..240446,241197..241202))
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153129"
     misc_feature    complement(order(240387..240389,240444..240449,
                     240456..240458,240651..240653,241194..241196))
                     /gene="leuC"
                     /locus_tag="CNE_BB1p02470"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153129"
     gene            242340..243269
                     /locus_tag="CNE_BB1p02480"
                     /db_xref="GeneID:10915228"
     CDS             242340..243269
                     /locus_tag="CNE_BB1p02480"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687710.1"
                     /db_xref="GI:339328018"
                     /db_xref="GeneID:10915228"
                     /translation="MHGCPTLHLRSQTMHRIDPVSIQLFLSVAREGSIKRAAELEHIA
                     QSALSRRIAELERNLGVGLFIRSTTGVALTDAGERALELGRKLNADIVAFTREVQDLG
                     DKVAGVVRLSASPSAIIGFLPERLHGFKQAHPLVEIALFERSTSESIRACLDDVVDVG
                     IGVAANAPPGLESWPFAIDPLNVVVPVNHSLAKRKRLRYAEILDHPLVVVQPGGALAQ
                     ELREQATNLRVPFNQSVAVSSFEAGCRMVEAGLGIAVLPNSASAAYAGSDRFVRIPLQ
                     ETWSNRRLLIYAPYKNPRLRAVSALVEALKQQG"
     misc_feature    242403..243263
                     /locus_tag="CNE_BB1p02480"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    242403..242573
                     /locus_tag="CNE_BB1p02480"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    242664..243254
                     /locus_tag="CNE_BB1p02480"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(242706..242711,242715..242720,242727..242729,
                     242739..242741,242745..242765,243039..243056,
                     243072..243077,243081..243086)
                     /locus_tag="CNE_BB1p02480"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            243398..244378
                     /locus_tag="CNE_BB1p02490"
                     /db_xref="GeneID:10915229"
     CDS             243398..244378
                     /locus_tag="CNE_BB1p02490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687711.1"
                     /db_xref="GI:339328019"
                     /db_xref="GeneID:10915229"
                     /translation="MPISLLKQVRNAFVVVTSCALVTGIFSPVTAQTPIRLIVPTQAG
                     SQADAVARAMSQSLSKNLGHSVVIENLPGAGGVPGTQQLVRAPKDGSTLGLISSNHVI
                     NPFIYKNVPYDALKDITPITVIGTLPLVLVVNPSVRANNTKELIAVLKSNPGEYNYGS
                     SGNGTVLHLAGQLFASEAKVNVSHVPYKGAGNYTTDLVGGQVQFGFLTLQTVLPLVKS
                     GKLKAIAVSTARRVPGLPDVPTLAESGLPQYNFDAWLAIVGPAGMQPQNVTQLQSKIK
                     TTLQEKDVQEQLAQQGVIISTSSAEGAPSFFKAELDKHAKIVKQAGATLN"
     misc_feature    243545..244366
                     /locus_tag="CNE_BB1p02490"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(244957..245739)
                     /locus_tag="CNE_BB1p02500"
                     /db_xref="GeneID:10915230"
     CDS             complement(244957..245739)
                     /locus_tag="CNE_BB1p02500"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004687712.1"
                     /db_xref="GI:339328020"
                     /db_xref="GeneID:10915230"
                     /translation="MLQLGKPLSSLTHEDLLIYERFLVDPQPAARWVLASSKKLARGH
                     FDWRPFAGPLSPASVRHALVILNALFAWLTEAGYLAGNPLALARRRRAPTQPRITRYL
                     NHELWDPVKDAVAAMPRMTDTATARERLHAARCRWLLSVLYLGGLRAAEVTGTAMGAF
                     FCRRDAQGVERWWLEVTGKGDKTGLVPATDELVAELARYRRAHGLAPTPRPGETRPLL
                     LPVIGRKDRQHDEKGLSRGALHLILKEVFGLAAARLRARGPE"
     misc_feature    complement(<244960..245439)
                     /locus_tag="CNE_BB1p02500"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     gene            246030..246416
                     /gene="tnpA2"
                     /locus_tag="CNE_BB1p02510"
                     /db_xref="GeneID:10915231"
     CDS             246030..246416
                     /gene="tnpA2"
                     /locus_tag="CNE_BB1p02510"
                     /codon_start=1
                     /transl_table=11
                     /product="ISJP4 transposase TnpA"
                     /protein_id="YP_004687713.1"
                     /db_xref="GI:339328021"
                     /db_xref="GeneID:10915231"
                     /translation="MGWLLLRVSKRRAIGRRPAFGAIARATAGEVTRGRRARFLPSSR
                     RFIVGASRWGGRKTGPNPTDRSRPGSKHHILVDAMRPHHVLMRGFNFRCLRIRFERRA
                     DIHEAFLKLGCSLVCWNIFRRAEPSF"
     gene            complement(247060..248655)
                     /gene="tanA"
                     /locus_tag="CNE_BB1p02520"
                     /db_xref="GeneID:10915232"
     CDS             complement(247060..248655)
                     /gene="tanA"
                     /locus_tag="CNE_BB1p02520"
                     /codon_start=1
                     /transl_table=11
                     /product="tannase and feruloyl esterase alpha/beta
                     hydrolase family"
                     /protein_id="YP_004687714.1"
                     /db_xref="GI:339328022"
                     /db_xref="GeneID:10915232"
                     /translation="MTFARNTFAGLLDRSQKSRQAINPRTLTRSTLILTATAVLLASC
                     GGGDSPPKTAEAACNELLNQEFEGARITRATLAPARGNVPESCVIRGEMPKELAFEVR
                     MPTTWNHRVLFMGGGGFDGAIYQSAYSPGVAESGYATIATNHGHDGEKHPQGSFALDP
                     QLLQDYADGAVPKVLASAKAILRKRYGDSISNSKFVYEGCSGGGRQALIQAQRHPDLF
                     DGIIARAPANAYTGQFLWYQKILKQMAKPGAGLSVGKVRTIAKFSQAQCDELDGLKDN
                     IISRPASCNVDLTALRCTGAESDSCLTDAQLESAKALYEPTSVAGGRYTWAAFPHVGG
                     ETADDSSWQALGGTTYQILGSDYMRYFVAQDPSVDPLNVDPQQYTTRLDYLANLIDAV
                     NPDLSKFSARGGKLILFHGTTDWLITLNNTTEYYNKVVASAGGQPAADRFVEYFVLPG
                     NDHCAATPNGGNGPDMVDLVSPMFEWIEKGAKPSSRKIVATRSVEPGTGMQRPLCKYP
                     QYPKYNGTGDPNAETSFTCVSAE"
     misc_feature    complement(247072..248370)
                     /gene="tanA"
                     /locus_tag="CNE_BB1p02520"
                     /note="Tannase and feruloyl esterase; Region: Tannase;
                     pfam07519"
                     /db_xref="CDD:254255"
     gene            complement(249048..250736)
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /db_xref="GeneID:10915233"
     CDS             complement(249048..250736)
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /EC_number="6.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="medium-chain-fatty-acid--CoA ligase AlkK"
                     /protein_id="YP_004687715.1"
                     /db_xref="GI:339328023"
                     /db_xref="GeneID:10915233"
                     /translation="MNANIYQTRLERNAANHVPLTPLQFLDRCAEQYPERTAIVHGGL
                     RQSWRTTRDRCRRLASALVKRGVRGGDTVSILAPNTPAMVEAHHGVPLSGAVLNAINC
                     RLDAEGVRFILAHGEARILLVDSEFAALAATALQGLDNPPLVVDILDTEGPTGTRLGA
                     LDYEQLLSEGDVDFGGIWPDDEWDAIALNYTSGTTSDPKGVVPSHRGAYLMSMLQLTD
                     WGMPRAPRYLWTLPMFHANGWCFAWAITAAAGTHVCLRKVTAENIFHAIDAHKVNHFC
                     AAPIVLASLATASESERRLFSHAVRVRTAGSPPPASVLKAVMEMGFDVEHVYGITEAS
                     GTPVSSYRDPAWDDKPIEEKARLMSRQGNRAAALEGLRVADPDTMEPVPCDGKTQGEL
                     LLRGNIVMKGYLKNPQATVAAFSGGWFHTGDVAVMHPDGYIQITDRSKDVIISGGENI
                     SSVEVEDVLHRHPAVLIAAVVAQPHPKWGESPCAFIELKPGVDAPTEKEIIDFCRDRL
                     AHYKCPVRVVYGPLPKTGTGKIQKYRLRELAKSREAITEIDGQRRTRGSLHRLG"
     misc_feature    complement(249096..250727)
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="acyl-CoA synthetase; Validated; Region: PRK08162"
                     /db_xref="CDD:236169"
     misc_feature    complement(249126..250688)
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="Fatty acyl-CoA synthetases similar to LC-FACS from
                     Thermus thermophiles and Arabidopsis; Region:
                     ttLC_FACS_AEE21_like; cd12118"
                     /db_xref="CDD:213326"
     misc_feature    complement(order(250140..250145,250149..250166,
                     250173..250175))
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213326"
     misc_feature    complement(order(249204..249206,249390..249401,
                     249423..249425,249432..249434,249468..249470,
                     249744..249761,249819..249824,249885..249887,
                     249894..249899,249903..249905,250041..250046,
                     250164..250166))
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="putative active site [active]"
                     /db_xref="CDD:213326"
     misc_feature    complement(order(249390..249392,249405..249407,
                     249417..249419,249423..249425,249468..249470,
                     249744..249761,249813..249821,250164..250166))
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213326"
     misc_feature    complement(order(249204..249206,249222..249224,
                     249393..249401,249822..249824,249885..249887,
                     249894..249899,250044..250046))
                     /gene="alkK1"
                     /locus_tag="CNE_BB1p02530"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213326"
     gene            250974..251693
                     /locus_tag="CNE_BB1p02540"
                     /db_xref="GeneID:10915234"
     CDS             250974..251693
                     /locus_tag="CNE_BB1p02540"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="YP_004687716.1"
                     /db_xref="GI:339328024"
                     /db_xref="GeneID:10915234"
                     /translation="MNRVAPPPAELQSVREAVEWAIVTRRSVRAFRPQPVDVETVHKI
                     LDVARFAATGVNIQPWQVHVVTGQARDRICAAIKQVDDDPAQSGAHSDEWAYYPDKWV
                     APYLDRRREVGWRLYGLLGIEKGNKARMHAQHGRNYQFFDAPVGLFFTVDRLMNEGSL
                     IDYGMFLQNLMVVARTYGLSTCPQAAFMKYHAIIRRELSLGAEEKFLVGMSLGYADDE
                     RVENQLVSDRAPASSFTVVHT"
     misc_feature    251025..251678
                     /locus_tag="CNE_BB1p02540"
                     /note="Nitroreductase family. Members of this family
                     utilize FMN as a cofactor and catalyze reduction of a
                     variety of nitroaromatic compounds, including nitrofurans,
                     nitrobenzens, nitrophenol, nitrobenzoate and quinones by
                     using either NADH or NADPH as a source...; Region:
                     Nitroreductase; cd02136"
                     /db_xref="CDD:239051"
     misc_feature    order(251046..251048,251052..251054,251058..251060,
                     251136..251138,251526..251531)
                     /locus_tag="CNE_BB1p02540"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239051"
     gene            251751..253136
                     /gene="benK"
                     /locus_tag="CNE_BB1p02550"
                     /db_xref="GeneID:10915235"
     CDS             251751..253136
                     /gene="benK"
                     /locus_tag="CNE_BB1p02550"
                     /codon_start=1
                     /transl_table=11
                     /product="benzoate transport protein BenK"
                     /protein_id="YP_004687717.1"
                     /db_xref="GI:339328025"
                     /db_xref="GeneID:10915235"
                     /translation="MKTEINVHKLAEDARFSRFHAGILFWCVAILILDGYDLAVVGAA
                     LPSIMKEMRVDATKAGFMASSALFGMMVGAIYLGTMAERIGRKLSICICVALFSLFTA
                     AAGLTTDPVTFSATRFLAGLGIGGVLPVVTAQMGEFAPSRMRARLVTLVFAGYSIGGI
                     LVALTGKQLIGTYGWQAVFFVAGLPIFFIPFILWTMPESLAFLAKKGRHAELERVARR
                     LAPALKQGERYQFFVPSEALASNAPVAALFSQGRALSTLMIWVAFFTGLFMVYALSSW
                     LTKLMALSGYSLGSALNFVLVFNIGAVCGAIGGGWLGDRFNIKHVLVAFYATGAVSLA
                     LMGHTKSTELLFVLVFVVGASTLGTQLLAYAYAGEFYPGPIRSTGVGFASGIGRLGAI
                     IAPVLIGTLVGMKLPLEQNFLAIGVAGLVGTLAVILVDHRKSAAARQSPGQVVSQEPL
                     APVAAHQPTNH"
     misc_feature    251766..252956
                     /gene="benK"
                     /locus_tag="CNE_BB1p02550"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    251820..253037
                     /gene="benK"
                     /locus_tag="CNE_BB1p02550"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(251862..251864,251871..251879,251883..251888,
                     251937..251939,251946..251951,251958..251960,
                     251970..251975,251979..251984,252120..252125,
                     252132..252137,252144..252149,252156..252158,
                     252192..252197,252204..252209,252225..252227,
                     252549..252551,252558..252563,252570..252575,
                     252582..252584,252621..252623,252633..252635,
                     252645..252647,252654..252656,252666..252668,
                     252807..252809,252816..252821,252828..252830,
                     252840..252845,252852..252854,252885..252890,
                     252897..252902,252909..252914,252921..252923)
                     /gene="benK"
                     /locus_tag="CNE_BB1p02550"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            253157..253915
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /db_xref="GeneID:10915236"
     CDS             253157..253915
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687718.1"
                     /db_xref="GI:339328026"
                     /db_xref="GeneID:10915236"
                     /translation="MNISGNVFIVTGGGSGLGAATVKVLAQQGAIVVIVDLDATKGQA
                     IAKDTGGVFWRTDVSDEASVKEMYAFACGLGKLRGLVNCAGIAPAEKIIGKSGIHAMS
                     SFMRTMQINVGGTFNLLRLAADIMASQDPVETGERGVIINTASIAAFDGQIGQTAYAA
                     SKGAIVSMTLPLARELARFGIRVMTIAPGIMETPMLLAMPPEVQKALGDAVPFPPRMG
                     KPDEFAGLVEYILGNAYLNGDVIRLDGAIRMPPK"
     misc_feature    253157..253903
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK08217"
                     /db_xref="CDD:181297"
     misc_feature    253169..253909
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(253190..253192,253196..253201,253205..253207,
                     253262..253270,253403..253411,253583..253591,
                     253628..253630,253640..253642,253718..253729)
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(253487..253489,253589..253591,253628..253630,
                     253640..253642)
                     /gene="fabG5"
                     /locus_tag="CNE_BB1p02560"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            253929..255128
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /db_xref="GeneID:10915237"
     CDS             253929..255128
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="YP_004687719.1"
                     /db_xref="GI:339328027"
                     /db_xref="GeneID:10915237"
                     /translation="MTTKDPIVIASAARTPIGGFQGALSSLGAPDLGGAAIRAAVERS
                     GIANDAVQEVLMGCVLPAGVGQAPARQASINGGLPLSAACTTVSKVCGSGMKAVMLAH
                     DLLAAGTNDMMVAGGMESMSNAPYLLPKARSGYRLGHGTMLDHMFFDGLEDRYSPETR
                     GRLMGTFAEDCAGAYQFSREAQDEWAVLSTQRAQAAIRDGSFAWETASIPIVDRKGAT
                     SVVADDEQPLKANVDKIASLKPAFRKDGTVTAANSSSISDGAAALVLTKASIAESLGL
                     SPIARVVGHATHAQAPAKFATAPVGAIGKLLNCIGWDTDSVDLWEINEAFAVVTMAAI
                     RDLSLDLARVNFHGGACALGHPIGASGARILVTLLGALRKTRGRRGVASLCIGGGEAT
                     AMAVEML"
     misc_feature    253932..255125
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06954"
                     /db_xref="CDD:180775"
     misc_feature    253950..255119
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(254004..254006,254085..254087,254127..254129,
                     254136..254138,254148..254150,254181..254192,
                     254214..254216,254235..254240,254247..254249,
                     254292..254294,254781..254783,254787..254789,
                     254793..254795,254853..254855,255090..255095)
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(254199..254201,254991..254993,255081..255083)
                     /gene="thlA"
                     /locus_tag="CNE_BB1p02570"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(255187..255945)
                     /locus_tag="CNE_BB1p02580"
                     /db_xref="GeneID:10915238"
     CDS             complement(255187..255945)
                     /locus_tag="CNE_BB1p02580"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="YP_004687720.1"
                     /db_xref="GI:339328028"
                     /db_xref="GeneID:10915238"
                     /translation="MRTISYAEASSAVHVHTLYGSTRSRHRTLEDFLQASSWFAILTD
                     EEKARVKIETFERYCAAGGMACHRGDPADHWLGVIEGIIKVDTASACGRAVTFAGVPA
                     GSWFGEGAVLKSEMRPYSVVAIKDSRIAYVPRETFLWLLGRNHGFSRYVIDQLNARCG
                     YYVGLVHNFRLHEAAARVAFCVAELFHRQLYPATERTLALSQEELGRLSGLSRQNTNR
                     ALRELAKAGMIEMEYGAIVVIDLDGLRRYAHIGD"
     misc_feature    complement(255226..255852)
                     /locus_tag="CNE_BB1p02580"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(255490..255834)
                     /locus_tag="CNE_BB1p02580"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(255589..255597,255622..255627))
                     /locus_tag="CNE_BB1p02580"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(255505..255513,255523..255531))
                     /locus_tag="CNE_BB1p02580"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(255412..255417)
                     /locus_tag="CNE_BB1p02580"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(255205..>255357)
                     /locus_tag="CNE_BB1p02580"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(order(255310..255312,255337..255345,
                     255349..255351))
                     /locus_tag="CNE_BB1p02580"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(255292..255312)
                     /locus_tag="CNE_BB1p02580"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(255292..255294,255304..255309))
                     /locus_tag="CNE_BB1p02580"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(255304..255309)
                     /locus_tag="CNE_BB1p02580"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            complement(255977..257659)
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /db_xref="GeneID:10915239"
     CDS             complement(255977..257659)
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A synthetase AcsA"
                     /protein_id="YP_004687721.1"
                     /db_xref="GI:339328029"
                     /db_xref="GeneID:10915239"
                     /translation="MEILSPLAELGERVSELIDHYADSSASLAWMLCDRHDPASVAYD
                     IVDANLRVERLTYGELRVQSEAFAAGLLDLGVRSGDRVATLAGKSLEYLVALLGIWRI
                     GAVHVPLFTAFAPPAVALRLEGSGARVVVCDASQRSKLSSSEDGEPAPRYDIVVISDD
                     ELSLEEPALHRYQDVLKAGHRVSPAALGGDAPFIHIYTSGTTGKPKGVVVPSRAIAAF
                     HAYVEFGIGLRADDVYWCAADPGWAYGLYFGVVGSLCTGVQSVFQKGGFDPALTYDVL
                     RQCGVTNFAAAPTVFRSLMCADVTAPAGLHLRSASSAGEPLTPDVNEWAAQALGVSVY
                     DHYGQTEAGMLINNHHDPRLVRPIQSGCMGISMPGWKAVVLDRTEDVEVPPGTVGRIA
                     FKLADSPLAWFAGYDGLPEKSAEKFSRDGQYYLSGDLARADETGAFFFSSREDDVIIM
                     AGYRIGPFEVESVLTAHPAVAECAVIAVPDKVRGEVIEAYVVLRPGFEATDEAAVELQ
                     QWVKTRYAAHAYPRRVTFISELPKTPSGKVQRFVLREARKNADLDGKGDEKH"
     misc_feature    complement(256001..257560)
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid
                     ligases [Lipid metabolism]; Region: Acs; COG0365"
                     /db_xref="CDD:223442"
     misc_feature    complement(256025..257497)
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(257042..257047,257051..257068,
                     257075..257077))
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(256049..256051,256298..256300,
                     256331..256333,256340..256342,256376..256378,
                     256640..256657,256718..256723,257066..257068))
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(256106..256108,256298..256309,
                     256331..256333,256340..256342,256376..256378,
                     256640..256657,256718..256723,256781..256783,
                     256790..256795,256799..256801,256943..256948,
                     257066..257068))
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(256106..256108,256124..256126,
                     256301..256309,256721..256723,256781..256783,
                     256790..256795,256946..256948))
                     /gene="acsA1"
                     /locus_tag="CNE_BB1p02590"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(257874..258518)
                     /locus_tag="CNE_BB1p02600"
                     /db_xref="GeneID:10915240"
     CDS             complement(257874..258518)
                     /locus_tag="CNE_BB1p02600"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687722.1"
                     /db_xref="GI:339328030"
                     /db_xref="GeneID:10915240"
                     /translation="MHDLLTSPRVRLRRRGADKHPLILKAARTLIAQSGFREAQMTAI
                     AEAAGLAIGTLYRYFPSKTELLVEVVKFTAQREVDVVAGIAMRDGTACDRLGIAAWTF
                     ASRALRGRRLAHALVAEPVEPEVEAARLTYHRALSRVFRTIIEQGIAAGEFPEQDSTA
                     SADCIVGCLFEGLVAPLSSEAALAGVPMQSQATSIITFCLRGVAGTSVTFVPPA"
     misc_feature    complement(257967..258482)
                     /locus_tag="CNE_BB1p02600"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(258312..258452)
                     /locus_tag="CNE_BB1p02600"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(258999..259112)
                     /locus_tag="CNE_BB1p02610"
                     /db_xref="GeneID:10915241"
     CDS             complement(258999..259112)
                     /locus_tag="CNE_BB1p02610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687723.1"
                     /db_xref="GI:339328031"
                     /db_xref="GeneID:10915241"
                     /translation="MVERTHAWFHKLRRLRIRFERRADIHEAFLKLGCSTQ"
     gene            complement(259360..260664)
                     /locus_tag="CNE_BB1p02620"
                     /db_xref="GeneID:10915242"
     CDS             complement(259360..260664)
                     /locus_tag="CNE_BB1p02620"
                     /EC_number="3.1.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="triacylglycerol lipase"
                     /protein_id="YP_004687724.1"
                     /db_xref="GI:339328032"
                     /db_xref="GeneID:10915242"
                     /translation="MKVGKAKCDDVNVGAASGTADLARAASSGHRKGWRGCRAAFLMV
                     ALSIGVVTASSAQIIPQDYFYVPPNPLPPGKPGDVIRTRTITAPLFPNALIQQIMYLS
                     STASGKPVAVTGVVATPLLRAAGQPLVVMTPGTRGTGDQCAPSRQFGVTSASPDGLDY
                     ESGTTQQLLARGISVVLTDYEGQGTPGLTSYLVGRSEGYNGLDALRAAQRLPGAGVPA
                     GAPVGVVGYSQGGQAAGWVAELQPTYAPELNFRGALVGGVPTDMLVEVNHLNGNPTAG
                     AGFGLAALSGLDHAFPELNLDGRLTDFGRQVMQDVRTSCFDKYLTAYGTTSAADVTQP
                     NALSDSQWQQRFKASLLGTKVPGAPAFIYHGTADQVVPFALGQLLFSSWCSRGADVTF
                     KGLIGLEHGTGNFAGPPDGIDWIAQRLAGVAAAHGCFDVTLP"
     misc_feature    complement(259402..260196)
                     /locus_tag="CNE_BB1p02620"
                     /note="Secretory lipase; Region: LIP; pfam03583"
                     /db_xref="CDD:252040"
     misc_feature    complement(259465..260166)
                     /locus_tag="CNE_BB1p02620"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(261134..261679)
                     /locus_tag="CNE_BB1p02630"
                     /db_xref="GeneID:10915243"
     CDS             complement(261134..261679)
                     /locus_tag="CNE_BB1p02630"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic compounds catabolic protein"
                     /protein_id="YP_004687725.1"
                     /db_xref="GI:339328033"
                     /db_xref="GeneID:10915243"
                     /translation="MENNQESLVWISQQSDAKQRIRKGGGAPGLARIDQVAGKSGLEI
                     LEAMMSGQLPYPPMNETMNMTLLEVDNGRAVFQGIPLRQHYNPLGTVHGGWFATLLDS
                     ALGCSVQTMLPARRSYTTAELSINIVRAASHKTGPLRGVATVVHSGRQIATAEARVED
                     AKGKLYAHATTTCFVFDVPAA"
     misc_feature    complement(261155..261499)
                     /locus_tag="CNE_BB1p02630"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    complement(<261170..261427)
                     /locus_tag="CNE_BB1p02630"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    complement(order(261290..261301,261320..261322,
                     261407..261409))
                     /locus_tag="CNE_BB1p02630"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(261299..261301,261305..261319,
                     261389..261391,261398..261400,261404..261406))
                     /locus_tag="CNE_BB1p02630"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(261320..261322,261362..261367,
                     261374..261379,261401..261403))
                     /locus_tag="CNE_BB1p02630"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            complement(261709..263211)
                     /locus_tag="CNE_BB1p02640"
                     /db_xref="GeneID:10915244"
     CDS             complement(261709..263211)
                     /locus_tag="CNE_BB1p02640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687726.1"
                     /db_xref="GI:339328034"
                     /db_xref="GeneID:10915244"
                     /translation="MHTDIRKSPMTNPDRPATALSASVALALQNAHPASPWPVFWVAS
                     VAVFLVSMDGTMLFAAFSALRAGFPHATAADLSWVLNAYTVAYAATLIPSGGLADKHG
                     RKKIFLGGVGLFLAASVACGLAVSVGWLVAARVLQAIGAALLTPASLSLVLAAFPTSK
                     RAVAISLWGAVGALAAAVGPSLGAFVIASVGWQWAFYLNLPLGIVAMWRGATLLTETK
                     QQASTRPLDLFGMSLLIVGTGALALSIVQSESPAWSRHELLGVAGVGLMSIVGFVAWA
                     RVATSPLVDLALFRNRAYRYANLATLSFGIAFSMMFFAFFFYMSSIWHYSLPLAGLAI
                     TPGPLLVIPVAAMSGRIASRHGHRPLLVAGSLLYATSALWFLLVPGIEPAYLSQWLPG
                     MLLSGVGVGMVLPSLAGAAVSRLPADHYAVGGAINQAIRQIGSVMGVALTVLLLGSTG
                     LQRADFNAVYLCHMSLALVTAALCLPVNTLSAAIAKTKTRDAGSSPEATA"
     misc_feature    complement(<262588..263094)
                     /locus_tag="CNE_BB1p02640"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(261898..263082)
                     /locus_tag="CNE_BB1p02640"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(262684..262686,262702..262707,
                     262714..262719,262753..262755,262762..262767,
                     262774..262779,262786..262791,262927..262932,
                     262936..262941,262951..262953,262960..262965,
                     262972..262974,263026..263031,263035..263043,
                     263050..263052))
                     /locus_tag="CNE_BB1p02640"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(263265..264152)
                     /locus_tag="CNE_BB1p02650"
                     /db_xref="GeneID:10915245"
     CDS             complement(263265..264152)
                     /locus_tag="CNE_BB1p02650"
                     /EC_number="1.1.1.62"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004687727.1"
                     /db_xref="GI:339328035"
                     /db_xref="GeneID:10915245"
                     /translation="MRSLIKQASSVKLNCRHLNSRIQKGTAVSNSKVVVITGVSSGIG
                     RATAAKFAQQGYRVFGTVRNSAKAQPISGVELVEMDIRDEASVQHGIQAIIAHAKRID
                     VLVNSAGVTLLGSTEETSIAEAQSLFDTNVFGILRTTQAVLPHMRAQRSGRIVNISSV
                     LGFLPAPYMGLYSASKHAVEGMSETLDHEVRKFGIRVVLVEPSFTKTGLDTNAPHAAS
                     KISAYDDERNIVLQAIQKNVKDAPDPDGVATTIVDAAVGAWGMRRPPKGQAYLLSKLR
                     RFMPAGPVDASLRKTFGLS"
     misc_feature    complement(263271..264068)
                     /locus_tag="CNE_BB1p02650"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06179"
                     /db_xref="CDD:235725"
     misc_feature    complement(263358..264059)
                     /locus_tag="CNE_BB1p02650"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(263526..263534,263538..263540,
                     263625..263627,263637..263639,263676..263684,
                     263763..263765,263823..263834,263910..263918,
                     263964..263966,264024..264035,264039..264041))
                     /locus_tag="CNE_BB1p02650"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(263625..263627,263637..263639,
                     263676..263678,263760..263762))
                     /locus_tag="CNE_BB1p02650"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(263475..263477,263484..263486,
                     263523..263525,263541..263546,263637..263639,
                     263655..263657,263670..263678))
                     /locus_tag="CNE_BB1p02650"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
     gene            complement(264182..265672)
                     /locus_tag="CNE_BB1p02660"
                     /db_xref="GeneID:10915246"
     CDS             complement(264182..265672)
                     /locus_tag="CNE_BB1p02660"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687728.1"
                     /db_xref="GI:339328036"
                     /db_xref="GeneID:10915246"
                     /translation="MEEPMLPKRSLAALFVASLATGCAVGPDYVKPDMPVSERFQGQA
                     AVEQRIANAEADLSAWWAGFGDPQLTRFVQIALEQNLDLAQAFARVTQARAGLGAANA
                     ALLPSGNITGQAARVYQSVETPLGRVLNSRPGFDRYGSAFEADVNASWELDVFGGLRR
                     GREAALADYQASQAGAVATRLAVAAQTADIYITIRGLQTRLKVARHQVQTQEELLSTI
                     KLLYGKGLAAELQVRQAEGALAQVRASIPQLEAGLDAAMNALDVMLGSLPGTHRAELA
                     QGGDVPAAPQIAISGSPGELLRRRPDLIVAERRLAASNARIGVAIAEYYPKFSLSGLL
                     GSATSVGAGSLFGSGASQFAGVLGLRWRLFDFGRINAQIDQAKGQEAEMLAAYRLAVL
                     RATEDVEDAFSALVKREEQAAVLAQGVDSLNRARNASFAAYQKGVVSLIEVLQADESL
                     LRASDARAQAQTEAARAAVSAFKALGGGWQPDESAVVATKPPEFAQ"
     misc_feature    complement(264209..265624)
                     /locus_tag="CNE_BB1p02660"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    complement(264878..265468)
                     /locus_tag="CNE_BB1p02660"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(264272..264784)
                     /locus_tag="CNE_BB1p02660"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            265651..266361
                     /gene="tolC"
                     /locus_tag="CNE_BB1p02670"
                     /db_xref="GeneID:10915247"
     CDS             265651..266361
                     /gene="tolC"
                     /locus_tag="CNE_BB1p02670"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein TolC"
                     /protein_id="YP_004687729.1"
                     /db_xref="GI:339328037"
                     /db_xref="GeneID:10915247"
                     /translation="MATWVLPSESQVTIVQNGHKLFNYRDSRKLEPMKTTPYPVPARG
                     PADHDVRDQIVAAATEHFSRYGYEKTAVSDLAKAIGYSKAYIYKFFESKQAIGEMICA
                     NCLREIEADVSAALAEADSPPEKLRRMFKALTEASLRLFSHDRKLYEIAASAATERWQ
                     AVIAYEERIQKVLRDVLQEGRETGDFERKTPLDEATTAIYLVMRPYLNPLLLQHSFDY
                     TESAPGLLSSLVLRSLSP"
     misc_feature    265765..266301
                     /gene="tolC"
                     /locus_tag="CNE_BB1p02670"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    265810..265938
                     /gene="tolC"
                     /locus_tag="CNE_BB1p02670"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    265993..266283
                     /gene="tolC"
                     /locus_tag="CNE_BB1p02670"
                     /note="YsiA-like protein, C-terminal region; Region:
                     TetR_C_4; pfam08359"
                     /db_xref="CDD:116940"
     gene            266447..267559
                     /gene="acrA"
                     /locus_tag="CNE_BB1p02680"
                     /db_xref="GeneID:10915248"
     CDS             266447..267559
                     /gene="acrA"
                     /locus_tag="CNE_BB1p02680"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/multidrug efflux system, mebrane-fusion
                     component AcrA"
                     /protein_id="YP_004687730.1"
                     /db_xref="GI:339328038"
                     /db_xref="GeneID:10915248"
                     /translation="MLSRRFVTSTVCALPLALSACGEKAPADPRTEAPLVRAAFVQPV
                     ASASRSFTGVVAARVQSDLGFRVPGKVLERLVDAGQSVKRGQPLMRIDPVDLKLAAHA
                     QQEAVTAARARAQQTAEDEARYRDLRGTGAISASAYDQAKAAADAAKAQLSAAEAQAD
                     VARNASRYAELVADGEGVVMETLAEPGQVVNAGQAVVRLAHAGRREAVVQLPETLRPA
                     IGSLAQATLFGGESARVPAKLRQLSDAADRLTRTFEARYVLDGELANAPLGATVTIQI
                     PDRLAIAQGDLQVPLGAVFDAGKGPGVWVIQGDPAKVSWRSVTIVRLGDEGARVAGQV
                     KQGDRIVALGAQLLREGQQVRVAGQGASTAIAGVRP"
     misc_feature    266582..267514
                     /gene="acrA"
                     /locus_tag="CNE_BB1p02680"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    266645..266767
                     /gene="acrA"
                     /locus_tag="CNE_BB1p02680"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    266975..267253
                     /gene="acrA"
                     /locus_tag="CNE_BB1p02680"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            267556..270678
                     /gene="acrB"
                     /locus_tag="CNE_BB1p02690"
                     /db_xref="GeneID:10915249"
     CDS             267556..270678
                     /gene="acrB"
                     /locus_tag="CNE_BB1p02690"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/multidrug efflux pump"
                     /protein_id="YP_004687731.1"
                     /db_xref="GI:339328039"
                     /db_xref="GeneID:10915249"
                     /translation="MSQVRFNLSALAVRERAVTLFLICLISLAGLISFFKLGRAEDPA
                     FTVKVMTIITAWPGATAQEMQDQVAEKIEKRMQELRWYDRTETYTRPGLAFTTLTLLD
                     STPPSEVQEEFYQARKKVSDEVANLPPGVIGPMVNDEYADVTFALFALKAQGEPQRVL
                     VRDAETLRQRLLHVPGVKKVNIIGEQSERIYVEFSHERLATLGLSPQEVFAALNSQNA
                     LTAAGSVETKGPQVFIRLDGAFDELQKIRDTPVVSQGRTLKLSDIATVKRGYEDPATL
                     MVRNGGQPALLLGIVMREGWNGLDLGKALDKEVGAVNADMPLGMSLTKVTDQAVNISS
                     AVDEFMLKFFAALLVVMLVSFVSMGWRAGLVVAAAVPLTLAVVFVVMAATGKNFDRIT
                     LGSLILALGLLVDDAIIAIEMMVVKMEEGYSRVAASAYAWSHTAAPMLSGTLVTAVGF
                     MPNGFARSTAGEYTSNMFWIVGIALIASWVVAVVFTPYLGVKMLPDFKKVEGGHDAIY
                     DTPRYNRFRALLGRVIARKWLVAGSVVGLFALAILGMAVVKKQFFPISDRPEVLVEVQ
                     MPYGASINQTSAATAKLEAWLAKQKEARIVTAYVGQGAPRFYLAMGPELPDPSFAKIV
                     IRTDSQEERDAVKQRLRQAIADGLAPEARVRVTQLVFGPYSPFPVAYRVSGPDAQTLR
                     RIAADVQQVMDASPMMRTVNTDWGMRVPTLHFTLQQDRLQAVGLGSSAVAQQLQFLLN
                     GIPVTAVREDIRTVQVTARSAGDVRLDPAKIGDFTLAGANGQRIPLSQVGKIDVRMEE
                     PIMRRRDRMPTITVRGDIADGLQPPDVSTAISKQLQPIIEKLPSGYRIEQAGSIEESG
                     KATKAMLPLFPIMLAVTLLILIFQVRSIPALVMVFLTSPLGLIGVVPTLILFGQPFGI
                     NALVGLIALSGILMRNTLILIGQIQHNKEEGLDPFRAVVEATVQRARPVILTALAAIL
                     AFIPLTHSVFWGALAYTLIGGTFAGTILTLVFLPAMYSIWFRIRPGNAADAQRDRHET
                     AQPAAELVPE"
     misc_feature    267574..270600
                     /gene="acrB"
                     /locus_tag="CNE_BB1p02690"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     gene            complement(271188..271355)
                     /locus_tag="CNE_BB1p02700"
                     /db_xref="GeneID:10915250"
     CDS             complement(271188..271355)
                     /locus_tag="CNE_BB1p02700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687732.1"
                     /db_xref="GI:339328040"
                     /db_xref="GeneID:10915250"
                     /translation="MVVAVMARASTGAYMVFPGEAFDVVATMSAVREERSTALQDVPT
                     MFIAPGRSPGS"
     misc_feature    complement(<271212..271355)
                     /locus_tag="CNE_BB1p02700"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     gene            complement(271384..271659)
                     /gene="mmlJ"
                     /locus_tag="CNE_BB1p02710"
                     /db_xref="GeneID:10915251"
     CDS             complement(271384..271659)
                     /gene="mmlJ"
                     /locus_tag="CNE_BB1p02710"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmuconolactone isomerase"
                     /protein_id="YP_004687733.1"
                     /db_xref="GI:339328041"
                     /db_xref="GeneID:10915251"
                     /translation="MLYCVQMDVKIPESLPADRVDTLKAAEKARAIEIQKAGKWPHLW
                     RVVGRYSNVSVFDVESNDELHELLSSLPLFPYMTIQVTPLAKHPSAI"
     misc_feature    complement(271387..271656)
                     /gene="mmlJ"
                     /locus_tag="CNE_BB1p02710"
                     /note="muconolactone delta-isomerase; Region: muco_delta;
                     TIGR03221"
                     /db_xref="CDD:213786"
     gene            complement(271748..272092)
                     /gene="mmlI"
                     /locus_tag="CNE_BB1p02720"
                     /db_xref="GeneID:10915252"
     CDS             complement(271748..272092)
                     /gene="mmlI"
                     /locus_tag="CNE_BB1p02720"
                     /codon_start=1
                     /transl_table=11
                     /product="4-methylmuconolactone methylisomerase"
                     /protein_id="YP_004687734.1"
                     /db_xref="GI:339328042"
                     /db_xref="GeneID:10915252"
                     /translation="MIRMLYLLVKPEGMSDDTFRAECLRHDEMSRGVPGLHKYEVRLV
                     AEQPTDTHVPFFDIGHVDAIGECWFENEAAYESYLASDIRKEWFEHGKTFIGQLKPFR
                     TAPVSGDDNVAG"
     misc_feature    complement(271754..272089)
                     /gene="mmlI"
                     /locus_tag="CNE_BB1p02720"
                     /note="Methylmuconolactone methyl-isomerase; Region: MmlI;
                     pfam09448"
                     /db_xref="CDD:87993"
     gene            complement(272162..273448)
                     /gene="mmlH"
                     /locus_tag="CNE_BB1p02730"
                     /db_xref="GeneID:10915253"
     CDS             complement(272162..273448)
                     /gene="mmlH"
                     /locus_tag="CNE_BB1p02730"
                     /codon_start=1
                     /transl_table=11
                     /product="muconolactone transporter MmlH"
                     /protein_id="YP_004687735.1"
                     /db_xref="GI:339328043"
                     /db_xref="GeneID:10915253"
                     /translation="MLDWYKNGTPQQKKTFWACYSGWALDSFDMQMFSFLLPALTIAW
                     GLTKPEVGVLGTVALIVTAIGGWGAGILSDRYGRARILVLAIIWFTLFGVLAGFAQTY
                     NQLLIARTLQGLGFGGEWAVGAALMAEVIDAKHRGKAMGYVQSGFALGWALSVVVATL
                     LLAWLPSEMAWRVAFWSGIIPASSVLFIRRHIKDAPMFERARRSCAPRASLASVFNRK
                     YARSLILSSVLVIGLQAGCYAILIWLPSLLSQREVAAASKIVTVFIMAFGSFCGFAVA
                     ADLCDRIGRRPTLILLSVCAWIVTVSYMLLPLNSTLTAILGFLVGFSAIGMFAALGPF
                     LSELFPTHVRTTCMGFSYNVGKSVGAGSVVGVGVLSTHIGLANAMGAFCLVAYTFAVF
                     GILLLPETRGIAIENIGEEDNHYEAGALAHSVRAQT"
     misc_feature    complement(272381..273427)
                     /gene="mmlH"
                     /locus_tag="CNE_BB1p02730"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(272261..273403)
                     /gene="mmlH"
                     /locus_tag="CNE_BB1p02730"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(272372..272374,272381..272386,
                     272393..272398,272405..272410,272441..272443,
                     272450..272455,272465..272467,272474..272479,
                     272486..272488,272630..272632,272642..272644,
                     272651..272653,272663..272665,272672..272674,
                     272714..272716,272723..272728,272735..272740,
                     272747..272749,272996..272998,273014..273019,
                     273026..273031,273065..273067,273074..273079,
                     273086..273091,273098..273103,273239..273244,
                     273248..273253,273263..273265,273272..273277,
                     273284..273286,273335..273340,273344..273352,
                     273359..273361))
                     /gene="mmlH"
                     /locus_tag="CNE_BB1p02730"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(273535..274197)
                     /gene="catJ"
                     /locus_tag="CNE_BB1p02740"
                     /db_xref="GeneID:10915254"
     CDS             complement(273535..274197)
                     /gene="catJ"
                     /locus_tag="CNE_BB1p02740"
                     /codon_start=1
                     /transl_table=11
                     /product="oxoadipate CoA transferase subunit beta"
                     /protein_id="YP_004687736.1"
                     /db_xref="GI:339328044"
                     /db_xref="GeneID:10915254"
                     /translation="MDHVARSLLAARVARDIPNGSYVNLGIGLPTLVANHLPRYREVI
                     LHSENGVLGQWSAAEPGQEDWDLINAGKEAIRLEKGAAFFHHADAFGMMRGGHLDICV
                     LGAFQVSERGDLANWHTGAPDAIPAVGGAMDLAIGAKRVFVMMDHLTKDGTSKLRREC
                     SYPLTGLACVSRVYTELGTFAIGPHGVSVIEIVGDMSPQSLQSLTDVKLEFTSMVIGE
                     YA"
     misc_feature    complement(273565..274185)
                     /gene="catJ"
                     /locus_tag="CNE_BB1p02740"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            complement(274203..274898)
                     /gene="catI"
                     /locus_tag="CNE_BB1p02750"
                     /db_xref="GeneID:10915255"
     CDS             complement(274203..274898)
                     /gene="catI"
                     /locus_tag="CNE_BB1p02750"
                     /codon_start=1
                     /transl_table=11
                     /product="oxoadipate CoA transferase subunit alpha"
                     /protein_id="YP_004687737.1"
                     /db_xref="GI:339328045"
                     /db_xref="GeneID:10915255"
                     /translation="MIDKLYTTARDAMDDVQDGATIAIGGFGGAGMPDELIDALIEQG
                     AKELTVISNNAGNGDTGLAALLKTRRVRKLLCSFPRQRDAYVFEELYRAGQIELEVVP
                     QGTLAERLRAAGSGIGAFYTPTGYGTLLAQGKETRQIDGRGYVLEHPLHVDVALINAA
                     AADRWGNLIYNKTARNFAPVMAMAASQTIAAVARVCELGELDPEDVVTPGIFVNRVVL
                     RGAVAQAEAMLAG"
     misc_feature    complement(274239..274898)
                     /gene="catI"
                     /locus_tag="CNE_BB1p02750"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            complement(275126..276040)
                     /locus_tag="CNE_BB1p02760"
                     /db_xref="GeneID:10915256"
     CDS             complement(275126..276040)
                     /locus_tag="CNE_BB1p02760"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004687738.1"
                     /db_xref="GI:339328046"
                     /db_xref="GeneID:10915256"
                     /translation="MAVPFDITDFRLFVNVAETHSLTRGAERSFLSVPAVSNRIKNLE
                     DTLGVRLLERSPQGVTLTAAGDVYLQHARVVLAELERLTGNLQPFTAGLSGQLKLVAN
                     TTAITEYLPPVIGDYLATHPDVRIDVRERLSDDIVRLVREGGADLGIISGNVPTAGLQ
                     AVPFVKSGLILVAPLGHPLLAEEEVWFEQALEYAFVALLEGSAFQVFMTRAAGALHKP
                     MTIRVHVASYDAICRMVAANAGIAIMPKAAFARLKGNQPIGACNLRDDWAVRTFQVCA
                     RDIEGLSSFAREFANRLIGRYAPGGDGS"
     misc_feature    complement(275162..276028)
                     /locus_tag="CNE_BB1p02760"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(275846..276022)
                     /locus_tag="CNE_BB1p02760"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(275162..275755)
                     /locus_tag="CNE_BB1p02760"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_1; cd08421"
                     /db_xref="CDD:176113"
     misc_feature    complement(order(275330..275335,275339..275344,
                     275360..275377,275651..275671,275675..275677,
                     275687..275689,275696..275701,275705..275710))
                     /locus_tag="CNE_BB1p02760"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176113"
     gene            complement(276160..277104)
                     /locus_tag="CNE_BB1p02770"
                     /db_xref="GeneID:10915257"
     CDS             complement(276160..277104)
                     /locus_tag="CNE_BB1p02770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687739.1"
                     /db_xref="GI:339328047"
                     /db_xref="GeneID:10915257"
                     /translation="MPYEPRTGLAIHIWETRHMMQSRTLGDIKITRILEYAGPTHDPA
                     FLFPDLDRSVLDANVDLMAPHHWIPHMNKLIVTIQFWIVHAGDKVVVVDTGVGNFKPR
                     AGIARMHMLNTLVREWMIAAGAAPEQVTHVVMTHLHADHVGWNTTWQDGRWAPTFPNA
                     RYYIPKDDFVFCDAGRNKEPGVVDVFGEAFFDSVMPVVKEGLAEMIVPGQEIAGCLQV
                     EPAAGHSPGQVAFRVRSRGEEAVFCGDILHSPLQIVRPDVNSGYCIRPDLARTTRLAL
                     LNQAADSEALVLPVHFGQPHCGYIRREGQGFLFEPATW"
     misc_feature    complement(276232..276864)
                     /locus_tag="CNE_BB1p02770"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(277599..278513)
                     /locus_tag="CNE_BB1p02780"
                     /db_xref="GeneID:10915258"
     CDS             complement(277599..278513)
                     /locus_tag="CNE_BB1p02780"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687740.1"
                     /db_xref="GI:339328048"
                     /db_xref="GeneID:10915258"
                     /translation="MKIDPLSLRLFLAVSELGTIAAAAEREHIAASAVSKRISDLEDT
                     LRTQLLERSNKGIVPTPAGIALQNLSRGIVNDLENIAAMMQDYATGTRGLVRIYANVS
                     SIAQFLPADLHGFIEKYPDVQLQLEERISTAILRGVAENAADIGCFADLGTSPQGVIT
                     LPYREDDLVVVVSRRHALASRKKLTTTEVLDHYLIGLQTGSYINMQLLRFASENGVPV
                     KFRMQVNSYDAVCLMVEADMGIGILPISLARRYAKTLAIRVIAFDAPWAHRKLNLCIR
                     SYEGLPVAARQLVDHLCSSARAIVGCSG"
     misc_feature    complement(277620..278507)
                     /locus_tag="CNE_BB1p02780"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(278325..278492)
                     /locus_tag="CNE_BB1p02780"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(277638..278231)
                     /locus_tag="CNE_BB1p02780"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_1; cd08421"
                     /db_xref="CDD:176113"
     misc_feature    complement(order(277806..277811,277815..277820,
                     277836..277853,278130..278150,278154..278156,
                     278166..278168,278175..278180,278184..278189))
                     /locus_tag="CNE_BB1p02780"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176113"
     gene            complement(278547..279731)
                     /locus_tag="CNE_BB1p02790"
                     /db_xref="GeneID:10915259"
     CDS             complement(278547..279731)
                     /locus_tag="CNE_BB1p02790"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="YP_004687741.1"
                     /db_xref="GI:339328049"
                     /db_xref="GeneID:10915259"
                     /translation="MENTEPKRYRFTGHERVIHNVSAIEALPDVLTLFGYHRVFVVCS
                     RSIRTKTAFIDRLQARLGEMIVGLTDEVGEHSPLSNVLRAARQARDARADVIVSVGGG
                     SVMDMCKAMQLCISENAYDRDSLLKLQFVVSADGTEMLTTSQAPAAIRQIAIPTTLAT
                     SEWTPVSTPIDDETRLKARFVVPDGSPVAVLYDPDLLHQTPVRLLWSTGIRGLDHAIN
                     TACSSSPHPFTSLLAERAIALYVQNLPKLGDASATEAFTQCQLATWYTGMGQMSVPHG
                     FSHWMVHIIGPYGGIAHSDAACVLMLAQSKWLEGWIKPQHERLAAAIGQPGMPFHAIL
                     HNLLVRLGMPTTLDDLGLTRAQVDAMIGPALEHPMVTRNNVRPITTEADLRAILELAW
                     RA"
     misc_feature    complement(278565..279689)
                     /locus_tag="CNE_BB1p02790"
                     /note="Dehydroquinate synthase-like (DHQ-like) and
                     iron-containing alcohol dehydrogenases (Fe-ADH); Region:
                     DHQ_Fe-ADH; cl02872"
                     /db_xref="CDD:261488"
     misc_feature    complement(order(278853..278855,278883..278885,
                     278895..278897,279087..279089,279099..279101,
                     279120..279122,279144..279146,279198..279203,
                     279255..279257,279261..279266,279405..279407,
                     279414..279416,279423..279431,279600..279602))
                     /locus_tag="CNE_BB1p02790"
                     /note="active site"
                     /db_xref="CDD:173927"
     misc_feature    complement(order(278853..278855,279144..279146,
                     279255..279257,279261..279266,279423..279431,
                     279600..279602))
                     /locus_tag="CNE_BB1p02790"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173927"
     misc_feature    complement(order(278853..278855,278895..278897,
                     279099..279101))
                     /locus_tag="CNE_BB1p02790"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173927"
     gene            complement(279980..280219)
                     /locus_tag="CNE_BB1p02800"
                     /db_xref="GeneID:10915260"
     CDS             complement(279980..280219)
                     /locus_tag="CNE_BB1p02800"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687742.1"
                     /db_xref="GI:339328050"
                     /db_xref="GeneID:10915260"
                     /translation="MVSAIIESERGMAIDEIRQIVTAVVISEPLADRLGVAARSAGLH
                     LVRHYKRAGKILEISGTIYPADRVSVAFQLKRNIV"
     misc_feature    complement(280013..>280210)
                     /locus_tag="CNE_BB1p02800"
                     /note="UTRA domain; Region: UTRA; cl17743"
                     /db_xref="CDD:266805"
     gene            complement(280634..281497)
                     /locus_tag="CNE_BB1p02810"
                     /db_xref="GeneID:10915261"
     CDS             complement(280634..281497)
                     /locus_tag="CNE_BB1p02810"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687743.1"
                     /db_xref="GI:339328051"
                     /db_xref="GeneID:10915261"
                     /translation="MFDWEDLRHFSVFAQEGSLSGAARRLKVDHATVARRISALEAAL
                     CLKLVDRRPRAYLLTGEGERVAALGARMEQESFAVERTAAAGQTGVSGDVTISAPPSM
                     AAAVIAPQLGRLREQHPALRICLTGTTHMASLSRREADLAVRLTRPSEGDLVVRKLGV
                     VVFSLYSSASYLSATTPSDYGFIAYDDSMEGSPQQNWLKQQAGTRPIVMVSNELEIQA
                     AAARAGVGIAALPYFLGDRDDGLQRVRSKGKRFEREIWLAVHADIRRAPRIQAVMQFL
                     GSCFTENASLA"
     misc_feature    complement(280652..281494)
                     /locus_tag="CNE_BB1p02810"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(281309..281488)
                     /locus_tag="CNE_BB1p02810"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(280670..281218)
                     /locus_tag="CNE_BB1p02810"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(280829..280834,280838..280843,
                     280859..280876,281120..281128,281129..281137,
                     281141..281143,281153..281155,281162..281167,
                     281171..281176))
                     /locus_tag="CNE_BB1p02810"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            281692..282612
                     /locus_tag="CNE_BB1p02820"
                     /db_xref="GeneID:10915262"
     CDS             281692..282612
                     /locus_tag="CNE_BB1p02820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687744.1"
                     /db_xref="GI:339328052"
                     /db_xref="GeneID:10915262"
                     /translation="MRKPDSLAYVGIIVSTFFWGTNFNAGALIIRHMTPISASIERFL
                     ISTTLLLLIFGLQGKLRLSVLRENLWAYVGLGLLGFTAFNLATFFGLQTTTPINGALI
                     LATTPLWTMLLAVVFERERIDTARAIGLFFGLLGVGLVITRGDVQMLLALKVARGDAI
                     ILAGSLAWAANMVGTRRFVKQATPLENTTFSMLFGTIGLIVLGFMFERPLASIAATPG
                     NIHAAVLYLAVGGSLLAYLLWFRGIHQIGAARTSIFFNLAPVFTMLVSTVLGVPPNAW
                     QLVGAVAVILGVVFASGLVGIPTRARAAQT"
     misc_feature    281692..282567
                     /locus_tag="CNE_BB1p02820"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    281740..282117
                     /locus_tag="CNE_BB1p02820"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    282187..282567
                     /locus_tag="CNE_BB1p02820"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            283033..283998
                     /locus_tag="CNE_BB1p02830"
                     /db_xref="GeneID:10915263"
     CDS             283033..283998
                     /locus_tag="CNE_BB1p02830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687745.1"
                     /db_xref="GI:339328053"
                     /db_xref="GeneID:10915263"
                     /translation="MAVRQLLQTFLAFSVATAAVAQESYPSKPVTVVVPQAPGGANDA
                     IARIVTQKLSGQFGRQFVVENRPGAGGNIGTAYVGKSAADGYTLLFTVSSAHVINPAL
                     YKRTGFDPVRDFAPVGSVATAGYVLVANPSFGPNNVKELVDAARAKPDTIMYASAGNG
                     TLNHLIGEMLQHSAGIRLVHIPYKGASAAVADVVGGQVPLSVQSLPSALSFIRAGKLK
                     VLAVTNEKRLASMPEVPTVGETLRGFGATPWYGLFAPAGTPPAVVSRLQAALSKVLDS
                     PDVRDTLARQGCQPFPSGAPQFEALIRDELPRWSAIVKAAGATVD"
     misc_feature    283165..283986
                     /locus_tag="CNE_BB1p02830"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            284348..284491
                     /locus_tag="CNE_BB1p02840"
                     /db_xref="GeneID:10915264"
     CDS             284348..284491
                     /locus_tag="CNE_BB1p02840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687746.1"
                     /db_xref="GI:339328054"
                     /db_xref="GeneID:10915264"
                     /translation="MDLKALHAKIGQPTLENDFVTVAAHNTGSHGTSGNDSQGIVGEI
                     RRK"
     gene            complement(284619..284891)
                     /locus_tag="CNE_BB1p02850"
                     /db_xref="GeneID:10915265"
     CDS             complement(284619..284891)
                     /locus_tag="CNE_BB1p02850"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004687747.1"
                     /db_xref="GI:339328055"
                     /db_xref="GeneID:10915265"
                     /translation="MRVRTEIAAYADPVGAMREHMASANHQQPGDPAKLATALLTLAD
                     SETPPVRLPLGSDTVYRITEKNRQVESELAAWQALAVSTDHDDVRH"
     misc_feature    complement(284634..>284873)
                     /locus_tag="CNE_BB1p02850"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     gene            complement(285334..285564)
                     /locus_tag="CNE_BB1p02860"
                     /db_xref="GeneID:10915266"
     CDS             complement(285334..285564)
                     /locus_tag="CNE_BB1p02860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687748.1"
                     /db_xref="GI:339328056"
                     /db_xref="GeneID:10915266"
                     /translation="MTDRQVDLRYVRDNFGHSSISTSGYLRSEEDARHEARAASEPLG
                     QQDVRCDPRLIHGLQLMNAASLHSDNRPRSTG"
     gene            complement(285726..286130)
                     /locus_tag="CNE_BB1p02870"
                     /db_xref="GeneID:10915267"
     CDS             complement(285726..286130)
                     /locus_tag="CNE_BB1p02870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687749.1"
                     /db_xref="GI:339328057"
                     /db_xref="GeneID:10915267"
                     /translation="MKAIVSFVAALMLSCLMAAQPAVAAPEAKVTPLRTEPLPEYPGK
                     EVQMIIVEYPPGSVDPVHRHDAHAFVYVLEGSIVMAVKGGKEVTLKAGDTFHEGTNDI
                     HTVGRNASSTQPARFVVFLIKNKGAPILTPVK"
     misc_feature    complement(285729..286109)
                     /locus_tag="CNE_BB1p02870"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(286135..286887)
                     /locus_tag="CNE_BB1p02880"
                     /db_xref="GeneID:10915268"
     CDS             complement(286135..286887)
                     /locus_tag="CNE_BB1p02880"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="YP_004687750.1"
                     /db_xref="GI:339328058"
                     /db_xref="GeneID:10915268"
                     /translation="MKIVVIGGSGLIGSQLVALLTNAGHAAVAASPRTGVNSVTGEGL
                     DLALKDADVVVDVANAPSWEPQAVLDFFRTSARNLGKAEVAAGVRNHVALSIVGTDRM
                     PGNAYFTAKVAQEEAIEAAGVPYTIVRATQFMEFLGGIADFGTDGTTVRMGDGLFQPI
                     ASQDVAAFLAQVALEAPRNGTIEIAGPDRAPFAEIVARYLKSTGDARSVVTDRDALYY
                     GGHVEELSLVPLGDARIGRISLGQWLSQANVE"
     misc_feature    complement(286183..286887)
                     /locus_tag="CNE_BB1p02880"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    complement(286363..286881)
                     /locus_tag="CNE_BB1p02880"
                     /note="NADH(P)-binding; Region: NAD_binding_10; pfam13460"
                     /db_xref="CDD:257784"
     misc_feature    complement(order(286489..286500,286555..286557,
                     286567..286569,286600..286608,286711..286719,
                     286852..286854,286858..286863,286867..286869))
                     /locus_tag="CNE_BB1p02880"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(286555..286557,286567..286569,
                     286600..286602,286672..286674))
                     /locus_tag="CNE_BB1p02880"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            287088..288605
                     /locus_tag="CNE_BB1p02890"
                     /db_xref="GeneID:10915269"
     CDS             287088..288605
                     /locus_tag="CNE_BB1p02890"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687751.1"
                     /db_xref="GI:339328059"
                     /db_xref="GeneID:10915269"
                     /translation="MTALTSPLAIEIDRQNRLPIYLQICERFRTAIAAGHLRPGDRVP
                     ALRGLATQLNTARGTVEMAYTILVDEGYLQMRGAAGTFVSASLPAAVTRSASGQDREH
                     MRAREGGASAVSDASRSRQPAPRQLAIAVAMSGEPKPLQPGLPALDAFPRKLWNRLVS
                     RCARSGQRAMLAYPDPVGYRALREHIATYLGLSRGVACLPEQVFITAGYRATLELLLR
                     SLASPSDRMWFEDPGYLLARSFLAEAGVQLVPVPIDSEGIDVERGIALDRQARFALVT
                     PSHQAPLGHTLSLARRMALLDWASKGSRWIIEDDYDSEFRYVGRPLPALKSLDKHDRV
                     IYCGTFSKVMFPGLRLAYAVVPERAVERVGRVACSMNAGSPMLLQAAVADFIEQGHFA
                     RHVKRMRALYGQRRMLIAHALNQAFGERMIVALPHGGIQFAVEFAEGPDGPVDDVAFA
                     SRARDAGLAVLPLSIWYANARTRRTPRGLVLGFANVTDAREASRLARTLHGCLDG"
     misc_feature    287136..288587
                     /locus_tag="CNE_BB1p02890"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    287142..287339
                     /locus_tag="CNE_BB1p02890"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(287142..287144,287148..287150,287217..287219,
                     287223..287228,287250..287264,287268..287273,
                     287280..287282,287310..287315,287319..287330)
                     /locus_tag="CNE_BB1p02890"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    287514..288578
                     /locus_tag="CNE_BB1p02890"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(287709..287717,287787..287789,287928..287930,
                     288021..288023,288102..288104,288108..288113,
                     288132..288134)
                     /locus_tag="CNE_BB1p02890"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(287718..287720,287817..287819,288000..288002,
                     288126..288134,288219..288221,288228..288230)
                     /locus_tag="CNE_BB1p02890"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    288111..288113
                     /locus_tag="CNE_BB1p02890"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            289259..289528
                     /locus_tag="CNE_BB1p02900"
                     /db_xref="GeneID:10915270"
     CDS             289259..289528
                     /locus_tag="CNE_BB1p02900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687752.1"
                     /db_xref="GI:339328060"
                     /db_xref="GeneID:10915270"
                     /translation="MLNLSLQDLSAWMLREEAALTSLVCEQRLMRALIEVSQGKGQHG
                     RYGFVSRERRDTAFFDRFGVCVKQAAVIGRVGTVTWSGDLVLEPG"
     gene            289883..290950
                     /locus_tag="CNE_BB1p02910"
                     /db_xref="GeneID:10915271"
     CDS             289883..290950
                     /locus_tag="CNE_BB1p02910"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004687753.1"
                     /db_xref="GI:339328061"
                     /db_xref="GeneID:10915271"
                     /translation="MKKALFAVAAAACAMSGSAFAQSSSNVTLYGIADAGISFQNHVN
                     GGANGSGSVVGVTSGGLSGSRWGLRGVEDLGSNLKGIFVLESGFDIDSGKSAQGGRLF
                     GRQAYVGLQGNFGAVTLGRQQNSLYDLFGAYDPMAAGPMYSLNSVDNQFNGRADNAIK
                     YTGKFGGLTATGFYSFGRDVNAGLGGEVPGHFKVGTNFGGGVAYANGPFSVGVAYDQF
                     QGSTLASADLAAKRAAIGTSYAFGAAKVFGGYRWMRDEVTTGTARHDNLYWLGANYKF
                     TPAFTLTGAAYYTDARTDSKDSWMFVLNADYALSKRTDAYLSLGYVNNKGNATFGVTG
                     TPNTMSGQNQTGAMLGMRHRF"
     misc_feature    289955..290947
                     /locus_tag="CNE_BB1p02910"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(289955..289957,289961..289963,289979..289981,
                     289985..289993,290090..290104,290120..290122,
                     290126..290134,290138..290140,290144..290155,
                     290189..290194,290198..290212,290237..290245,
                     290342..290344,290348..290353,290807..290812,
                     290819..290821,290933..290935,290939..290941,
                     290945..290947)
                     /locus_tag="CNE_BB1p02910"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(289976..289978,290075..290077,290192..290194,
                     290282..290284,290342..290344)
                     /locus_tag="CNE_BB1p02910"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(291134..291259)
                     /locus_tag="CNE_BB1p02920"
                     /db_xref="GeneID:10915272"
     CDS             complement(291134..291259)
                     /locus_tag="CNE_BB1p02920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687754.1"
                     /db_xref="GI:339328062"
                     /db_xref="GeneID:10915272"
                     /translation="MTYNITSTSVNPQTKIVITTRPTPLQRKAFALLGIDPGCSQ"
     gene            complement(292007..292252)
                     /locus_tag="CNE_BB1p02930"
                     /db_xref="GeneID:10915273"
     CDS             complement(292007..292252)
                     /locus_tag="CNE_BB1p02930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687755.1"
                     /db_xref="GI:339328063"
                     /db_xref="GeneID:10915273"
                     /translation="MRVAAPRIWPGSSNRRPRRSVAQAERDAGLRQDGLTTAERQELT
                     RLRRENRQLKMEREILAKAAAWFARETDRLPDKGTNS"
     gene            292275..297860
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /db_xref="GeneID:10915274"
     CDS             292275..297860
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodV"
                     /protein_id="YP_004687756.1"
                     /db_xref="GI:339328064"
                     /db_xref="GeneID:10915274"
                     /translation="MRFAEARGDHSIYTARLLKEAVKNQPMHSVFRFDADRLVSFQVL
                     WKDGERVLGRGWRLAADGQREAVLALWLATEHPMPANLGRLAHEFSLKEALDPAWAAR
                     PLELVREHGRTVLLLEDPGGEPLDRLMGTPMEAGRFLRLAIAMSGALGQFHQRGFIHK
                     DLKPAHILVNQADGAVRLTGFGLASRLLRETQAPTQPDEIAGTLAYMAPEQTGRMNRS
                     VDARSDLYALGVTLYQMLTGTLPFSAGNPMDWVHCHLARQPMAPAERVPASPVQLSAV
                     VMKLLAKTAEERYQTAGGLEADLRRCLAAWESRGRIDTFAPGEHDLPDRLMIPERLYG
                     RDREIGVLLGAFDRVVSGGAPELVLVSGYSGIGKTSVVHELHRALVPHRGLFASGKFD
                     QYKRDIPYATLAQALQGLVRPLLGKSEAELAPWRAALAEALGPNIGLMVPLIPELALI
                     LGPQPPMSEVPPRDEQHRFQLVFRRLIGVFAQAAHPLALFLDDLQWLDAATLDLLEHL
                     ATQPEVRHLLLIGAYRDNEVTPGHPLLARLTAIRQGGASVGEIMLTSLGRDDVGRLLG
                     DALHCTPERGEALARLVHEKTAGNPFFAIQFLTALAEEGLFAFNHREARWSWDLGQIR
                     AKGFTDNVVDLMLGKLGRLPAATQEALKQLACLGNEAAVGIMTMVLGGSEGTLDAALW
                     EAVQGGLVLRREETYRFPHDRVHEAAYALIAEAARPAAHLAIGRRLAAHTSQEALAER
                     VFEIVGQLNRGAALITAPEERWRLAELNLLAGQRAKGSTAYASALAYLATGAALLPAD
                     AWECRHALAFALAFERAACEFLTGASGAAEPRLADLASRVVGLPELAAVTQLRLEHFM
                     ALGQRGRAVEVGLDYLRRAGVEWSAHPAKAEVEQEYARMWRQIGDRPIDALIDLPRMA
                     DPDAVGTMDVLTALMPPAWYTDENLRALVIGRMANLSLEHGNSDASCLGYAWLSMVLA
                     PQSGDYAAGYRFGKLGLDLVDQRGLDRFKARVYQVVGGHVLQWTHPIRDASSLVRRGF
                     DLSNKQGDRTFAAFTSNNLITHLLASGAPLADMEREAEAAIAFAREAGFGLVVDRITP
                     QRQLARTLRGLTSVFGSFNDSGFDEDRFERHLEQDRGLALVTCWYWIRKLQARFFAAD
                     HAGAIAAAERARPLLWTSPSFFEQAEYHFYAALARAACCDAVAAADRVRHLEALAGHH
                     RQLQAWAEHCPGNFENRAALIGAEIARMGGREADAMRLYEQAILSARDNDFIHNQALA
                     NELAARFYAARGFEKIAWVYLRDARHGYRRWGAEGKVRQLDGLYPALGEEESAPASTR
                     TIGASVEHLDLATVIAVSQAVSGEIFLDKLVDTLMRTAIEQAGAQRGLLILHQGAGLR
                     IAAEATTCGHAITVQLHDQSVPGTALPLSILHHVLRSRETVVLDNAEAQGPFSVDPYI
                     RLHRARSILCLPLLTQAKLIGVLYLENSLAPRVFVPARAAVLKLVASQAATALENSRL
                     YRDLEQREAKIQRLVEANIIGICIWQLDGRILEANDAFLRMSGYDREDLRSGRLGWAD
                     LMPASAQAPGAPLAAFSVAGTVPPFEKDLVRKDGRRVPVLLGSANFEDGVDQGVSFVL
                     DLTERKRAEQALHQARAELAHVARVTTLNALTASIAHEVSQPLAAIVANASAALRWLG
                     RQPPDLAEVREAVEGIVQNGHRASAVIEGMRGLLRKTAAVTVRLDLNELVKETITLIS
                     GEVSRHQILLRTELAPGLPLVAGDRVQLQQVLLNLVMNGIEAMTEVADRPRELVIRSL
                     CAKPQTVRVAVEDAGIGLAPQVMERVFDAFYTTKAQGLGMGLAICQSLVESHGGRLWA
                     SANSPCGSVFQFALPARQE"
     misc_feature    292584..>293183
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="Serine/threonine protein kinase [General function
                     prediction only / Signal transduction mechanisms /
                     Transcription / DNA replication, recombination, and
                     repair]; Region: SPS1; COG0515"
                     /db_xref="CDD:223589"
     misc_feature    <292632..293153
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    order(292641..292643,292647..292649,292755..292757,
                     292761..292763,292767..292772,292776..292778,
                     292812..292814,292821..292823,292878..292889)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(292641..292643,292647..292649,292755..292757,
                     292761..292763,292767..292769,292821..292823,
                     292878..292889)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(292809..292829,292878..292889)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    293265..293834
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    293268..295502
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG3899"
                     /db_xref="CDD:226415"
     misc_feature    296313..296780
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    296775..297140
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    296817..297104
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(296856..296858,296868..296870,296886..296888,
                     296928..296939,297015..297017,297030..297032)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(296919..296921,296931..296933,296955..296957,
                     296964..296969,297051..297053,297057..297059)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    297534..297842
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(297552..297554,297564..297566,297573..297575,
                     297657..297659,297663..297665,297669..297671,
                     297675..297680,297741..297752,297798..297800,
                     297804..297806,297819..297824,297828..297830)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    297564..297566
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(297669..297671,297675..297677,297741..297743,
                     297747..297749)
                     /gene="nodV1"
                     /locus_tag="CNE_BB1p02940"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            298273..299334
                     /locus_tag="CNE_BB1p02950"
                     /db_xref="GeneID:10915275"
     CDS             298273..299334
                     /locus_tag="CNE_BB1p02950"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687757.1"
                     /db_xref="GI:339328065"
                     /db_xref="GeneID:10915275"
                     /translation="MLEQRVVLAVEVRRFKCTNAGCPRCTFAENIHALAGRHQRRTRS
                     QARALHALGHALGGEAAARLANALGMRTSADTVLRELRRAPGRKRKPRPRVVGIDDWA
                     IARGHQYGTIIVNLERREPIEVFAGRGTTAVTAWVRARSSIEIVARDGAGAYSEAVDI
                     ALPAARQASDRWHLLCNLRDNVERLLCRLGPQLRQAAQQVEVRGVTLGRQRELSRNSL
                     WSWQRLSDQRRASRLELYERVMALHAQGGTMKGIGQELSIDHRTVRNFITAGAFPERA
                     PRARGPTPLDAHLRPGACSDGSSDGGSSPSRNLRAPTTSASCRRFARTNPWWAKFAAS
                     RGSFSDSCTGEVRGSSIDG"
     misc_feature    298279..>298983
                     /locus_tag="CNE_BB1p02950"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    298558..>298791
                     /locus_tag="CNE_BB1p02950"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            299327..299551
                     /locus_tag="CNE_BB1p02960"
                     /db_xref="GeneID:10915276"
     CDS             299327..299551
                     /locus_tag="CNE_BB1p02960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687758.1"
                     /db_xref="GI:339328066"
                     /db_xref="GeneID:10915276"
                     /translation="MAKASVTLRRCGNAQIRAKLRADLPAVRAAFKLPWSNGQTEGHV
                     NRLKFLKRQMYGRASIELLRLRVPIAIAGG"
     misc_feature    <299366..299524
                     /locus_tag="CNE_BB1p02960"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    <299384..299527
                     /locus_tag="CNE_BB1p02960"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            complement(299760..300440)
                     /locus_tag="CNE_BB1p02970"
                     /db_xref="GeneID:10915277"
     CDS             complement(299760..300440)
                     /locus_tag="CNE_BB1p02970"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687759.1"
                     /db_xref="GI:339328067"
                     /db_xref="GeneID:10915277"
                     /translation="MKITKAQAQANRQHVVETASQLFRERGYDGVGVADLMAAAGFTH
                     GGFYKQFRSKADLMAESATCGIAQTVALSAGVNAPEFVRYYLSREHRDKRGTGCTMAA
                     LGGDAARQPEAVRATFAAGIESLLAALKPDGTASDGADPGRLRAQSLDILAHAVGAIV
                     MSRACPDDSPLADEILKVCRDEILASLRAAATASASSLERSASSIQQPADPQNANGGG
                     KLPTRTAT"
     misc_feature    complement(299913..300440)
                     /locus_tag="CNE_BB1p02970"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(300261..300398)
                     /locus_tag="CNE_BB1p02970"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            300572..301654
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /db_xref="GeneID:10915278"
     CDS             300572..301654
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase NemA"
                     /protein_id="YP_004687760.1"
                     /db_xref="GI:339328068"
                     /db_xref="GeneID:10915278"
                     /translation="MNDKTLFEPYALGRLALANRIVMAPLTRNRAGAGLVPSELAATY
                     YAQRASAGLIITEATQVSAQAQGYQDTPGLYTPEQVVGWRKVTEAVHAKGGRIFAQLW
                     HVGRVSHVDVQPDGAAPVAPSAIRAATKTFVNNGFVDVSQPRALELNELPGIVNDFRR
                     AAANALAAGFDGVEIHGANGYLLEQFIKDGANQRTDPYGGSIENRARLLLEVVTAVVE
                     EIGADRTGVRISPVSPANGISSSDPQPQYDYIADQLSALGIVYLHVVEGATGGPRAVA
                     PFDYDALRRRFRQTYLANNGYDLELATARLNEGKADLFAFGRAFISNPDLVERLKTGA
                     PLAQPDLATLYGGGAAGYSDYPTITA"
     misc_feature    300584..301591
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(300644..300646,300650..300652,300743..300745,
                     300869..300871,301253..301255,301454..301456,
                     301514..301516,301520..301528)
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(300644..300646,300650..300652,300743..300745,
                     300869..300871,300875..300877,300896..300898,
                     301097..301099,301106..301108,301112..301114,
                     301253..301255,301274..301276,301454..301456,
                     301514..301516,301520..301525)
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(300650..300652,300875..300877,301097..301099,
                     301106..301108,301112..301114,301523..301525)
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    301112..301114
                     /gene="nemA2"
                     /locus_tag="CNE_BB1p02980"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
     gene            301708..302496
                     /locus_tag="CNE_BB1p02990"
                     /db_xref="GeneID:10915279"
     CDS             301708..302496
                     /locus_tag="CNE_BB1p02990"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_004687761.1"
                     /db_xref="GI:339328069"
                     /db_xref="GeneID:10915279"
                     /translation="MTTLPTVLITGASSGIGATYAARFAGRGHNLVLVARDKTRLDTL
                     AARLRAENGVSVDVLQADLTQPADLAVVETRLRDDSRIGILINNAGMAQSGDFLQQSA
                     EGIDRLVTLNTTALTRLAAAVAPRFVQSGNGAIVNIGSVVGFAPEFGMSIYGATKAFV
                     LFLSQGLNLELSPSGVYVQAVLPASTRTEIWGRAGIDVNMLPEVMEVDELVDAALVGF
                     DRRELVTIPPLHVAGRWDALDGARQGLMSDIRQARAADRYRSEA"
     misc_feature    301720..302484
                     /locus_tag="CNE_BB1p02990"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    301726..302352
                     /locus_tag="CNE_BB1p02990"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(301738..301740,301744..301755,301810..301818,
                     301888..301896,301969..301977,302038..302040,
                     302119..302127,302164..302166,302176..302178,
                     302254..302265,302269..302274)
                     /locus_tag="CNE_BB1p02990"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(302041..302043,302125..302127,302164..302166,
                     302176..302178)
                     /locus_tag="CNE_BB1p02990"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            302576..303487
                     /locus_tag="CNE_BB1p03000"
                     /db_xref="GeneID:10915280"
     CDS             302576..303487
                     /locus_tag="CNE_BB1p03000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687762.1"
                     /db_xref="GI:339328070"
                     /db_xref="GeneID:10915280"
                     /translation="MTNLQNLDTNDVRTMPLKALQTTYVHVPTNLVSAAGTTFAYREL
                     GHRGGVPLVLLNHWGAVLDNFDPQIVDGLAREHHVITIDYRGIGLSGGTAPVTVDEMA
                     RDTIAVIRAMGFEQIDLFGFSLGGFVAQDVALKAPGLVRRLILTGTGPAGGQGIDHVG
                     PVSWPLILKGLLTRHDPKTYLFFTATENSRQAAGAFLNRLKERRAGRDKGPTPRAFLR
                     QLKAIKAWGQQVPQDLAGLHMPVLIVNGDNDIMVPTPLSRDMARRIPHAQLVIYEDAG
                     HGSIFQYHADFVPKALAFLAAFTPHWH"
     misc_feature    302726..303406
                     /locus_tag="CNE_BB1p03000"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    302729..303439
                     /locus_tag="CNE_BB1p03000"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            303493..304494
                     /locus_tag="CNE_BB1p03010"
                     /db_xref="GeneID:10915281"
     CDS             303493..304494
                     /locus_tag="CNE_BB1p03010"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-type alcohol dehydrogenase-like protein"
                     /protein_id="YP_004687763.1"
                     /db_xref="GI:339328071"
                     /db_xref="GeneID:10915281"
                     /translation="MKALTFKRYGNSPEIGFADVPRPTLKPDDLLVQVHAAGLNPIDN
                     MIPAGTFKPVLKFELPATLGSDIAGVVVEVGSHVTRFKPGDAVFASLFDLGRGSLAEF
                     AAVPEGVAALKPARLDFVQAASVPMVGLTSWQALKERANVRAGQKVLIPAGSGGIGTF
                     AIQLAKSLGATVGTTTSTGNVQMVADLGADEVVDYRKQDFEKLLHDYDVVLGTLRGDA
                     IAKSVGILKPGGRIVSLIGPLDAAFARARRLNFFLAFVFSLMSRKIMRLARKRNINYS
                     FLFVRPDGAQLWEIGGLLESERIRPVIDKVFAFEQAKEALEYLAQGRAKGKVVVRVK"
     misc_feature    303493..304488
                     /locus_tag="CNE_BB1p03010"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    303493..304482
                     /locus_tag="CNE_BB1p03010"
                     /note="alcohol dehydrogenase and quinone reductase-like
                     medium chain degydrogenases/reductases; Region:
                     MDR_like_2; cd05289"
                     /db_xref="CDD:176191"
     misc_feature    order(303610..303618,303625..303627,303871..303873,
                     303883..303885,303949..303966,304021..304026,
                     304030..304032,304072..304074,304129..304134,
                     304195..304200,304324..304332)
                     /locus_tag="CNE_BB1p03010"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176191"
     gene            complement(304543..305334)
                     /locus_tag="CNE_BB1p03020"
                     /db_xref="GeneID:10915282"
     CDS             complement(304543..305334)
                     /locus_tag="CNE_BB1p03020"
                     /EC_number="2.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="MocR family transcriptional regulator"
                     /protein_id="YP_004687764.1"
                     /db_xref="GI:339328072"
                     /db_xref="GeneID:10915282"
                     /translation="MSPWFREGRYKATCVRSQDVCALSRAPPPAPWLSPGPTGVSMTL
                     PRRTALLDWAEAAGGWILEDDYDGEYRYRGPPLPALKSLDRHERVVYCGTFSKVLFAG
                     LRLGYVVVPDSQIAAFTAACRRSLHGGCPELMQAVVADFIEEGHFARHIKRMRALYAK
                     RGNLCAVPAPSVSGGPKPRDEARRLQQPARKFRRWRLPNVVDRHTLIVAMFGDQLQIG
                     LPHIRADEFDLGGDLGADEGGQRTSRSSRSCVPCRPTANGCNQPR"
     misc_feature    complement(<304843..>305271)
                     /locus_tag="CNE_BB1p03020"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(<304843..>305226)
                     /locus_tag="CNE_BB1p03020"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(304924..304926,304933..304935,
                     305023..305031,305155..305157))
                     /locus_tag="CNE_BB1p03020"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(305023..305025,305044..305049,
                     305053..305055,305134..305136))
                     /locus_tag="CNE_BB1p03020"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(305044..305046)
                     /locus_tag="CNE_BB1p03020"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            306040..307311
                     /locus_tag="CNE_BB1p03030"
                     /db_xref="GeneID:10915283"
     CDS             306040..307311
                     /locus_tag="CNE_BB1p03030"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator type"
                     /protein_id="YP_004687765.1"
                     /db_xref="GI:339328073"
                     /db_xref="GeneID:10915283"
                     /translation="MTETKSMTKKSKKSSAPKLFPDELIDQLLAQVQNKDAESILGES
                     GLAGLLKKQLAERMLAAELTHHLASEAKQGKSGNHRNGSSAKTVITPNGELELDIPRD
                     RQATFEPQLVAKYQRRLSGFDDHVISMYARGMSVREIQGHLQELYGLQVSPDLISTIT
                     DEVLAEVDQWQQRPLEAMYPIVYFDALRLKIRDEGTVRNKAVYLALGIRADGRKEVLG
                     LWIEQTEGAKFWLKVFNELKNRGLDDILVAVVDGLRGFPEAIEAVYPGAQIQTCIVHL
                     IRNSLNLASWKDRKGLAAALKPIYQAATADAAAGALQAFAASDWGRKFPTVADMWRRQ
                     WEQVIPFFAYPPEVRRIIYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNI
                     EKDWKMPPITWKQAANQFAILFGDRFTNALR"
     misc_feature    306100..307230
                     /locus_tag="CNE_BB1p03030"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    306136..307284
                     /locus_tag="CNE_BB1p03030"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            307410..307658
                     /locus_tag="CNE_BB1p03040"
                     /db_xref="GeneID:10915284"
     CDS             307410..307658
                     /locus_tag="CNE_BB1p03040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687766.1"
                     /db_xref="GI:339328074"
                     /db_xref="GeneID:10915284"
                     /translation="MPETLTADTAFIAAATLHDYGKGKTLQNADANITLDRDTLDDIA
                     LGKLKLRELTASGKVTFDGNRGDKFRCSPCSTSSTSGS"
     misc_feature    <307452..307607
                     /locus_tag="CNE_BB1p03040"
                     /note="SCP-2 sterol transfer family; Region: SCP2;
                     cl01225"
                     /db_xref="CDD:260844"
     gene            complement(307741..308184)
                     /locus_tag="CNE_BB1p03050"
                     /db_xref="GeneID:10915285"
     CDS             complement(307741..308184)
                     /locus_tag="CNE_BB1p03050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687767.1"
                     /db_xref="GI:339328075"
                     /db_xref="GeneID:10915285"
                     /translation="MATIIQYLRSYGDCVHHPREDVAYALLVERDPGTRIIISRLLQE
                     HRVIATVGAELLDRLREAQSEVVTSRAALEAAAAMYLVYYRNHLSTEEKQVMPRAARF
                     LTEADWAEVAATDPASADPLFGANVQKRFATLRKQIDSEANASMH"
     misc_feature    complement(307783..>308175)
                     /locus_tag="CNE_BB1p03050"
                     /note="Hemerythrin family; Region: Hemerythrin-like;
                     cl15774"
                     /db_xref="CDD:265780"
     gene            complement(308570..309652)
                     /locus_tag="CNE_BB1p03060"
                     /db_xref="GeneID:10915286"
     CDS             complement(308570..309652)
                     /locus_tag="CNE_BB1p03060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687768.1"
                     /db_xref="GI:339328076"
                     /db_xref="GeneID:10915286"
                     /translation="MQPFIYQTHPQRIVFRAGALATLGAEADTLHARKLLVLCTPQQR
                     DLAERAAEVLGARCAGIFDGAVMHVPVEQARLARSCAAELGADAVVAIGGGSTIGLGK
                     AIALESDLPILAVPTTYAGSEMTPIYGLTEGGLKRTGRDARVLPRTVVYDPDLTLGLP
                     VAMSVTSGINAIAHAAEGLYAGDRTPVSDWMCREGIAALGRALPVIATAGGERDSAQL
                     RAARSDALYGAWLCGAVLGSATVGLHHKLCHTLGGSYNLPHAETHTIVLPHALAYNAP
                     AAPQAMAAIAAALGRPDATGPQAVFDLAASLGAAVALRDIGMREKDLDRACELALLAQ
                     YPNPRPLAQREIRQLLDDAFHGQRPG"
     misc_feature    complement(308600..309625)
                     /locus_tag="CNE_BB1p03060"
                     /note="Maleylacetate reductase is involved in many
                     aromatic compounds degradation pathways of aerobic
                     microbes; Region: MAR; cd08177"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(308876..308878,308906..308908,
                     308918..308920,309131..309133,309143..309145,
                     309164..309166,309188..309190,309242..309247,
                     309293..309295,309299..309304,309347..309349,
                     309356..309358,309365..309373,309533..309535))
                     /locus_tag="CNE_BB1p03060"
                     /note="active site"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(308696..308698,308702..308704,
                     309170..309175,309527..309529))
                     /locus_tag="CNE_BB1p03060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173936"
     misc_feature    complement(order(308876..308878,308918..308920,
                     309131..309133,309143..309145))
                     /locus_tag="CNE_BB1p03060"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173936"
     gene            308921..309853
                     /gene="pcpE"
                     /locus_tag="CNE_BB1p03070"
                     /db_xref="GeneID:10915287"
     CDS             308921..309853
                     /gene="pcpE"
                     /locus_tag="CNE_BB1p03070"
                     /EC_number="1.3.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="2-Chloromaleylacetate/maleylacetate reductase
                     PcpE"
                     /protein_id="YP_004687769.1"
                     /db_xref="GI:339328077"
                     /db_xref="GeneID:10915287"
                     /translation="MQANSGAAQHGAAEPGAIQRIAPGRAQLGAVPLATGCRDHRKRT
                     SQRRDAFPAHPVADGRPIARVQPFGGVGNGVDAAGHAHRHRQAEGQVGVVDYRPRQHA
                     CIAPGTLQAAFGQAVDRRHLRAGVGRRDGKDGQVRFEGNGLAKPDGRAAADRHHGIGA
                     EFRRAGPRQPRLLHRHVHDSAIEDAGAARAQHLGGALGQVALLGGAEHQQLACVQGVG
                     FGAERRERAGTEHNTLRVGLVDKGLHDARHLFNDDMTRLDKPAPADGFFPYQLVGLGA
                     VAGDDIEAAVAEYLADGRIAQRGVDLGGEPAEDV"
     gene            complement(309665..310669)
                     /locus_tag="CNE_BB1p03080"
                     /db_xref="GeneID:10915288"
     CDS             complement(309665..310669)
                     /locus_tag="CNE_BB1p03080"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004687770.1"
                     /db_xref="GI:339328078"
                     /db_xref="GeneID:10915288"
                     /translation="METTAAKTIRRFALLRLAAAALVTVTAASMSPASARAETWPAKP
                     VTLIVPYAAGGTVDKVARQIQEGLRKRLAQPVMIDNRAGAGGTIGTAQIARSAADGYT
                     IGMVFDGFATESHIYPKLPYASQKDLTGVSYMVRSPMVLVVPASSPYKTLQDYVAAAK
                     KPDTVSYASVGAGSSNQLVAELFHEAAGTSGTHTPYKGGGPAINDLLGGHVDSMIASL
                     PLVMPYVQAGKLRALAVTAAQRDARLPGVPAVAESYKGFEAYSWVAMIAPARTPLNVL
                     GRLAAEVNATLRDPAIGKVLSDGGFDVIAGDSAQANKLIREESVRWGRLIKSRHIVIE
                     "
     misc_feature    complement(309677..310492)
                     /locus_tag="CNE_BB1p03080"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            310761..311768
                     /locus_tag="CNE_BB1p03090"
                     /db_xref="GeneID:10915289"
     CDS             310761..311768
                     /locus_tag="CNE_BB1p03090"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687771.1"
                     /db_xref="GI:339328079"
                     /db_xref="GeneID:10915289"
                     /translation="MLDWAASCGKPVRLRNAFAEIAKMEFSRFAENLSIFVEVAQSGS
                     FSAVARQRGLVASSVARQIDTLERELGVPLFTRSTRALVRTDAGELLFARATRILHEL
                     SDTRDAVTALEQGVSGLIRVACLPAFGRRHVVPHLGALYAQYPRLTVELALTERIVDP
                     VVERFDVVIRVGQQADSSLVARCISSQRYIICATPGYLALYGRPAHADEIGRHRLIDR
                     GHSTSMRGWRELLTPAHAAEATFALECDDCDARRLSVLQGLGIALMPDWSVGPDIGAG
                     RLVELALDGLLPQVPGGIYLLRATQHASAKVKAFCTHLTASMGSPPTWQQAMAGEAVL
                     A"
     misc_feature    310851..311732
                     /locus_tag="CNE_BB1p03090"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    310857..311027
                     /locus_tag="CNE_BB1p03090"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    311112..311702
                     /locus_tag="CNE_BB1p03090"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(311142..311144,311154..311156,311271..311273,
                     311313..311315,311319..311321,311502..311504,
                     311553..311555,311640..311642)
                     /locus_tag="CNE_BB1p03090"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(311145..311150,311160..311165,311169..311174,
                     311181..311183,311193..311195,311199..311219,
                     311400..311402,311484..311498,311517..311522,
                     311529..311531)
                     /locus_tag="CNE_BB1p03090"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            312241..312558
                     /locus_tag="CNE_BB1p03100"
                     /db_xref="GeneID:10915290"
     CDS             312241..312558
                     /locus_tag="CNE_BB1p03100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687772.1"
                     /db_xref="GI:339328080"
                     /db_xref="GeneID:10915290"
                     /translation="MGRRYRDGDRACRPSARGDRRARAWQLDALTVASDRPYLVRALV
                     LLAGPAGKVPKGVDAVPIPAEVRAQIKRCEDTSLPDACAYTRCSSRPATTLSLGCWAG
                     TLN"
     gene            complement(313268..313387)
                     /locus_tag="CNE_BB1p03110"
                     /db_xref="GeneID:10915291"
     CDS             complement(313268..313387)
                     /locus_tag="CNE_BB1p03110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687773.1"
                     /db_xref="GI:339328081"
                     /db_xref="GeneID:10915291"
                     /translation="MFQNELMKIETTIFAELTSSRRSYLCDSTSSDHPTEEKQ"
     gene            313564..314523
                     /locus_tag="CNE_BB1p03120"
                     /db_xref="GeneID:10915292"
     CDS             313564..314523
                     /locus_tag="CNE_BB1p03120"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS5 family"
                     /protein_id="YP_004687774.1"
                     /db_xref="GI:339328082"
                     /db_xref="GeneID:10915292"
                     /translation="MRKDNRQQAEPKGVYRVKNWAQYNKGLIARGDVTMWVEESLLVP
                     PAKAQSSKRGHPLVYTDALIQGLLGLKQVFHLPLRALQGFAQSLRTLAFPTLPVPNYT
                     TLSRRAQNLNVVLPASRTGEPLHLVIDSTGLKLYGEGEWKVRKHGWSKRRTWRKVHLA
                     MDANTGQICAALMTHQDVGDGEVLADLLDQIPADTPIDTIGGDGAYDSKPCHAEIAAR
                     GARPSIPPRDGAKPWSESTPGAAWRNDAIDVIEKSSRGEWKAASGYHRRSLAETLMYR
                     LKTLTGHSLWAREIGSQAAEVAIRAGVLNRMVALARPQSVRIA"
     misc_feature    313645..313977
                     /locus_tag="CNE_BB1p03120"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:258032"
     misc_feature    313924..314478
                     /locus_tag="CNE_BB1p03120"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(314826..314948)
                     /locus_tag="CNE_BB1p03130"
                     /db_xref="GeneID:10915293"
     CDS             complement(314826..314948)
                     /locus_tag="CNE_BB1p03130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687775.1"
                     /db_xref="GI:339328083"
                     /db_xref="GeneID:10915293"
                     /translation="MVEIPSSENVFVRQLTSIGDFHSITDEVFEIIEYAMMVAI"
     gene            complement(315258..315371)
                     /locus_tag="CNE_BB1p03140"
                     /db_xref="GeneID:10915294"
     CDS             complement(315258..315371)
                     /locus_tag="CNE_BB1p03140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687776.1"
                     /db_xref="GI:339328084"
                     /db_xref="GeneID:10915294"
                     /translation="MNVESFLSQFEWQMLVTSRDLMRILYPRYIFCLYRRK"
     gene            315910..316071
                     /locus_tag="CNE_BB1p03150"
                     /db_xref="GeneID:10915295"
     CDS             315910..316071
                     /locus_tag="CNE_BB1p03150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687777.1"
                     /db_xref="GI:339328085"
                     /db_xref="GeneID:10915295"
                     /translation="MANIFQEVAHDSFFFVDDDDENIKSAKEYGFYVHRYVDHFDFLS
                     DLKKWSLRR"
     gene            316068..317801
                     /locus_tag="CNE_BB1p03160"
                     /db_xref="GeneID:10915296"
     CDS             316068..317801
                     /locus_tag="CNE_BB1p03160"
                     /EC_number="2.1.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyltransferase"
                     /protein_id="YP_004687778.1"
                     /db_xref="GI:339328086"
                     /db_xref="GeneID:10915296"
                     /translation="MNIIGIHDGHTSSAALIRDGRIFGILQEERYTRTKNQGGFPKYA
                     ANEILDLAGLSWSDVDTVAFSTRKFRNEAMRDRKEVMAVFDHLFRGTRPAKARDTAIE
                     SFDATKDPVDRSARLRAAGYAGPIEFVDHHTCHASATYFSRGHFDQGPCAVLTCDGQG
                     DGASGSVFVGEGYTLTAKCHIPRDDSVAQLYSYLTYLLGFVPLEHEYKLMGLAPYATS
                     SDGAREISQFFSAMFKQSAAGEFAWRRAEGIPPSELQPEFLEQKLKRRRFDELAAGLQ
                     IFFEEFVTDWALNVTRELRTDKLAVAGGAFMNVKLNQRLSQHPSIGDFYVIPSCGDES
                     NSLGAAWALSSRFGITPEGGMRNIYCGRRYGPDEFELALGDLKGADVTVAQPESIDDA
                     VAELLAAGEIVARYASGAEFGARALGNRSILSHPSSLSNLQEINSAIKSRDFWMPFAP
                     SVLDIGVDRLLSTKAPPHSPHMMISFDTTLEGAKLLAAAIHPKDKTCRAQILQREDNE
                     SYYRLIQRFHILTGIPAVLNTSFNIHGEPIVETPADAVSVFSRSGLRTLALGPYLLTK
                     NDRHGCPENLA"
     misc_feature    316068..317765
                     /locus_tag="CNE_BB1p03160"
                     /note="BadF/BadG/BcrA/BcrD ATPase family; Region:
                     BcrAD_BadFG; cl17271"
                     /db_xref="CDD:266600"
     gene            317776..318642
                     /gene="murB"
                     /locus_tag="CNE_BB1p03170"
                     /db_xref="GeneID:10915297"
     CDS             317776..318642
                     /gene="murB"
                     /locus_tag="CNE_BB1p03170"
                     /EC_number="1.1.1.158"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase
                     MurB"
                     /protein_id="YP_004687779.1"
                     /db_xref="GI:339328087"
                     /db_xref="GeneID:10915297"
                     /translation="MDARKISHDVNLEYANSYRLISMCEELLLPHCVEDVVDMFERSG
                     AAPFPILGHGSNVILARSHYPRVMKIGRRFSSLQRLEEHLLYVDAGASLHRVALACER
                     FGLAGFEYLGNIPGSVGGGIVMNAGAFGHDIASVVQAVRVYAIRARQVIELSHAECGW
                     GYRSSIFQNEAYVVLGAYFRLRDAAPQFLRAQRLSNLALRRQRFPRSEPNAGSVFKRP
                     SHGLRIGEMIERMGHKGRSIGTAEISAKHPGFIVVKRPGCASDICALIAFMQREIRRH
                     FDVETEVEQKIL"
     misc_feature    317788..318639
                     /gene="murB"
                     /locus_tag="CNE_BB1p03170"
                     /note="UDP-N-acetylmuramate dehydrogenase [Cell envelope
                     biogenesis, outer membrane]; Region: MurB; COG0812"
                     /db_xref="CDD:223882"
     misc_feature    317854..318201
                     /gene="murB"
                     /locus_tag="CNE_BB1p03170"
                     /note="FAD binding domain; Region: FAD_binding_4; cl19922"
                     /db_xref="CDD:268275"
     misc_feature    318331..318639
                     /gene="murB"
                     /locus_tag="CNE_BB1p03170"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     C-terminal domain; Region: MurB_C; pfam02873"
                     /db_xref="CDD:251582"
     gene            318674..319381
                     /locus_tag="CNE_BB1p03180"
                     /db_xref="GeneID:10915298"
     CDS             318674..319381
                     /locus_tag="CNE_BB1p03180"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase family protein"
                     /protein_id="YP_004687780.1"
                     /db_xref="GI:339328088"
                     /db_xref="GeneID:10915298"
                     /translation="MEVYQKHSHVSAKIDAGIRWDFESSHSSDISRIWTFLTERQPKI
                     FNGPVLMSHDMSGDDLSLEVHLLRTSYAAFMAWRELNHPIKSAKLCFPIAAVKTSDDF
                     FLLGTMASHTSNAGLSYFPSGTLNDDDVLQDGTVALEHSLVREVKEETGLTHEDFELA
                     NGWTRVENDVRCAFFKEARLKLSRAEVSERIGTFLKDQVDPELSRVLFVKYPSDLAGL
                     KLPAVQREYFERVLPDR"
     misc_feature    318950..319369
                     /locus_tag="CNE_BB1p03180"
                     /note="NUDIX domain; Region: NUDIX; pfam00293"
                     /db_xref="CDD:249747"
     misc_feature    319097..319123
                     /locus_tag="CNE_BB1p03180"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            319496..320023
                     /gene="tdo"
                     /locus_tag="CNE_BB1p03190"
                     /db_xref="GeneID:10915299"
     CDS             319496..320023
                     /gene="tdo"
                     /locus_tag="CNE_BB1p03190"
                     /EC_number="1.13.11.11"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan 2,3-dioxygenase Tdo"
                     /protein_id="YP_004687781.1"
                     /db_xref="GI:339328089"
                     /db_xref="GeneID:10915299"
                     /translation="MKNTHWGLPYAAVLAEPTTAAQQPPHPSPPPPPQAKRRDQLNKA
                     LAEPSLYDDVLSYLNRNGFGVPVAVLDRDFSVPYEPRKAVEKVWRDIYADQNGDLELQ
                     ELRETLADIAEGSSTWKYLHLMATRRTFGDRPAYFGTEGVAWLVPTMDKIPFPELWSA
                     RGFIGDPPAACPHMH"
     misc_feature    <319613..319978
                     /gene="tdo"
                     /locus_tag="CNE_BB1p03190"
                     /note="Tryptophan 2,3-dioxygenase; Region:
                     Trp_dioxygenase; cl03994"
                     /db_xref="CDD:243604"
     gene            320743..321897
                     /locus_tag="CNE_BB1p03200"
                     /db_xref="GeneID:10915300"
     CDS             320743..321897
                     /locus_tag="CNE_BB1p03200"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687782.1"
                     /db_xref="GI:339328090"
                     /db_xref="GeneID:10915300"
                     /translation="MNADHATELHAEDAILAVSLELSAAQWKVALHDGFREQPAVHSV
                     GALQAASRLQAVLDLIEQQKRKWSLPSHVRVVVSYEAGQDGFWILRSLRSRGIDCYMV
                     DAASIPVERHKRRAKTDRLDAIKLVTNLRAWLHGERDRMRVVRAPSLQDEASRHLIRD
                     RGQLQKEVMQHRDRMRKLLVTVGCWDEVDHRAFAKRLARGELTCHDGSPLPDELRERL
                     LRESHRLELAEQQLKDLQRTLHDRLPEPVRERITWLKRLRGVGDIGASRLMLELFWRQ
                     FRNRRQLGACVGLVPQPYDSGQSRVDQGISKQGNRRVRVQLIEMAWGWLRYQPGSALT
                     RWFNERTQGTGPNRRARRIAIVALARRLVIALWRYLTEGIIPDGAQFKLA"
     misc_feature    320794..321264
                     /locus_tag="CNE_BB1p03200"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    320959..321852
                     /locus_tag="CNE_BB1p03200"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    321502..321738
                     /locus_tag="CNE_BB1p03200"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(322228..322611)
                     /locus_tag="CNE_BB1p03210"
                     /db_xref="GeneID:10915301"
     CDS             complement(322228..322611)
                     /locus_tag="CNE_BB1p03210"
                     /codon_start=1
                     /transl_table=11
                     /product="prophage maintenance system killer protein"
                     /protein_id="YP_004687783.1"
                     /db_xref="GI:339328091"
                     /db_xref="GeneID:10915301"
                     /translation="MSGRDYLTVADVLGMHTALMQRYGGAPGVRDPGALESALFRPQT
                     GYYEDIVAEAAAALESLAINHPFVDGNKRIAFAAADVFLRINGWRLQRPSMQIHIEII
                     QMLESGTFDIAHLEPWLRAFARPTA"
     misc_feature    complement(322243..322599)
                     /locus_tag="CNE_BB1p03210"
                     /note="Fic/DOC family; Region: Fic; cl00960"
                     /db_xref="CDD:260722"
     gene            complement(322618..322848)
                     /locus_tag="CNE_BB1p03220"
                     /db_xref="GeneID:10915302"
     CDS             complement(322618..322848)
                     /locus_tag="CNE_BB1p03220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687784.1"
                     /db_xref="GI:339328092"
                     /db_xref="GeneID:10915302"
                     /translation="MTTVAREKFSSQAAPEVLAALRQIAEAQGRQFQAVLDEALRDYI
                     DRQQRERPRRHVMASFASSLDEFDSLYRELAK"
     gene            complement(323026..324327)
                     /locus_tag="CNE_BB1p03230"
                     /db_xref="GeneID:10915303"
     CDS             complement(323026..324327)
                     /locus_tag="CNE_BB1p03230"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004687785.1"
                     /db_xref="GI:339328093"
                     /db_xref="GeneID:10915303"
                     /translation="MELLPLPPLDGPAAPLPTALPIPLERLRLPPALSGVAGSNRASA
                     NATRIAAADDLAAVTAWLARYADSAATLTAYRREVERLLLWAVLQLGKPLSSLTHEDL
                     LTYERFLADPQLAARWVLAGGKKLARSHPDWRPFAGPLAPRSVRQALVILNALFAWLT
                     EAGYLAGNPLALARRRRTPTQPRITRYLSHELWDAVKETIEAMPGATDTATERERLHA
                     ARCRWLLTVLYLGGLRAAEVTGTAMGAFFCRRDAQGVERWWLEVTGKGNKTRLVPATD
                     ELIAELARYRRAHGLAPTPHPGETRPLLLPVIGREGREHRDKGLSRGALHLILKEVFG
                     LAAARLRARGPDWEAQADVLASASAHWLRHTAGSHMTDRQVDLRYVRDNFGHTSISTT
                     SAYLHTEDDARHQATQERHRIGWAAPAGTPAHAVAAKATGN"
     misc_feature    complement(323125..324183)
                     /locus_tag="CNE_BB1p03230"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    complement(323137..323769)
                     /locus_tag="CNE_BB1p03230"
                     /note="INT_SG1, DNA breaking-rejoining enzymes,
                     integrase/recombinases subgroup 1, C-terminal catalytic
                     domain. The CD contains mainly predicted
                     integrase/recombinase and site-specific XerD recombinases.
                     The members of this CD are found predominantly in...;
                     Region: INT_SG1_C; cd01183"
                     /db_xref="CDD:238588"
     misc_feature    complement(order(323143..323145,323170..323172,
                     323239..323241,323248..323250,323533..323535,
                     323626..323628))
                     /locus_tag="CNE_BB1p03230"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238588"
     gene            complement(324429..324806)
                     /gene="pilT"
                     /locus_tag="CNE_BB1p03240"
                     /db_xref="GeneID:10915304"
     CDS             complement(324429..324806)
                     /gene="pilT"
                     /locus_tag="CNE_BB1p03240"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilT"
                     /protein_id="YP_004687786.1"
                     /db_xref="GI:339328094"
                     /db_xref="GeneID:10915304"
                     /translation="MRILLDTHVFLWAVTNDPKLSQTAQQLILDAEEVFISAASIWEI
                     SIKAGLDKIEVDVDELIAEITAAGFRELPVTNTHAAAVRHLPNHHRDPFDRLLVAQAI
                     TEPLRLLSADEHVWKYSDLVIRV"
     misc_feature    complement(324432..324800)
                     /gene="pilT"
                     /locus_tag="CNE_BB1p03240"
                     /note="PIN domain of the VapC-like Sll0205 protein and
                     homologs; Region: PIN_Sll0205; cd09872"
                     /db_xref="CDD:189042"
     misc_feature    complement(order(324471..324473,324525..324527,
                     324678..324680,324789..324791))
                     /gene="pilT"
                     /locus_tag="CNE_BB1p03240"
                     /note="putative active site [active]"
                     /db_xref="CDD:189042"
     gene            complement(324806..325042)
                     /locus_tag="CNE_BB1p03250"
                     /db_xref="GeneID:10915305"
     CDS             complement(324806..325042)
                     /locus_tag="CNE_BB1p03250"
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin of toxin-antitoxin system, phd type"
                     /protein_id="YP_004687787.1"
                     /db_xref="GI:339328095"
                     /db_xref="GeneID:10915305"
                     /translation="MRTVNIHEAKTHLSRLIEEVAAGDEVVIAKAGKPVVRIVPFAKP
                     KPRRRLGGLQGKIRTADDFDAPLPDDLLAAFEGR"
     misc_feature    complement(324815..325042)
                     /locus_tag="CNE_BB1p03250"
                     /note="Antitoxin of toxin-antitoxin stability system [Cell
                     division and chromosome partitioning]; Region: Phd;
                     COG4118"
                     /db_xref="CDD:226603"
     gene            complement(325275..326453)
                     /locus_tag="CNE_BB1p03260"
                     /db_xref="GeneID:10915306"
     CDS             complement(325275..326453)
                     /locus_tag="CNE_BB1p03260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687788.1"
                     /db_xref="GI:339328096"
                     /db_xref="GeneID:10915306"
                     /translation="MSELIPARADYGSMHGDIVALLEDARRAAARSVNVLMTATYWEI
                     GRRIVEFEQGGQDRAGYGQALLKRLSADLSRRFGRGFSERNLEQMRLFYQAWPIDHIS
                     QTPSAKLPTARISQTPSAISTGDEISKALSRNSLDLSELAKAFPLPWSAYVRLLSVRN
                     EMARGFYETEALRCGWSVRQLDRQINSQFYERIALSRNKAAMLQKGEVAESVEVITPE
                     QAFKDPLVLEFLNLKDEYSESDLEEALIQHLADFLLELGDDFAFVGRQRRLRIDDSWF
                     RVDLLFFHRQLKCLLVIDLKIGKFSHADAGQMHMYLNYAREHWMKPGENPPVGLILCA
                     SKGSNEAHYALEGLPNKVLAAEYQTVLPNENLLAAELARTRQELEARLGRLNDAGSGE
                     "
     misc_feature    complement(325332..326414)
                     /locus_tag="CNE_BB1p03260"
                     /note="Protein of unknown function (DUF1016); Region:
                     DUF1016; cl19557"
                     /db_xref="CDD:267910"
     gene            complement(326854..327396)
                     /locus_tag="CNE_BB1p03270"
                     /db_xref="GeneID:10915307"
     CDS             complement(326854..327396)
                     /locus_tag="CNE_BB1p03270"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004687789.1"
                     /db_xref="GI:339328097"
                     /db_xref="GeneID:10915307"
                     /translation="MRAAEVTGTAMGAFFFRRDAQGVERWWLEVTGKGNKTRLVPATD
                     ELIAELARYCRGHGLPPTPHPGETRPLLLPVIGRETGGDKALSRGALHLILKEVFGMA
                     AERLRARGPEWEAQAAVLASASAHWLRHTAGLTDQQVDLRFVRDNFGHASIATTSAYL
                     HSEEDARHRIGWGTSNKESP"
     misc_feature    complement(326914..327396)
                     /locus_tag="CNE_BB1p03270"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(326920..326922,327019..327027,
                     327298..327300,327388..327393))
                     /locus_tag="CNE_BB1p03270"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(326920..326922,326947..326949,
                     327010..327012,327019..327021,327298..327300,
                     327391..327393))
                     /locus_tag="CNE_BB1p03270"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(326920..326922,326947..326949,
                     327010..327012,327019..327021,327391..327393))
                     /locus_tag="CNE_BB1p03270"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(327419..327706)
                     /locus_tag="CNE_BB1p03280"
                     /db_xref="GeneID:10915308"
     CDS             complement(327419..327706)
                     /locus_tag="CNE_BB1p03280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687790.1"
                     /db_xref="GI:339328098"
                     /db_xref="GeneID:10915308"
                     /translation="MNSVSTLDIYMEHAGPVALWDPTDPSVPTDAPKRVMQGRRRGAS
                     PVVAISDSRRALSGSANRAQGMIFRSHIGRSLAPTPPLSASACMRRAAAGC"
     gene            complement(327862..329625)
                     /locus_tag="CNE_BB1p03290"
                     /db_xref="GeneID:10915309"
     CDS             complement(327862..329625)
                     /locus_tag="CNE_BB1p03290"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004687791.1"
                     /db_xref="GI:339328099"
                     /db_xref="GeneID:10915309"
                     /translation="MSATTTQDINGIALGVLVCSRDGSTVAAVGACSDPAIADAAVTA
                     CAHAKAPSQGRKLFPVEAGTRRFIGLCLEDDDHRLILLHRADTQAVLLDFLGTVPFAG
                     AILDYFLNDPYQAITVVDKEGRVRFISPVHEKFLGLDTGAGIGRPAAEVIPNSRLPQV
                     VASGKAEIGQLQQLDGVTRVVNRMPIRQDGEVVGAIGQVMFKGPEALVRMHKELVELR
                     SEVARYQREFDHLRDGLHERQPTFGLIGESAPMQRLRREIQTVARLDVPVLILGESGT
                     GKELVARAIHGAGAAPASVRPLVSLNLAALPATLIESELFGHAPGAFTGSQRQGQAGK
                     LELAAGGTVFLDEVADIPLEMQVKLLRVLEDHMVERLGSRRSQRVDFRLVSATNRDIP
                     ELIDAGRFRLDLYYRLSGVVLRIPALRQRREDIPALLQHFVDAFCARNAMPAPDVDHD
                     VARYLASQPWPGNVRQLRQRIEEALVFCNGRTLRVADFARGESARTLSGLESQPPVPA
                     AEQAYPHETFAANDPPSPASAPRLTSEPAAGMRELAYAAVMDAVARHGGNKKRAAEQL
                     RISRSHLYKILERGPRASGSK"
     misc_feature    complement(329038..329313)
                     /locus_tag="CNE_BB1p03290"
                     /note="PAS domain; Region: PAS_10; pfam13596"
                     /db_xref="CDD:257911"
     misc_feature    complement(327889..329121)
                     /locus_tag="CNE_BB1p03290"
                     /note="Transcriptional regulators containing an AAA-type
                     ATPase domain and a DNA-binding domain [Transcription /
                     Signal transduction mechanisms]; Region: PspF; COG1221"
                     /db_xref="CDD:224142"
     misc_feature    complement(328399..328875)
                     /locus_tag="CNE_BB1p03290"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(328789..328812)
                     /locus_tag="CNE_BB1p03290"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(328462..328464,328588..328590,
                     328786..328809))
                     /locus_tag="CNE_BB1p03290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(328585..328602)
                     /locus_tag="CNE_BB1p03290"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(328405..328407)
                     /locus_tag="CNE_BB1p03290"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(327889..328008)
                     /locus_tag="CNE_BB1p03290"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            329772..331352
                     /locus_tag="CNE_BB1p03300"
                     /db_xref="GeneID:10915310"
     CDS             329772..331352
                     /locus_tag="CNE_BB1p03300"
                     /EC_number="2.1.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA carboxyltransferase 12S
                     subunit"
                     /protein_id="YP_004687792.1"
                     /db_xref="GI:339328100"
                     /db_xref="GeneID:10915310"
                     /translation="MYRTKTQERTVSWQPEIDELVYRRRLAARMGGEGKVERHKAAGK
                     LTVRERIDALADPGSFREVGGLTGSGRYDSNGRLLDLVPSNLVMGRAEVGGRPAVLVG
                     DDFTVRGGANEGAVGDKLIHAEKMAHDLRLPMVRLVDGTGGGGSVRNIEIKGHTLIPT
                     MKVWQHVVENMSVVPVVSLALGSVAGMGAARVAASHYSVMVRETSQLFNEGPPSVVAR
                     VGEELSKNELGGSQIHTRNGVVDDEVETEQEAFARARQFLSYLPPSVFELPPRREPGD
                     DPARRDEWLLSAIPRDSRADYKIRPIVQALVDADSFFEIGMRWGCAVITALARLDGWP
                     VAVIASDPCFHGGSWDSASAEKFTRFVDMAQAFHLPVVNLVDTAGFQVGLEAEKAGIM
                     RYGVRALAALYQATVPWCSVILRRAYGVSAAGHQHMGRFNFRYAWPSANWGALPIEGG
                     LDVAYRAEIEGADDPVQKRAEIELRVRSLTSPFRSAEAFVIEDIIDPRETRTLLCEFA
                     NLAAPLREAGTSQFGIRP"
     misc_feature    329814..>330200
                     /locus_tag="CNE_BB1p03300"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    329817..331349
                     /locus_tag="CNE_BB1p03300"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    <330735..>331100
                     /locus_tag="CNE_BB1p03300"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            331336..334725
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /db_xref="GeneID:10915311"
     CDS             331336..334725
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /EC_number="6.3.4.14"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase"
                     /protein_id="YP_004687793.1"
                     /db_xref="GI:339328101"
                     /db_xref="GeneID:10915311"
                     /translation="MAYGPELAPCQTRHRHPNTNEETALKKLLIANRGEIALRVLRAA
                     RDLGTGTVAVYSQDDQGALHRILADEAVALDGAGPAAYIDIPGIIAAAKAASCDAIHP
                     GYGFLSERADFAQACHDAGIRFIGPTVEQLALFGDKGRALELAADSDVPVMPATRGAA
                     SLEEIASFFDKQGGAGVVIKAVGGGGGRGMRVVRRREELAEAYARCRSEAGSAFGIDA
                     VYAERLVARARHIEVQIAGDGTHVIALGERDCTLQRRFQKLVEIAPSPVLKPQLREQI
                     IKAALRLARRVNYQSLGTFEFLVEETESGEQKDFVFIEANPRLQVEHTITEQVTGVDL
                     VALQIGIAAGQTLSELGLDPAAPPQPRGYAIQVRINAEMTDAQGLARPAHGRLERFDP
                     PSGPDVRVDSHGYAGYEPSPNFDTLLAKLIVSSATPKFDAAVRRLQRSLAEFRIAGVP
                     TNLNLLRALVQRDDFLVQDVHTRHFEAIVPELTASAQAIAQAGCTQEALLGGSAGASH
                     AHAPRHAEPEEEVSEGLVAIRAPLTGRVVEIGVALDEIVKPGQTVAVLDAMKMEHAIV
                     AACGGRVVDLRLEPGALAAENQMLIVLEQLEADGISVAAVQQADPNAIRPDLQRVLDR
                     HAYLDDAVRPDAVARRRSRGQRTARENVADMCDPDTFVEYGALALAAQASRRSQQDLI
                     VNTPADGLITGIGNINGELVGKERARSAVMAYDATVLAGTQGKRNHIKTDRIVEVALR
                     DELPLVLFGEGGGGRPGDVDFPSVSGLYQPSFAAFAELSGNVPVVGIVSGRCFAGNAA
                     FLGCCDVIIADKSANIGMAGPAMIEGGGLGIFSPEEVGPASVQHANGVVDILVGNEAE
                     AVQAARHYLSMFQGRVAHWSAPEALALRHVVPENRLRVYDTRKAIEGIADVGSVLMLR
                     GGFGAGIHTALARVEGQPVGIMANNPYHLGGAIDADAADKASRFMQLCDAHGLPIISL
                     IDTPGFMVGPEVEARAQVRHVSRMFLTAAKLRVALLAVTLRKGYGLGAMAMAGGGFRS
                     ASFTVSWPTGEFGPMGLEGAVRLGFKKELEAVPDGPERKALFDRLVAQSYERGHAINT
                     AAAVEIDAVIDPAQTRKWIAQGIASAELRSRRERRGFIDAW"
     misc_feature    331408..332763
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK08591"
                     /db_xref="CDD:236307"
     misc_feature    331408..331728
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    331744..332385
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    332431..332763
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; pfam02785"
                     /db_xref="CDD:251532"
     misc_feature    <332845..333117
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Biotin carboxyl carrier protein [Lipid metabolism];
                     Region: AccB; COG0511"
                     /db_xref="CDD:223585"
     misc_feature    332914..333114
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    order(332983..332985,333010..333018,333037..333039)
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    333013..333015
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     misc_feature    333181..334707
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    <333274..333804
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    <333676..334014
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cl18948"
                     /db_xref="CDD:267301"
     misc_feature    order(333682..333684,333745..333756,333790..333795,
                     333811..333813,333817..333825,333829..333834,
                     333910..333915,333919..333924,333934..333939,
                     333946..333948,333985..333987)
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    333718..333720
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    <334105..>334413
                     /gene="accC"
                     /locus_tag="CNE_BB1p03310"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            334769..337240
                     /gene="frc2"
                     /locus_tag="CNE_BB1p03320"
                     /db_xref="GeneID:10915312"
     CDS             334769..337240
                     /gene="frc2"
                     /locus_tag="CNE_BB1p03320"
                     /EC_number="2.8.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl-coenzyme A transferase Frc"
                     /protein_id="YP_004687794.1"
                     /db_xref="GI:339328102"
                     /db_xref="GeneID:10915312"
                     /translation="MIKHGIDPAQLALGGLRVLEVGSGPALAYAGKLFSDFGAEVIKV
                     ESPAGDTWRQMPPLVSIADAAQPESALFAWLNTNKRSVTADDGNAEDGVWLAQLARTC
                     DVVLDARALTEGPGILGTPLWQRAADETSGHEPIEVALTWFGESGPYSHYAGAEAVCR
                     GLAGAVHGSGPADGPPHMPHDVQSAIVFGLSAFSAAVAALIGRGQGSRRYVLSAHESI
                     FSVVEMEAGMVQDRRHPLQRLGVNRFCGTHPAGIYQTAEGWIGIFTHTLPQWQGLCEA
                     IGRSELGNDPRYASGPERMARADEIDALLMPAFLARTARQWFEILGDKKHPAVIVPTM
                     ETLLGQEVHRQRGAFVPVGVGDASFEGPVVPLRLDAAGPLPGGNAPAKGAHDLHYRTS
                     GLDHRPRLSLKRTAGERLPLQGLRMVDLTMGWAGPLAARTLADFGAEIIKVESTGYPD
                     WWRGANFTEAFYRDRLYEKNSNFNLMNRNKQGITLDLTRPEGKQVLLQLVESADAVIE
                     NYSAEVLPKLGLDYEALRARNERLVMLSMPAFGLGNAWSNTRAYGGTLEQASGLPLYT
                     GHPDGPPAMTSYAYGDPIGGLNGGAAILLALFAQQATGQGRHINLSQVEAMLPMAAPF
                     MLEQSISGAVSPRQGNRHPMHSPHGCFRCAGDDAWIVLTVTDADWPALCRAIGRADLA
                     TDPRLTQASGRRAEENRIEQAITSWCVVRDAEAAMQLLQQAGIASGVVRPMSQVLQDP
                     HLRARGFWREVERAHIGTYTSSTAWFRTGPDPVPIRHVAPTLGEHTEAVLSRVLGLST
                     DQVASLERQGITGTVAKPKRAKEMP"
     misc_feature    334787..335923
                     /gene="frc2"
                     /locus_tag="CNE_BB1p03320"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     misc_feature    335999..337195
                     /gene="frc2"
                     /locus_tag="CNE_BB1p03320"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            337284..338312
                     /locus_tag="CNE_BB1p03330"
                     /db_xref="GeneID:10915313"
     CDS             337284..338312
                     /locus_tag="CNE_BB1p03330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687795.1"
                     /db_xref="GI:339328103"
                     /db_xref="GeneID:10915313"
                     /translation="MNKPTWIQRCQASAKTGKFSMAAAALGILATTMAAPAAAQSTGW
                     PSKPIRMIVPFPAGSFTDTVARILSERLSKSLGQPVVVENKAGANGLIGVGEAARAAP
                     DGYTLLVTNSSSITINPQIYKKGTYSPKDFTPVTLVLEAPFILVTNPDWSQKNAVGTV
                     PELVRYATQHPGKVSYGSAGPGNIAHLSFAMLNNRAKIKTTHIPYKSAAQAQLAVISG
                     ELDTAFDTWTALPQIKAGKLKPLAVSASKRMTQLPDVPTLEELGISPFNVTFWIGMLA
                     PAGTPPQIVQRLHSVTQGLLEDGKAKTALGQQGDVVMIDPANFSKRVEKEEVNWTAVI
                     QREGITLD"
     misc_feature    337473..338300
                     /locus_tag="CNE_BB1p03330"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(338500..338850)
                     /locus_tag="CNE_BB1p03340"
                     /db_xref="GeneID:10915314"
     CDS             complement(338500..338850)
                     /locus_tag="CNE_BB1p03340"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_004687796.1"
                     /db_xref="GI:339328104"
                     /db_xref="GeneID:10915314"
                     /translation="MDIKPIRTELDYDTAMDRIGQLWGAPVGSPEGDELEVLSILVER
                     YEEEHYPIPPSDPVEAIKFRLDQQGLTTRDLEPFIGSSGRVSEVLNRKRKLSLSMVKR
                     LHDGLRIPYESLLS"
     misc_feature    complement(338506..338844)
                     /locus_tag="CNE_BB1p03340"
                     /note="Predicted transcription regulator containing HTH
                     domain [Transcription]; Region: COG5499"
                     /db_xref="CDD:227786"
     gene            complement(338850..339152)
                     /locus_tag="CNE_BB1p03350"
                     /db_xref="GeneID:10915315"
     CDS             complement(338850..339152)
                     /locus_tag="CNE_BB1p03350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687797.1"
                     /db_xref="GI:339328105"
                     /db_xref="GeneID:10915315"
                     /translation="MRIIARRTLREFWESDPAYADAISPLTEWYRHMEKVTYATPQDV
                     KAELRTASILKGGRVVFNIAGNKYRLILAIDYERQIGWVRFVGTHAQYDKVDAESV"
     misc_feature    complement(338865..339092)
                     /locus_tag="CNE_BB1p03350"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2136); Region: DUF2136; pfam09907"
                     /db_xref="CDD:150566"
     gene            complement(339371..339670)
                     /locus_tag="CNE_BB1p03360"
                     /db_xref="GeneID:10915316"
     CDS             complement(339371..339670)
                     /locus_tag="CNE_BB1p03360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687798.1"
                     /db_xref="GI:339328106"
                     /db_xref="GeneID:10915316"
                     /translation="MPALPAKHYAAELQRQLRSLLGHEQIITQAYGRHLLIKRLDDEE
                     PTVVARLTELGRNRYGAAFRTHSGRWEPLPGAGSLDEMAEPVVTLLQPYLQPDNY"
     gene            complement(339683..340099)
                     /locus_tag="CNE_BB1p03370"
                     /db_xref="GeneID:10915317"
     CDS             complement(339683..340099)
                     /locus_tag="CNE_BB1p03370"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687799.1"
                     /db_xref="GI:339328107"
                     /db_xref="GeneID:10915317"
                     /translation="MIAALDVHTGQVLAECRDRRTQDDLVAFMERVATAYPGKQVHVV
                     WDNLNTHCAQAVWQAFNARHDERFHFHFTPLHASWVNQIELWFARYTRRVLRHASHTS
                     IAHLRERTEQFVRAHNQAARPFKWSFRGYPLQTGAS"
     misc_feature    complement(339779..>340099)
                     /locus_tag="CNE_BB1p03370"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     cl19249"
                     /db_xref="CDD:267602"
     gene            complement(340096..340974)
                     /locus_tag="CNE_BB1p03380"
                     /db_xref="GeneID:10915318"
     CDS             complement(340096..340974)
                     /locus_tag="CNE_BB1p03380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687800.1"
                     /db_xref="GI:339328108"
                     /db_xref="GeneID:10915318"
                     /translation="MARAADLSQSTVTRIWRAFGLQPHRQETFKLSSDPLFVEKVRDI
                     VGLYLDPPLKAMVLCVDEKSQIQALDRTQPILPMAPGIPERRTYDYMRHGTTTLFAAL
                     DIATGKVIGELHRRHRSSEFLQFLRTIEANVPPKLDVHLVMDNYGTHKTASIKAWFAR
                     HPRFHVHFTPTSASWINQVERWFATITEQYIRRGSHRSTRQLEQAIRQYLDLNNANPT
                     PFVWTKSADDILASIKRFCLRISDSGQRLGARWCSVSTRRPAFRPSNVSTRDGHPRRG
                     DCVVVNLNIFVTAPRR"
     misc_feature    complement(340366..340806)
                     /locus_tag="CNE_BB1p03380"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            complement(341146..342405)
                     /locus_tag="CNE_BB1p03390"
                     /db_xref="GeneID:10915319"
     CDS             complement(341146..342405)
                     /locus_tag="CNE_BB1p03390"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase mutator family"
                     /protein_id="YP_004687801.1"
                     /db_xref="GI:339328109"
                     /db_xref="GeneID:10915319"
                     /translation="MPRKTKTSQAADRELPAIPEDLIAHFVKGPMTAEAVQDASMAFK
                     KALIERALGAELGHHLGYQPGAERPAGTANQRNGKSAKTVLTEDGPLRVDIPRDRDGS
                     FDPILIPKHERRFTGFDDKIIAMYARGMTVREIQAFLAEQYGTEVSPEFISSVTDAVM
                     DEVTAWQARPLEVMYPVVFFDALRVKMREDGVVRNKAVYLALGVLPDGTRDILGLWIE
                     TTEGAKFWMKVFNDLKTRGTQDILIAVTDGLKGMEQALAAVFPNTTLQTCIVHLIRNS
                     LEYASWKERRAVAAALKPVYTAPTVEAALAELAAFEQGEWGKRYTPIAASWRRAWDQV
                     IPFFTFPPAIRKIIYTTNAIESVNAQLRKIIKTRGHFPSDEAATKLLWLALRNITGKW
                     GSSTHDWKAAMNQFAILYEERFTHPHR"
     misc_feature    complement(341230..342327)
                     /locus_tag="CNE_BB1p03390"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; pfam00872"
                     /db_xref="CDD:250193"
     misc_feature    complement(341170..342282)
                     /locus_tag="CNE_BB1p03390"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(342426..342716)
                     /locus_tag="CNE_BB1p03400"
                     /db_xref="GeneID:10915320"
     CDS             complement(342426..342716)
                     /locus_tag="CNE_BB1p03400"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687802.1"
                     /db_xref="GI:339328110"
                     /db_xref="GeneID:10915320"
                     /translation="MRGRPKAELILSEAEREQLKALTMRRKTAQALALRARIVLASAE
                     GLDNKTVAAKQRVDVHTVSKWRSRFVADRLDGLLDAPRPGAPGPVRNFVFRA"
     misc_feature    complement(342483..342623)
                     /locus_tag="CNE_BB1p03400"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     misc_feature    complement(<342459..342614)
                     /locus_tag="CNE_BB1p03400"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     gene            complement(342885..343721)
                     /locus_tag="CNE_BB1p03410"
                     /db_xref="GeneID:10915321"
     CDS             complement(342885..343721)
                     /locus_tag="CNE_BB1p03410"
                     /EC_number="2.7.7.2"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN adenylyltransferase"
                     /protein_id="YP_004687803.1"
                     /db_xref="GI:339328111"
                     /db_xref="GeneID:10915321"
                     /translation="MQVTRQADALRLAASVVSIGTFDGVHRGHRAVLAALRAAGRSLG
                     LPTVLLTFDPHPRALLQPQSAPRMISTVDDRIALLADSGAVDHCLVLPFDQALSEASA
                     DDFVRGLLLARLGMRRLVVGANFRCGRGRQGDVDYLGQLGKAHGYAVEPAQLHATNAT
                     GTDVRCSSTEARRLIQSGNVRAAAALLARPHEIRAMVVAKTPARASGAAEIRLPQDIC
                     LPPVGQYAGAVRTQTDTPHWRPALVQLGDADGLARVFSDAQFAPMPGSALSVRFFSSA
                     AA"
     misc_feature    complement(343128..343679)
                     /locus_tag="CNE_BB1p03410"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    complement(order(343218..343226,343260..343262,
                     343350..343352,343635..343637,343644..343646,
                     343653..343664))
                     /locus_tag="CNE_BB1p03410"
                     /note="active site"
                     /db_xref="CDD:185679"
     gene            complement(343813..344784)
                     /locus_tag="CNE_BB1p03420"
                     /db_xref="GeneID:10915322"
     CDS             complement(343813..344784)
                     /locus_tag="CNE_BB1p03420"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687804.1"
                     /db_xref="GI:339328112"
                     /db_xref="GeneID:10915322"
                     /translation="MDTIPQRHEDELSLNQLLVLDVLLSERSLTKAARVLNLTQPALS
                     KTLARLRQYFGDPLFVRVGLRMEPTPKALGLAEPVRGILQSVRALRSDHVGFDPRTSQ
                     RSFSFFLLDAGASQMLPPLLSQLAEEAPGILVQAVNADATHLDIWLENGLVDLAIGSF
                     PGLTQSIRRQLLWHETYGAVVRKDHPRLAQLGDLDAFVAEKHVLVSAVGTGHQHLSIE
                     RAIEAAVPHTNIICRVPSFATAGLIAKHSDAVAVLPLTLARALCKDLNLTVVAPPLTL
                     PGMDIAQHWHDRVHREPGNQWIRALVHRLFARHDAVAGAAAGSNMEG"
     misc_feature    complement(343852..344751)
                     /locus_tag="CNE_BB1p03420"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(344569..344745)
                     /locus_tag="CNE_BB1p03420"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(343867..344472)
                     /locus_tag="CNE_BB1p03420"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that are involved in
                     the catabolism of dinitrotoluene, naphthalene and
                     gamma-hexachlorohexane; contains the type 2 periplasmic
                     binding fold; Region: PBP2_DntR_NahR_LinR_like; cd08459"
                     /db_xref="CDD:176148"
     misc_feature    complement(order(343942..343944,344149..344151,
                     344260..344262,344434..344436,344446..344451,
                     344455..344457))
                     /locus_tag="CNE_BB1p03420"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176148"
     misc_feature    complement(order(344005..344007,344047..344049,
                     344056..344061,344068..344073,344080..344094,
                     344182..344184,344371..344373,344377..344391,
                     344395..344400,344407..344412,344416..344421,
                     344428..344433,344440..344445,344452..344454))
                     /locus_tag="CNE_BB1p03420"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176148"
     gene            344935..345486
                     /gene="rutF"
                     /locus_tag="CNE_BB1p03430"
                     /db_xref="GeneID:10915323"
     CDS             344935..345486
                     /gene="rutF"
                     /locus_tag="CNE_BB1p03430"
                     /EC_number="1.5.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-flavin reductase RutF"
                     /protein_id="YP_004687805.1"
                     /db_xref="GI:339328113"
                     /db_xref="GeneID:10915323"
                     /translation="MSSAVFIEAGANRFTDAAIDATSFRDALSRAVTAVTVIATDGAG
                     GRAGVTCSAVCSVSDSPPTVLFCINRRSAANSVIKSNGVVSINWLHASQTAVSQLFAG
                     AGAVPMAQRFDGDGWGVFGTGAPYSKSAMVALDCKVVDQLEIGTHSVFVAQVLGSSGA
                     ESSNDTPLVYCRRSYATTQPVAA"
     misc_feature    344989..345459
                     /gene="rutF"
                     /locus_tag="CNE_BB1p03430"
                     /note="Flavin Reductases; Region: FlaRed; cl00801"
                     /db_xref="CDD:260629"
     gene            345625..347178
                     /gene="tcpA"
                     /locus_tag="CNE_BB1p03440"
                     /db_xref="GeneID:10915324"
     CDS             345625..347178
                     /gene="tcpA"
                     /locus_tag="CNE_BB1p03440"
                     /codon_start=1
                     /transl_table=11
                     /product="2,4,6-trichlorophenol monooxygenase"
                     /protein_id="YP_004687806.1"
                     /db_xref="GI:339328114"
                     /db_xref="GeneID:10915324"
                     /translation="MIRTGKQYLESLNDGRNVWVGNEKIDNVATHPKTRDYAQRHADF
                     YDLHHRPDLQDVMTFVDKDGERRTMQWFGHFDKEQLRRKRKYHETIMREMAGASFPRT
                     PDVNNYVLQTYIDDPSPWETQTIGAEGKVKAKNIVDFVNFAKKHDLNCAPQFVDPQMD
                     RSNPDAQQRSPGLRVIEKNDKGIIVSGVKAIGTGVAFADWIHIGVFFRPGIPGDQIIF
                     AATPVNTPGVTIVCRESVVKEDPIEHPLASQGDELDGMTVFDNVFIPWSHVFHLGNPE
                     HAKLYPQRVFDWLHYHALIRQSVRAELMAGLAILITEHIGTNKIPAVQTRVAKLIGFH
                     QAMLAHIVASEELGFHTPGGAYKPNILIYDFGRALYLENFSQMIYELVDLSGRSALIF
                     ASEDQWNDEALNGWFERMNNGPVGQPHDRVKIGRVIRDLFLTDWGNRLFVFENFNGTP
                     LQAIRMLTMQRAEFSAAGPYGTLARKVCGIELSEGHESEYKATAGYAQALDSARHQEK
                     LALSGTMTV"
     misc_feature    345634..346437
                     /gene="tcpA"
                     /locus_tag="CNE_BB1p03440"
                     /note="4-hydroxyphenylacetate 3-hydroxylase N terminal;
                     Region: HpaB_N; pfam11794"
                     /db_xref="CDD:256625"
     misc_feature    <346141..>346548
                     /gene="tcpA"
                     /locus_tag="CNE_BB1p03440"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    346450..347034
                     /gene="tcpA"
                     /locus_tag="CNE_BB1p03440"
                     /note="4-hydroxyphenylacetate 3-hydroxylase C terminal;
                     Region: HpaB; pfam03241"
                     /db_xref="CDD:251823"
     gene            347241..347831
                     /gene="tcpB"
                     /locus_tag="CNE_BB1p03450"
                     /db_xref="GeneID:10915325"
     CDS             347241..347831
                     /gene="tcpB"
                     /locus_tag="CNE_BB1p03450"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase TcpB"
                     /protein_id="YP_004687807.1"
                     /db_xref="GI:339328115"
                     /db_xref="GeneID:10915325"
                     /translation="MQSNELLDKIFRGARSQNGWLPTPVPDSKLRELYDLMKFGPTSV
                     NCSPARLVFVRTEEGRAKLRPALAPGNVEKTMAAPVVAIVGYDTRFYEQLPALFPHNP
                     AVKAWFEGDEKVDFANTTAFRNGTLQGGYLIAAARALGLDCGPMSGFNNQAVDQAFFA
                     GTSIRSNFICGLGHGDPEKVFARSPRLSFEQACQLA"
     misc_feature    347259..347819
                     /gene="tcpB"
                     /locus_tag="CNE_BB1p03450"
                     /note="Nitroreductase-like family 5.  A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_5; cd02148"
                     /db_xref="CDD:239061"
     misc_feature    order(347280..347282,347286..347288,347292..347294,
                     347370..347372,347679..347684)
                     /gene="tcpB"
                     /locus_tag="CNE_BB1p03450"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239061"
     gene            347849..348679
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /db_xref="GeneID:10915326"
     CDS             347849..348679
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /codon_start=1
                     /transl_table=11
                     /product="6-chlorohydroxyquinol-1,2-dioxygenase TcpC"
                     /protein_id="YP_004687808.1"
                     /db_xref="GI:339328116"
                     /db_xref="GeneID:10915326"
                     /translation="MQEYDQHNLTKAVIARLANTPNARTKQIMTSLVRHLHDFAREVR
                     LTEAEWKQGIDYLTATGQMCDDKRQEFILLSDVLGLSMLTVAMNQEKPEGCTEATVFG
                     PFHVEGAPHYEHGADVANGAKGVPCMVYGRVKGVDGRPIAGAVVETWQADADGHYDVQ
                     YERLEVAQGRGVLKSGDDGRFHFRTIVAQAYPIPDDGPVGELLRATGRHPWRPAHLHF
                     MIKAPGYETLVTHVFRRGDKYLDSDAVFGVRKSLIGDWVRQTDGTYRLDFDFVLNPTR
                     "
     misc_feature    347867..348664
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /note="Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes
                     the ring cleavage of hydroxyquinol
                     (1,2,4-trihydroxybenzene), a intermediate in the
                     degradation of a large variety of aromatic compounds
                     including some polychloro- and nitroaromatic pollutants,
                     to form...; Region: 1,2-HQD; cd03461"
                     /db_xref="CDD:239544"
     misc_feature    347912..348670
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /note="chlorocatechol 1,2-dioxygenase; Region:
                     chlorocat_1_2; TIGR02465"
                     /db_xref="CDD:131518"
     misc_feature    order(347918..347920,347924..347926,347930..347932,
                     347936..347941,347957..347959,347969..347977,
                     347993..347998,348071..348076,348095..348097,
                     348110..348112,348470..348472)
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239544"
     misc_feature    order(348074..348076,348155..348160,348317..348319,
                     348419..348421,348482..348484,348491..348493,
                     348497..348499)
                     /gene="tcpC"
                     /locus_tag="CNE_BB1p03460"
                     /note="active site"
                     /db_xref="CDD:239544"
     gene            348795..349757
                     /locus_tag="CNE_BB1p03470"
                     /db_xref="GeneID:10915327"
     CDS             348795..349757
                     /locus_tag="CNE_BB1p03470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687809.1"
                     /db_xref="GI:339328117"
                     /db_xref="GeneID:10915327"
                     /translation="MKVRRARASLPVRFGRLALAAACAAGSMPARATEGGGNSYPIGV
                     DNLYSGLMLPEGANWLLFYQHYDAGSSKDNTGHDNPKLASFHLRLDALAPRLSYVWPG
                     VRVFGANLETRIVVPIVSANLDMSVARPAPLPPLDKGGNKTGLADMTFAPVILGWHSG
                     SFHQMAGVEFHLKTGAYDVHDPVSIGRNYYQIAPSYAFTWFPTRNVDISAKFRYGLNT
                     RNEATQYQSGDEATIEFSAGYHVTPRLTLGLNGYYYVQTTDDTQNGVRVNGNGNRGRV
                     TALGPDICFQLNDKVSFSLKGQFEFGARNRPEGNRIWAMGRISF"
     misc_feature    348882..349754
                     /locus_tag="CNE_BB1p03470"
                     /note="Putative MetA-pathway of phenol degradation;
                     Region: Phenol_MetA_deg; cl01768"
                     /db_xref="CDD:261060"
     gene            349797..350864
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /db_xref="GeneID:10915328"
     CDS             349797..350864
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /EC_number="1.3.1.32"
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetate reductase TftE"
                     /protein_id="YP_004687810.1"
                     /db_xref="GI:339328118"
                     /db_xref="GeneID:10915328"
                     /translation="MKAFQYAARAQRIVFGAGTIRQVGKEIDALGASSVLVLSTPEQR
                     RLAEQVSDLLGARAIGIFDRAVMHVPVETARAACAMAFELGADSVVAIGGGSTTGLAK
                     AIGLEMSLPVLAIPTTYAGSEMTTIYGLTDAGLKRTGTDVRVLPRTVIYDPELTYSLP
                     VAISVTSGINALAHAAEGLYAHDRSPISDLMAGEGIRAIAAALPALVSERDTAALYEA
                     RAQALYGAWLCGAVLGSVGVALHHKLCHTLGGSFNLPHAETHTIILPHALAYNAKAAP
                     GAMAAIAQALGAANAAQGAFDLARTTGAPLGLHQIGMREDALDKACEIALQNQYPNPR
                     PLEAGAIRELLQNAWEGRRPA"
     misc_feature    349827..350834
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /note="Maleylacetate reductase is involved in many
                     aromatic compounds degradation pathways of aerobic
                     microbes; Region: MAR; cd08177"
                     /db_xref="CDD:173936"
     misc_feature    order(349914..349916,350076..350084,350091..350093,
                     350100..350102,350145..350150,350154..350156,
                     350202..350207,350259..350261,350283..350285,
                     350304..350306,350316..350318,350520..350522,
                     350532..350534,350562..350564)
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /note="active site"
                     /db_xref="CDD:173936"
     misc_feature    order(349920..349922,350274..350279,350730..350732,
                     350736..350738)
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173936"
     misc_feature    order(350304..350306,350316..350318,350520..350522,
                     350562..350564)
                     /gene="tftE1"
                     /locus_tag="CNE_BB1p03480"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173936"
     gene            350870..351157
                     /locus_tag="CNE_BB1p03490"
                     /db_xref="GeneID:10915329"
     CDS             350870..351157
                     /locus_tag="CNE_BB1p03490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687811.1"
                     /db_xref="GI:339328119"
                     /db_xref="GeneID:10915329"
                     /translation="MGFLLARVQAAPIAIQIGRHKMWKIPRQYSHFAFGAIQVGVTCA
                     VASAIASMQFVAEGTFVSHWLRAYFFSWVAMLPVVIVAAPVIHWLANRITR"
     misc_feature    350978..351151
                     /locus_tag="CNE_BB1p03490"
                     /note="Protein of unknown function (DUF2798); Region:
                     DUF2798; pfam11391"
                     /db_xref="CDD:256443"
     gene            351913..352413
                     /locus_tag="CNE_BB1p03500"
                     /db_xref="GeneID:10915330"
     CDS             351913..352413
                     /locus_tag="CNE_BB1p03500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687812.1"
                     /db_xref="GI:339328120"
                     /db_xref="GeneID:10915330"
                     /translation="MPRPLPDPTPPSRATIRTIHQLGERIRATRAGEGMPIDQVARHC
                     GVSIGMLSKLENDKGVNLEHALRVMDGLGLTMLVQFAVLIRREVKAWTCRSRRQPYNC
                     HSDSILEFVRWPRYSGLDLGAAVRCPDWNTEHHRFRLRSMSWGRSDHRLAAIARARRD
                     RHAGVG"
     misc_feature    351973..>352140
                     /locus_tag="CNE_BB1p03500"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    351979..352140
                     /locus_tag="CNE_BB1p03500"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(351991..351993,352003..352005,352078..352080)
                     /locus_tag="CNE_BB1p03500"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(352000..352002,352075..352077)
                     /locus_tag="CNE_BB1p03500"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(352021..352026,352057..352059,352066..352068,
                     352078..352083)
                     /locus_tag="CNE_BB1p03500"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            352507..352824
                     /locus_tag="CNE_BB1p03510"
                     /db_xref="GeneID:10915331"
     CDS             352507..352824
                     /locus_tag="CNE_BB1p03510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687813.1"
                     /db_xref="GI:339328121"
                     /db_xref="GeneID:10915331"
                     /translation="MGRRYRDGDRACRPSARGDRRARAWQLDARTVASDRPYLVRALV
                     LLAGPAGKVPKGVDAVPIPAEVRAQIKRCEDTSLPDACAYTRCSSRPATTLSLGCWAG
                     TLN"
     gene            353536..354843
                     /locus_tag="CNE_BB1p03520"
                     /db_xref="GeneID:10915332"
     CDS             353536..354843
                     /locus_tag="CNE_BB1p03520"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase"
                     /protein_id="YP_004687814.1"
                     /db_xref="GI:339328122"
                     /db_xref="GeneID:10915332"
                     /translation="MAADQRSSGSHWSSRRSRSPLWSSRIRRGFQGFQLLGVHGYQGR
                     EAGCFDSVFLADSLALGEGIRHVAGAGLEPITAVAALARATSRIGFIATASTTYSEPF
                     NLARQFASLDHITGGRVGWNIVTSWVQGANQNFGLDQQPPHAERYARAHDFLEATSKL
                     WDSWADDAIIDDAQTGRFADPDRIRPIGHAGPFYKVAGPLNIARGPQGRPVLVQAGSS
                     PAGKAFAARYAEAVFTAHLDKETAVPFYAELKAAARQRGRRDDQIVILPGISPVIGSG
                     DEEAQRNWRELNALTDPEVGRARLSNRFGGFDFSHLDLDTPLSLDDFPDPATVQAAQS
                     RAVVITGLVARERPTLRELLHKLAGARGHFTLAGSPERIADTIEDWFVSGAADVFNVM
                     PPVLPGHLDDFVEHVVPLLQRKGLFRRGYETQTLRAHYGLDRP"
     misc_feature    353668..354786
                     /locus_tag="CNE_BB1p03520"
                     /note="nitrilotriacetate monoxygenase oxidizes
                     nitrilotriacetate utilizing reduced flavin mononucleotide
                     (FMNH2) and oxygen. The FMNH2 is provided by an
                     NADH:flavin mononucleotide (FMN) oxidorductase that uses
                     NADH to reduce FMN to FMNH2; Region:
                     Nitrilotriacetate_monoxgenase; cd01095"
                     /db_xref="CDD:238528"
     misc_feature    order(353746..353748,353905..353907,353971..353973,
                     354190..354195)
                     /locus_tag="CNE_BB1p03520"
                     /note="active site"
                     /db_xref="CDD:238528"
     misc_feature    353812..353817
                     /locus_tag="CNE_BB1p03520"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238528"
     gene            complement(354953..355600)
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /db_xref="GeneID:10915333"
     CDS             complement(354953..355600)
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /EC_number="3.4.19.3"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrrolidone-carboxylate peptidase Pcp"
                     /protein_id="YP_004687815.1"
                     /db_xref="GI:339328123"
                     /db_xref="GeneID:10915333"
                     /translation="MATVLVTGIEPFDGETINPSWEAARRLDGETIDGAAIAARQLPC
                     VIGKVNGVLHDAIEETSPDVVICLGQAGGRSDISVERVGINIVDARIPDNDGHQPVDE
                     PVVPGGPAAYFSTLPIKAVVAALRAHGIPASVSQTAGTYNCNAILYGLSHYIARHRPA
                     MRGGFIHVPYLPEMAARHPGAPSLALDTLVAAVRVIVATSLAVREDVRVSAGALH"
     misc_feature    complement(355016..355594)
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="Pyroglutamyl peptidase (PGP) type I, also known as
                     pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes
                     responsible for cleaving pyroglutamate (pGlu) from the
                     N-terminal end of specialized proteins. The N-terminal
                     pGlu protects these proteins from...; Region:
                     Peptidase_C15; cd00501"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(355172..355180,355469..355471,
                     355565..355567,355574..355576))
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(355046..355048,355052..355057,
                     355076..355078,355082..355087,355202..355216,
                     355223..355225,355373..355381))
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="AC domain interface; other site"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(355100..355102,355172..355174,
                     355361..355363))
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(355181..355183,355190..355195,
                     355244..355246,355262..355273,355298..355303,
                     355331..355333,355337..355339,355343..355345,
                     355355..355360))
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="AB domain interface; other site"
                     /db_xref="CDD:238279"
     misc_feature    complement(355046..355048)
                     /gene="pcp"
                     /locus_tag="CNE_BB1p03530"
                     /note="interchain disulfide; other site"
                     /db_xref="CDD:238279"
     gene            355674..356567
                     /locus_tag="CNE_BB1p03540"
                     /db_xref="GeneID:10915334"
     CDS             355674..356567
                     /locus_tag="CNE_BB1p03540"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004687816.1"
                     /db_xref="GI:339328124"
                     /db_xref="GeneID:10915334"
                     /translation="MKWIFIIHIVNMNLASIDLNLLVAFEALYETRNVTLAGQRLHRA
                     QPSVSNALNRLRALFQDELFVRTAAGMLPTQRADALIPAIRQALAQIRLALEQGVKFD
                     PANAAAQRFTIAASDYTDIVLVPFIVARLRHEAPQIDLRVARLDRAAIWQQLDDGTVD
                     IAIGGHLAPPKRMLVTPLYDERLICIADRRHPGLPGGSLDLRAYIELPHALFVPSDDS
                     SSRGVVDVTLAGLGLRRRVAATFAHIVALPQAVAGTDLVATLAERVAVRLAGKQVVLY
                     PLPNRLCSTRCRQNWVIIVSA"
     misc_feature    355728..355904
                     /locus_tag="CNE_BB1p03540"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    356001..356510
                     /locus_tag="CNE_BB1p03540"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    order(356019..356021,356025..356030,356040..356042,
                     356214..356216,356334..356336)
                     /locus_tag="CNE_BB1p03540"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    order(356022..356024,356031..356036,356043..356048,
                     356055..356060,356064..356069,356076..356081,
                     356085..356099,356103..356105,356295..356297,
                     356385..356399,356406..356411,356418..356423,
                     356430..356432)
                     /locus_tag="CNE_BB1p03540"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            356519..356680
                     /locus_tag="CNE_BB1p03550"
                     /db_xref="GeneID:10915335"
     CDS             356519..356680
                     /locus_tag="CNE_BB1p03550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687817.1"
                     /db_xref="GI:339328125"
                     /db_xref="GeneID:10915335"
                     /translation="MLYPLPPELGDHRFSVDMVCGRRANGNGALEWLRATVSAAAQEL
                     MRRGRTASA"
     gene            357767..357967
                     /locus_tag="CNE_BB1p03560"
                     /db_xref="GeneID:10915336"
     CDS             357767..357967
                     /locus_tag="CNE_BB1p03560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687818.1"
                     /db_xref="GI:339328126"
                     /db_xref="GeneID:10915336"
                     /translation="MAHLTPPSSQKYLMPRDADAVGPQNEAERRLYELIVEGLNSGPG
                     TDYESVADFAVEFRARLQNGKR"
     gene            complement(358774..359652)
                     /locus_tag="CNE_BB1p03570"
                     /db_xref="GeneID:10915337"
     CDS             complement(358774..359652)
                     /locus_tag="CNE_BB1p03570"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase"
                     /protein_id="YP_004687819.1"
                     /db_xref="GI:339328127"
                     /db_xref="GeneID:10915337"
                     /translation="MASRKKLARGAPDWRPFAGPLSPASARHAMVILNTLFAWLVDAG
                     YLAGNPLSLARSRRGQSKPRVTRYLSHAMWQVVKDTIEAMPGANDTATERERLHAARC
                     RWLLTVLYLGGLRAAEVAETRMGAFLCRRDREGVERWWLEVTGKGSKTRLVPATDELM
                     VELARYRRAHGLPPAPHPGEERPILLPIIGKEKPLSRGALHLVLKEIFALAAARLRAR
                     GPEWESRAEVLASASAHWLRHTAGSHMTDQQVDLRFVRDNFGHASISTTSAYLHTEDD
                     VRHRATQERHRIGWKR"
     misc_feature    complement(358837..359451)
                     /locus_tag="CNE_BB1p03570"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(358843..358845,358948..358956,
                     359215..359217,359305..359310))
                     /locus_tag="CNE_BB1p03570"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(358843..358845,358870..358872,
                     358939..358941,358948..358950,359215..359217,
                     359308..359310))
                     /locus_tag="CNE_BB1p03570"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(358843..358845,358870..358872,
                     358939..358941,358948..358950,359308..359310))
                     /locus_tag="CNE_BB1p03570"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(360286..361578)
                     /locus_tag="CNE_BB1p03580"
                     /db_xref="GeneID:10915338"
     CDS             complement(360286..361578)
                     /locus_tag="CNE_BB1p03580"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004687820.1"
                     /db_xref="GI:339328128"
                     /db_xref="GeneID:10915338"
                     /translation="MKQVPHVHPPATRALGSQQPRSMIACRRLLTTMATGAAVAAAAA
                     CGGSSGETAAVSEDATAKQAALVEQGKQIFRFETFGDEAHWTDTLKMHEVIATAVDPV
                     TALSVGLKVDAEALPAAVVEGIRNGTVDLKSPATTVALLKLNAVVGVRGTVETINGVD
                     KLVRVGITCALCHSTVDNSFAPGIGKRLDGWANRDLNPGAIIALSPAMDAAMKKVLNA
                     WGAGKFDPRHNIDGLSKPVVIPPAYGLAGIHRITVTGDGDDIAYWNRYVAVAEMGGLG
                     TVTEPRLNLSITHGTEDLVTSKLPALQAYQLSLKAPAAPAGSFDELAAQRGKLVFEGA
                     GRCATCHSGATFTDANSRLHPPAESMAEPESPSYASRSATKQYRTSPLSGVWQHAPYF
                     HDGSAATLADVVQTYNTKQALGLTSQEIADLAEYLKSL"
     misc_feature    complement(360289..361098)
                     /locus_tag="CNE_BB1p03580"
                     /note="tryptophan tryptophylquinone biosynthesis enzyme
                     MauG; Region: TTQ_mauG; TIGR03791"
                     /db_xref="CDD:163503"
     misc_feature    complement(360289..360609)
                     /locus_tag="CNE_BB1p03580"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            362145..362867
                     /locus_tag="CNE_BB1p03590"
                     /db_xref="GeneID:10915339"
     CDS             362145..362867
                     /locus_tag="CNE_BB1p03590"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma-24 subunit ECF subfamily"
                     /protein_id="YP_004687821.1"
                     /db_xref="GI:339328129"
                     /db_xref="GeneID:10915339"
                     /translation="MPNNVIAQHPPPTVDGRPDADLVASARAGDASAFEIIMRRNNRL
                     LFRAARGVVPDDAEAQDVVQETYLRAFTSLDSFRGDAALSTWLVRIAINIAVSAQRKR
                     GRLVQMEDSEEPAAEPSRENLMSLRTADSESPDAMAERGQMREILQAAIERLPAIYRS
                     VFILRAIEDMSVEETAFCLDVSNDVVKTRFLRARTMLRANLAVQATPYLHATFAFAGP
                     RCDAVVNHVLTELNLRGLIRQH"
     misc_feature    362166..362846
                     /locus_tag="CNE_BB1p03590"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK11922"
                     /db_xref="CDD:237024"
     misc_feature    362253..362456
                     /locus_tag="CNE_BB1p03590"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    362574..362738
                     /locus_tag="CNE_BB1p03590"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(362607..362609,362637..362639,362655..362660,
                     362688..362690,362694..362699,362703..362711,
                     362715..362720,362724..362726)
                     /locus_tag="CNE_BB1p03590"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            362922..363740
                     /gene="folE"
                     /locus_tag="CNE_BB1p03600"
                     /db_xref="GeneID:10915340"
     CDS             362922..363740
                     /gene="folE"
                     /locus_tag="CNE_BB1p03600"
                     /EC_number="3.5.4.16"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase FolE"
                     /protein_id="YP_004687822.1"
                     /db_xref="GI:339328130"
                     /db_xref="GeneID:10915340"
                     /translation="MNAPERTAFLPDVQATEDQRKLAINAVGVKGVRYPVTLHTGKGV
                     VPAIATLSMTVGLPATMRGTHMSRFIEVLEAQTAALDQAGFKAFLFAMMQRLHAHSGE
                     LEMRFPYFVRKSAPVSGAQSLLDYEVRWQGTVAEDGQYGFWMYVTVPATSLCPCSKEI
                     SAYGAHNQRSHICIGVRLVAEMAVEELIAIAERNASCEVYGLLKRADEKYVTERAYDN
                     PKFVEDLVRDIALALGDDPRVTAFQVEAENFESIHNHSAFARIAQPDQVLPGRR"
     misc_feature    362949..363716
                     /gene="folE"
                     /locus_tag="CNE_BB1p03600"
                     /note="putative GTP cyclohydrolase; Provisional; Region:
                     PRK13674"
                     /db_xref="CDD:237466"
     gene            363790..364515
                     /locus_tag="CNE_BB1p03610"
                     /db_xref="GeneID:10915341"
     CDS             363790..364515
                     /locus_tag="CNE_BB1p03610"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_004687823.1"
                     /db_xref="GI:339328131"
                     /db_xref="GeneID:10915341"
                     /translation="MSTYESRLKGCEQVADGTFAFHFEKPAGFHFKPGQAVDLVLPDP
                     APASAHYAARHTFSLVSAPFQDELVIATRMRDSPFKRVLKSLSVAAIVRLEGPFGSLT
                     LHGDRARPAVLIAGGIGVTPFVSMLRQAAREQLPQRILLLYANRRPEDAAFLAELTQL
                     EQRYKYFHLIATMTQVVKSASPWDGSTGQIDENMVRRACSEYAAPVYYVAGPPGMVES
                     MRNVLSDLGVNDDAIRSEEFFGY"
     misc_feature    363823..364497
                     /locus_tag="CNE_BB1p03610"
                     /note="Ferredoxin reductase (FNR), an FAD and NAD(P)
                     binding protein, was intially identified as a chloroplast
                     reductase activity, catalyzing the electron transfer from
                     reduced iron-sulfur protein ferredoxin to NADP+ as the
                     final step in the electron transport...; Region: FNR_like;
                     cd00322"
                     /db_xref="CDD:99778"
     misc_feature    order(363895..363897,363952..363963,364000..364008,
                     364021..364029,364141..364143)
                     /locus_tag="CNE_BB1p03610"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99778"
     misc_feature    order(363952..363954,363958..363963)
                     /locus_tag="CNE_BB1p03610"
                     /note="conserved FAD binding motif [chemical binding];
                     other site"
                     /db_xref="CDD:99778"
     misc_feature    order(364027..364029,364036..364038,364054..364056)
                     /locus_tag="CNE_BB1p03610"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99778"
     misc_feature    order(364126..364128,364138..364149,364153..364155)
                     /locus_tag="CNE_BB1p03610"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99778"
     misc_feature    order(364141..364146,364219..364227,364420..364425)
                     /locus_tag="CNE_BB1p03610"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99778"
     gene            complement(364520..364726)
                     /locus_tag="CNE_BB1p03620"
                     /db_xref="GeneID:10915342"
     CDS             complement(364520..364726)
                     /locus_tag="CNE_BB1p03620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687824.1"
                     /db_xref="GI:339328132"
                     /db_xref="GeneID:10915342"
                     /translation="MDQAFAHFEKLLEWNLQLVPFSLQGSSECTKRMFAMGRPQDLLA
                     MQIALMQLASGQAFSCQPALSIRS"
     misc_feature    complement(<364550..364717)
                     /locus_tag="CNE_BB1p03620"
                     /note="Phasin protein; Region: Phasin_2; cl11491"
                     /db_xref="CDD:245658"
     gene            364886..365026
                     /locus_tag="CNE_BB1p03630"
                     /db_xref="GeneID:10915343"
     CDS             364886..365026
                     /locus_tag="CNE_BB1p03630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687825.1"
                     /db_xref="GI:339328133"
                     /db_xref="GeneID:10915343"
                     /translation="MAKADSAGLLPDGQGKCMNAPRTCARCMEATVIFDRKPMVNRNS
                     TG"
     gene            365675..366067
                     /locus_tag="CNE_BB1p03640"
                     /db_xref="GeneID:10915344"
     CDS             365675..366067
                     /locus_tag="CNE_BB1p03640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687826.1"
                     /db_xref="GI:339328134"
                     /db_xref="GeneID:10915344"
                     /translation="MRKTIFLTRAHVERLNSLVVDQALPTHKRQSLREIIDQAIVCTH
                     TSLPAKAITLHTPFLCIEAQHREHLLWRIVYPEDADYRQGKLSILSPAGMALFGLHEG
                     QHVRVAVPESLNFLEITVEEVLEPERIH"
     misc_feature    365675..366058
                     /locus_tag="CNE_BB1p03640"
                     /note="nucleoside diphosphate kinase regulator;
                     Provisional; Region: PRK05753"
                     /db_xref="CDD:180236"
     misc_feature    <365885..366031
                     /locus_tag="CNE_BB1p03640"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            complement(366290..366436)
                     /locus_tag="CNE_BB1p03650"
                     /db_xref="GeneID:10915345"
     CDS             complement(366290..366436)
                     /locus_tag="CNE_BB1p03650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687827.1"
                     /db_xref="GI:339328135"
                     /db_xref="GeneID:10915345"
                     /translation="MGLAALVAAIQARRAGEAFRDVRLLTGVSAACALAGLMLAMDLM
                     GWNA"
     gene            complement(366532..367401)
                     /locus_tag="CNE_BB1p03660"
                     /db_xref="GeneID:10915346"
     CDS             complement(366532..367401)
                     /locus_tag="CNE_BB1p03660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687828.1"
                     /db_xref="GI:339328136"
                     /db_xref="GeneID:10915346"
                     /translation="MAMELSQNFVKAKRPCADGYKWFLRNRHGGSDYQRLLDALVQAD
                     RVGDACWLLDQFGPTDTILTLDALDAKALVFAGTVIVRGGIDVESVVRAGRSIRVGAG
                     IRAGTAIVAGEDIDSAATLYSGGTIEAGGDVKANWGIEAETEIDCKGSVRAGWDVTAG
                     ERIAVSGNLRARENIVAQGAIRCGQGIKAGGNIEGQHDIVAGCGIEAGGAIRAGQHLV
                     AGWGIKARETIAAEGAIKAGEGVQTEEDILTGPGYGIYAGLNVRIDIWEDSARIVARQ
                     KPSTLVCGSWQPR"
     misc_feature    complement(<366796..>367179)
                     /locus_tag="CNE_BB1p03660"
                     /note="Protein of unknown function (DUF342); Region:
                     DUF342; cl19219"
                     /db_xref="CDD:267572"
     gene            complement(367549..367665)
                     /locus_tag="CNE_BB1p03670"
                     /db_xref="GeneID:10915347"
     CDS             complement(367549..367665)
                     /locus_tag="CNE_BB1p03670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687829.1"
                     /db_xref="GI:339328137"
                     /db_xref="GeneID:10915347"
                     /translation="MQTGESMPTISRKTLVIYRRTLCAMGAIAVLYLALNLD"
     gene            367789..367983
                     /locus_tag="CNE_BB1p03680"
                     /db_xref="GeneID:10915348"
     CDS             367789..367983
                     /locus_tag="CNE_BB1p03680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687830.1"
                     /db_xref="GI:339328138"
                     /db_xref="GeneID:10915348"
                     /translation="MELLRDPGLQGGEAALLCTGTRSRNMLGMLAVGGADLYRVHSVA
                     TFAGGRLLCAEPMSAGFRWG"
     gene            complement(368166..368339)
                     /locus_tag="CNE_BB1p03690"
                     /db_xref="GeneID:10915349"
     CDS             complement(368166..368339)
                     /locus_tag="CNE_BB1p03690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687831.1"
                     /db_xref="GI:339328139"
                     /db_xref="GeneID:10915349"
                     /translation="MMASTPSTCTGNFTRMDGSNIPTDTKKSTEKGLATNRLIRHDYT
                     AQLMQRRENDDQP"
     gene            complement(368868..369863)
                     /locus_tag="CNE_BB1p03700"
                     /db_xref="GeneID:10915350"
     CDS             complement(368868..369863)
                     /locus_tag="CNE_BB1p03700"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_004687832.1"
                     /db_xref="GI:339328140"
                     /db_xref="GeneID:10915350"
                     /translation="MAKTPLKKIIAFYCRFTPSYSAIGYHARRLFWRRINPDFRGQTW
                     LVTGGSEGIGASAARQAVAAGATVICVARDTAKLKAFAASVTRPEAVQIQTADFSLQA
                     DVWALVDRLEQRGVRIDVAVNNVGIQKRDQIITREGLETSFATNVLGHYLLLRELLGR
                     KMLRDDATVIEVASGGMYNHAMVVDDLNITGPGYLGVRAYGLAKRAQMMLMTHWRAAF
                     ADTGRCFYAMHPGWVNTASVNRSMPRFVAILKSVLRDHQKGADTIVWLASRRPEQVRP
                     EAIWFDRKERRPHIYAHTPKSTATPSDVVAKLESLVLARGDSEIVNLASVNSVEI"
     misc_feature    complement(369060..369752)
                     /locus_tag="CNE_BB1p03700"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    complement(368994..369743)
                     /locus_tag="CNE_BB1p03700"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(369165..369176,369252..369254,
                     369264..369266,369324..369332,369486..369494,
                     369642..369650,369705..369707,369711..369716,
                     369720..369722))
                     /locus_tag="CNE_BB1p03700"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(369252..369254,369264..369266,
                     369324..369326,369426..369428))
                     /locus_tag="CNE_BB1p03700"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(369919..370329)
                     /locus_tag="CNE_BB1p03710"
                     /db_xref="GeneID:10915351"
     CDS             complement(369919..370329)
                     /locus_tag="CNE_BB1p03710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687833.1"
                     /db_xref="GI:339328141"
                     /db_xref="GeneID:10915351"
                     /translation="MVASTLSAEQKKDVFREMTQAWEAKDWQKCASLFAPDGVLHSVM
                     LDPCVGRQAFLERIEKAAKPNKHVKLHIQRMGTADEALIVERIDEIIIDGVGRSVPTV
                     GILEFDGALISLWREYYDRPTLLKALGLSADPHA"
     misc_feature    complement(369985..370287)
                     /locus_tag="CNE_BB1p03710"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            complement(370540..371301)
                     /locus_tag="CNE_BB1p03720"
                     /db_xref="GeneID:10915352"
     CDS             complement(370540..371301)
                     /locus_tag="CNE_BB1p03720"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase alpha/beta fold family"
                     /protein_id="YP_004687834.1"
                     /db_xref="GI:339328142"
                     /db_xref="GeneID:10915352"
                     /translation="MASRQQRATPHSSRTEAALNRIRLWLLPGMMNTASVWDPVAAEL
                     TDVADISVADLSWQTSIAEMAQSVLAQQQGRFALAGFSMGGYVAQEIVAQAPSRVSHL
                     ALLGTSMRPESPEQTAGRKTLLDAVQTGFSALTHKLLALNLHPAHAGDSVPAQTLRTM
                     FETLGPDVFARQIRAIMSRHDTRAALLAAQMPVAAICGREDRVVSPALSAEIAAQVPG
                     ASLTWIERAGHMALLEQPSAVASSLRELLRERGAA"
     misc_feature    complement(370561..371235)
                     /locus_tag="CNE_BB1p03720"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(370582..371226)
                     /locus_tag="CNE_BB1p03720"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            371334..372203
                     /locus_tag="CNE_BB1p03730"
                     /db_xref="GeneID:10915353"
     CDS             371334..372203
                     /locus_tag="CNE_BB1p03730"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004687835.1"
                     /db_xref="GI:339328143"
                     /db_xref="GeneID:10915353"
                     /translation="MVSASDRRPCLSRLQGTDFRRTSGICYICSMDEKKTALAPVAGT
                     QSAARALSLLRHVGANHGSGIRLRDLIAVSGLDRSTTHRLLTCLIEEGFVERIGTTKL
                     YRLGIEALQWGFSSAGLSSVSDRFRPVMQRLARQTGDTVFLLVRSGDFAVCLCREEGD
                     YPVKAFIVQVGVRRLLATSAVGASIMAMLPDEEIAQMLARNGKEYSRLGISASQLRQL
                     IARARKLGYSESADPHVEMSGVGCAFALTRNSYAGISIAAINSRMPAKRRAELGELLI
                     REVSPFGWHGEEQ"
     misc_feature    371466..372173
                     /locus_tag="CNE_BB1p03730"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    371466..371738
                     /locus_tag="CNE_BB1p03730"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    371841..372161
                     /locus_tag="CNE_BB1p03730"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(372241..373125)
                     /locus_tag="CNE_BB1p03740"
                     /db_xref="GeneID:10915354"
     CDS             complement(372241..373125)
                     /locus_tag="CNE_BB1p03740"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004687836.1"
                     /db_xref="GI:339328144"
                     /db_xref="GeneID:10915354"
                     /translation="MKINGASLGRDLKERPSIFDILIVVSICHKQLMSVPRRVPLDLL
                     EYEGDRQFATTLARGIALLRCFTPEEPVLGNKELSRRLELPVATISRLTYTLVAMGYL
                     AQDEPHGKYRLGSAVLSLSYPLLELFTIRRRARPYLLELAESTGGSVSIGIRDRLSVV
                     YIEAIRSHHHKVYPLDVGTRQSLAGTAIGRAYLMSCAPSEREALMNQLRVRAPEEWQR
                     HQAELRRNMAEYSRWGACVSVGEIFPDVQAVAVPLGRIDRGEPAALNCAFQGRPLNRS
                     WLLEEIGPKLQALARQLM"
     misc_feature    complement(372247..372966)
                     /locus_tag="CNE_BB1p03740"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(372697..372966)
                     /locus_tag="CNE_BB1p03740"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(372247..372609)
                     /locus_tag="CNE_BB1p03740"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            373147..374589
                     /locus_tag="CNE_BB1p03750"
                     /db_xref="GeneID:10915355"
     CDS             373147..374589
                     /locus_tag="CNE_BB1p03750"
                     /EC_number="1.14.99.41"
                     /codon_start=1
                     /transl_table=11
                     /product="apocarotenoid-15,15'-oxygenase"
                     /protein_id="YP_004687837.1"
                     /db_xref="GI:339328145"
                     /db_xref="GeneID:10915355"
                     /translation="MQVDDLPILDNPALSGNNAGIQREDSFDELPVIGCVPADLNGLY
                     VRNGPNNYFPPDWRYHAYDGDGMLHAVRFRNGKVSYRNRWIATSALQEEKAEGRALWK
                     GLKEPLRADRPDEPLKNTSNTDVKYHAGRLITMWYRSGMPYAVDPDSLQTFGPADFSG
                     AVTRISAHSKPDEHTGELMFFDYGLTRPFMEYGVIGPDRKVVHRTEIPLDAPSLPHDM
                     AITEHYSILHDFPLRPDAEALLAGRYKLRFDVSQPSRFAVIPRHGHADEIRWFNAKPT
                     YMLHVVNAWEEGDEIVMIGTPYRIHAGPDGQPDARRLERTIHLRQRDFLLYQWRFNLK
                     TGETRENPIDDVLNTEFPVINSMYQGRRNRWSYNVVFPHGGHEEPRFPGLVKYDLDTG
                     GYVAYSAGPRHFYNEPGFAPRDNSMAEDDGYLVCFVWNPVDARSEIQVFDCRGANLAQ
                     GPVARVLLPRRVPNGFHATFVSQATLNRWK"
     misc_feature    373189..374565
                     /locus_tag="CNE_BB1p03750"
                     /note="Retinal pigment epithelial membrane protein;
                     Region: RPE65; pfam03055"
                     /db_xref="CDD:251697"
     gene            374593..376341
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /db_xref="GeneID:10915356"
     CDS             374593..376341
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /EC_number="6.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain-fatty-acid--CoA ligase FadK"
                     /protein_id="YP_004687838.1"
                     /db_xref="GI:339328146"
                     /db_xref="GeneID:10915356"
                     /translation="MILVSRDKIEDYVARGWWGERTLGAMFVETAVRQPTAFAVADPP
                     NRSELWGKAAQQWTWGELLEQVGRYTAWLHRQGLRKDDIIVLQLPNCVELHALYIACA
                     ISGVIVSPVPMQYRGHELSHVLSTTSARFAITTQRVGSFQAAEQWSAYMTQCVALEQV
                     WSYRDGSGDALPPAIGDLDAALAATTGWNAAALCAHMEAIGLTAHDVFTICWTSGTEA
                     RSKGVPRNHNEWLVVGQSVVEAGRLQPGNQLLIPFPFVNMAGVSTSLVAWLLIGGGLH
                     HHHPFNIEVFLTQLRTSLIDYTVAAPAVLSRLLKEPERLSEVDLQRLKRIGSGGGPLA
                     DWLVAQFAQRFNVEIVNYFGSNEGAALSSTPEDIPDRSQRALYFPRMGVPGYTWSHSN
                     AKRIRTRLVDPDTGAEVDAPGHIGELRFQGPAIFSGYFNAPELSARAFDEQGYYRTGD
                     LFEIAGDRHQFYRFAGRHKDIVIRGGMNISSEEVENLLLGHPDVREVAVIGSPDPTLG
                     ERVCAVVVPQPDATVTLPALVAHLRAEGVAAFKLPEQLLITAELPRNPVGKVLKRELR
                     QLLACVSQNTSAAVQG"
     misc_feature    374611..376287
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    374644..376302
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    order(375220..375222,375229..375246,375250..375255)
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(375229..375231,375577..375582,375643..375660,
                     375940..375942,375982..375984,375991..375993,
                     376024..376026,376267..376269)
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(375229..375231,375349..375354,375493..375495,
                     375499..375504,375511..375513,375577..375582,
                     375643..375660,375940..375942,375982..375984,
                     375991..375993,376015..376026,376210..376212)
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(375349..375351,375499..375504,375511..375513,
                     375577..375579,376015..376023,376189..376191,
                     376210..376212)
                     /gene="fadK"
                     /locus_tag="CNE_BB1p03760"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            376385..377860
                     /locus_tag="CNE_BB1p03770"
                     /db_xref="GeneID:10915357"
     CDS             376385..377860
                     /locus_tag="CNE_BB1p03770"
                     /EC_number="1.14.99.41"
                     /codon_start=1
                     /transl_table=11
                     /product="apocarotenoid-15,15'-oxygenase"
                     /protein_id="YP_004687839.1"
                     /db_xref="GI:339328147"
                     /db_xref="GeneID:10915357"
                     /translation="MHVEVVGEIHPTLALEGHPYTAGPFTPNYREVNAVDLEVEGTIP
                     ARLNGVYLRNTQNPVHQPLGKFHPFDGDAMLHLLSFQNGRCEYRNRFVRTKAFQQEQQ
                     AGRALYAGLIDKPSLSELPGWGARGGLRDSAATDVIVHAGKALAMFYQCGEPYRLDAR
                     TLELEGVDAWGADVLRDCGLSAHAKVDPRTGDLLFFNYSKDAPYMHYGEVDRQNRLAH
                     YVPVPLPGPRLPHDMAFTEHFAILNDFPLHWDENLLPQGKHKLSYYPDKPSRFAIVPR
                     RGAALAQIRWFEASPTYVLHWLNAWEDGDEVVLHGYHQKTPMPKAGYDNTGNTMGPDR
                     YGPTLYEWRFNLRTGATRERRLDERYLEFGMVNMEYWGKPYRYSYNMIAHPGAFLFDG
                     ILRYDHTTGESQQYLFGEGRFGSESPMAPCHDAQGEDDGYVVSFVTDMNNDRSECLVL
                     DARDLAAGPVARIFLPHRISSGTHACWADARDIQSDWAGLL"
     misc_feature    376415..377818
                     /locus_tag="CNE_BB1p03770"
                     /note="Retinal pigment epithelial membrane protein;
                     Region: RPE65; cl10080"
                     /db_xref="CDD:263961"
     gene            377882..379123
                     /locus_tag="CNE_BB1p03780"
                     /db_xref="GeneID:10915358"
     CDS             377882..379123
                     /locus_tag="CNE_BB1p03780"
                     /EC_number="2.3.1.176"
                     /codon_start=1
                     /transl_table=11
                     /product="propanoyl-CoA C-acyltransferase"
                     /protein_id="YP_004687840.1"
                     /db_xref="GI:339328148"
                     /db_xref="GeneID:10915358"
                     /translation="MSQSAYILGGYQTDFAKVWSRHGQDISDIIRDTTLGTLDACALD
                     AAQIESIHVGNAFGELQRQQAHLGAMVAQVVPELWGIPAMRHEGACASSSLAVLTAMA
                     ELEAGRYDCVLVLGAEEFKNISGHEASKNQNSAAWQGHEDIDCTFMWPAAFGRIAQEY
                     ERRFGLDRKYLNRIAEINYGNARRNPLAQTRNWQFNADSFTDNDEANPLIEPGTRRQD
                     CGQVTDGGCGIVLASPRFAQEYARRRGTSVDQLPRIAGWGHRTAGLRLRDKLERSRDQ
                     AYVFPHLRHAIEDAWRRANVTGIEAIDGVETHDCFTTTEYVALDHLGLTPPGQSWQAV
                     EDGSIEPGGRCPVNMSGGLIGCGHPVGATGARMLLDAARQVTGTAGEAQIEGARRLQT
                     LNIGGSCATVASFVVERGGQA"
     misc_feature    377882..379102
                     /locus_tag="CNE_BB1p03780"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06289"
                     /db_xref="CDD:235771"
     misc_feature    377906..379072
                     /locus_tag="CNE_BB1p03780"
                     /note="Thiolase domain associated with sterol carrier
                     protein (SCP)-x isoform and related proteins; SCP-2  has
                     multiple roles in intracellular lipid circulation and
                     metabolism. The N-terminal presequence in the SCP-x
                     isoform represents a peroxisomal...; Region:
                     SCP-x_thiolase; cd00829"
                     /db_xref="CDD:238425"
     misc_feature    order(378149..378151,378803..378805,378953..378955)
                     /locus_tag="CNE_BB1p03780"
                     /note="active site"
                     /db_xref="CDD:238425"
     gene            379120..379923
                     /locus_tag="CNE_BB1p03790"
                     /db_xref="GeneID:10915359"
     CDS             379120..379923
                     /locus_tag="CNE_BB1p03790"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004687841.1"
                     /db_xref="GI:339328149"
                     /db_xref="GeneID:10915359"
                     /translation="MKPLADLRADTNAAMPVLAWRDGSLAHIRFNRPAARNAVDLALA
                     RAFRLACEEFAADTDVRALILSGEGRAFLSGGDLQAMTSAIDSAAEIVDEMHGALAVL
                     ERLEFPKVAAVHGAIAGGAIGVMLAADLIVAADDTRFNVAAALVGASPECGTTWRLPR
                     AVGLRRALELALLCEPLSAPDACAAGLVNRVVAPAELMAEAEAIARRLAAGPPLALAL
                     TRRLLLDASQRDLTAQLRAEAESFALCAASADFAEGVTAMLQKRQANFG"
     misc_feature    379156..379917
                     /locus_tag="CNE_BB1p03790"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK06688"
                     /db_xref="CDD:235852"
     misc_feature    379168..379743
                     /locus_tag="CNE_BB1p03790"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(379225..379227,379231..379233,379327..379329,
                     379339..379353,379465..379467,379471..379479,
                     379543..379548,379555..379557)
                     /locus_tag="CNE_BB1p03790"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(379345..379347,379477..379479)
                     /locus_tag="CNE_BB1p03790"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(379417..379419,379441..379443,379504..379515,
                     379549..379560,379576..379578,379582..379590,
                     379594..379599,379612..379617,379621..379626,
                     379630..379635,379642..379644,379675..379677,
                     379684..379686,379729..379731,379738..379743)
                     /locus_tag="CNE_BB1p03790"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            379980..380783
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /db_xref="GeneID:10915360"
     CDS             379980..380783
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687842.1"
                     /db_xref="GI:339328150"
                     /db_xref="GeneID:10915360"
                     /translation="MNSELQDTHRAASVASSQRFRLDGRVVLVTGASSGLGKHFASVL
                     AEAGARVALAARRVDKLQPIVEAISQAGGTACALALDVTDAKSVQACFDAIPWSTPQV
                     VVNNAGVALTRPALEQSEADFNAVIDTNLKGCWLVACEAGRRMASAGGGSIVNIASIL
                     GARVTAGVAPYAISKAGVIQATKALALELARHRIRVNALLPGYVMTEMNKDFLRSDAG
                     EKLRKRIPSRRFCQLTDLDGPLLLLASDAGAAMTGTTLAVDGGHLVSPL"
     misc_feature    380040..380762
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    380052..380765
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(380070..380072,380076..380081,380085..380087,
                     380142..380150,380295..380303,380445..380453,
                     380490..380492,380502..380504,380580..380591)
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(380367..380369,380451..380453,380490..380492,
                     380502..380504)
                     /gene="fabG6"
                     /locus_tag="CNE_BB1p03800"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            381041..382021
                     /gene="bug1"
                     /locus_tag="CNE_BB1p03810"
                     /db_xref="GeneID:10915361"
     CDS             381041..382021
                     /gene="bug1"
                     /locus_tag="CNE_BB1p03810"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor"
                     /protein_id="YP_004687843.1"
                     /db_xref="GI:339328151"
                     /db_xref="GeneID:10915361"
                     /translation="MSTKTRRSFLAFAAQAACLAWLGNPVWAQSKPVARIVVPFAPGG
                     GGDVLGRLLAEKLSIELGQAVIVENRPGGSATIATDVVAKSAPDGNTILLTVPLLVQT
                     PSLFKKLPFDPIADLTPVVDVVTSPLWVAVSTSRTSARTVKEFVADVKAHPAKHSFAS
                     LGNGSSAHVLGSQFNAVAGLDMIHVPYKGSAPASVALVAGEVSLTILDIVTLKPQLAS
                     GKIRLLAVTGGKRSPLTPEVPTLAEQGYPGFDLPTWAGLFVPSKTSPEIVRKLHAATV
                     KVLHQPDVVSRLGGLGYMPGGQSQESFARGVGAEKVRWAELIGKAGIQPD"
     misc_feature    381188..382009
                     /gene="bug1"
                     /locus_tag="CNE_BB1p03810"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            382137..383114
                     /locus_tag="CNE_BB1p03820"
                     /db_xref="GeneID:10915362"
     CDS             382137..383114
                     /locus_tag="CNE_BB1p03820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687844.1"
                     /db_xref="GI:339328152"
                     /db_xref="GeneID:10915362"
                     /translation="MTWISFPRRRALMAMLVLLCGPVAAQSYPDKPVRVVVPFPAGGG
                     TDVVARIAGSALQVNMKQAIVVDNRPGASGVIGSDYVAKAQPDGYTLLFTIPILLQTA
                     SAMPKIPYDPLRDFVPVTTLVSAPLWLAVSTSRVKATDFAAFTSEAKATTKKWEYSSF
                     GNASSSHLYGHALNQALSAGMLHVPYKGGSAAVQALANGEVAAMWTDYPSVRPYVASG
                     KVRIIASSGAKRSRLTPDVPTLSELRLPGFEALGWGAFFAPAGTPPEVVKRLQTEISA
                     VTRNPDVVKKFADLGYEPGGKPQPEFAADVRADQARWSALIKAADIRLD"
     misc_feature    382278..383102
                     /locus_tag="CNE_BB1p03820"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            383320..384393
                     /locus_tag="CNE_BB1p03830"
                     /db_xref="GeneID:10915363"
     CDS             383320..384393
                     /locus_tag="CNE_BB1p03830"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_004687845.1"
                     /db_xref="GI:339328153"
                     /db_xref="GeneID:10915363"
                     /translation="MNKIGRVRFLASVMAMSATGMSAQVVFAQSSVTIYGVADTYLEY
                     SSNNRSAIAGDNSAKSAVKLTSAGLSGPRWGLRGVEDLGGGMKALFVLESGFNIDTGT
                     MADTSRLFNRQSFVGMESLYGRLTFGRQYTTFFDILANFTPLYYSGTYEPFSVLLGPL
                     RVDNSVKYRIALGALTAQAHYAFGEQPGSIQASASWGGGVSYGSGPFAVSAIYDQGNG
                     PDTTAGIAKSRKAAVAGTYTQGPIRLSAGYRWGKDVAANGATSSRDNMYWAGIGYQIA
                     TPFGLTLAYYYDDIKSKTGVANPANPQQYVLQGIYSLSKRTDVYGVAAYAKNSALNFA
                     SLQTLAPGKTNQTGVALGIRHKF"
     misc_feature    383407..384390
                     /locus_tag="CNE_BB1p03830"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(383407..383409,383413..383415,383431..383433,
                     383437..383445,383551..383565,383581..383583,
                     383587..383595,383599..383601,383605..383616,
                     383650..383655,383659..383673,383698..383706,
                     383800..383802,383806..383811,384256..384261,
                     384268..384270,384376..384378,384382..384384,
                     384388..384390)
                     /locus_tag="CNE_BB1p03830"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(383428..383430,383536..383538,383653..383655,
                     383743..383745,383800..383802)
                     /locus_tag="CNE_BB1p03830"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            384557..385618
                     /locus_tag="CNE_BB1p03840"
                     /db_xref="GeneID:10915364"
     CDS             384557..385618
                     /locus_tag="CNE_BB1p03840"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_004687846.1"
                     /db_xref="GI:339328154"
                     /db_xref="GeneID:10915364"
                     /translation="MTNRHDLAGTVPVREQHQFDQTALERWMEQNVAGYAGPLTIDQF
                     KGGQSNPTYRLTTPGRSYVLRRKPRGALLKGAHAVEREARVMAALGQADFPVPYIHGL
                     CIDDSVIGSWFFVMDMIEGRIFWDASFSDVSRHDRAAYMDAMNATLARLHTIDPASIG
                     LSDYGKPGGYVARQVARWSAQYLSDGVAGRHPSMDLLANWLPRHLPAADEVAIAHGDF
                     RADNMIFHPSEPRVLAVLDWELSTLGDPLADFAYHVMMFRMPSDILGGIAGRDLAALG
                     LPDEVAYVDAYCRRTGRDGIPNLDFYIAFNMFRFAAILHGIKGRVARGTASNADAHAM
                     GERFARVAELAWAQAQRVG"
     misc_feature    384671..385336
                     /locus_tag="CNE_BB1p03840"
                     /note="Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal
                     domain, and similar proteins. This subfamily is part of a
                     larger superfamily that includes the catalytic domains of
                     other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs); Region:
                     ACAD10_11_like; cd05154"
                     /db_xref="CDD:240175"
     misc_feature    384674..385462
                     /locus_tag="CNE_BB1p03840"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(384698..384700,384710..384712,384743..384745,
                     384749..384751,384845..384847,384902..384913,
                     385205..385207,385217..385222,385226..385228,
                     385262..385267,385322..385324)
                     /locus_tag="CNE_BB1p03840"
                     /note="putative active site [active]"
                     /db_xref="CDD:240175"
     misc_feature    order(384698..384700,385205..385207,385322..385324)
                     /locus_tag="CNE_BB1p03840"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240175"
     misc_feature    order(384710..384712,384743..384745,384749..384751,
                     384845..384847,384902..384913,385205..385207,
                     385217..385222,385226..385228,385262..385267)
                     /locus_tag="CNE_BB1p03840"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240175"
     gene            complement(385506..386201)
                     /locus_tag="CNE_BB1p03850"
                     /db_xref="GeneID:10915365"
     CDS             complement(385506..386201)
                     /locus_tag="CNE_BB1p03850"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_004687847.1"
                     /db_xref="GI:339328155"
                     /db_xref="GeneID:10915365"
                     /translation="MYERYKFLKFERRGKILTVTMDNPSANAANFGLHDELSYVFDEI
                     EHDAECEVVVLTGTGRVFSAGADRTGRLKACDNSSVRASMISRAPNMVSSLLSMSKPV
                     IARVNGHARGLGATLALLADVAISVDTAEIADPHVNIGQSAEDSGAFFWPMVVGYSRS
                     RQYLERELGVDPINSIIATNKSRHKRANAKSRPALNPLAAPAPKPARPRAQSVRPWHA
                     RRHWRPCRAQLCP"
     misc_feature    complement(<385710..386189)
                     /locus_tag="CNE_BB1p03850"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    complement(385710..386180)
                     /locus_tag="CNE_BB1p03850"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(385785..385787,385794..385799,
                     385863..385871,385875..385877,385998..386012,
                     386022..386024,386118..386120))
                     /locus_tag="CNE_BB1p03850"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(385863..385865,386004..386006))
                     /locus_tag="CNE_BB1p03850"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(385710..385712,385716..385721,
                     385725..385730,385743..385748,385752..385760,
                     385764..385766,385782..385793,385827..385838,
                     385899..385901,385923..385925))
                     /locus_tag="CNE_BB1p03850"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(386318..388054)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /db_xref="GeneID:10915366"
     CDS             complement(386318..388054)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /EC_number="1.3.99.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxosteroid 1-dehydrogenase KsdD"
                     /protein_id="YP_004687848.1"
                     /db_xref="GI:339328156"
                     /db_xref="GeneID:10915366"
                     /translation="MSENQMKVTYDVIVIGSGAAGMMAALRARDQGLDVLIVEKERQY
                     GGTSATSGGLFWVPNHGLDATGDSREKALTYLKTVARGPVRQDRLEKFVDTAPEMARY
                     LASSTGLKLDVQTGYPDYYSEAEGAHPGRALAPQVIDGAGLANDFHTLREQFVRFKIF
                     NRYTLSLYEAFTLATRAPGWRSLFAKMVFNYWTDFSWRRKTPRDRRLSMGNALIGGMR
                     MALNKRRVPLWLNTALDELIVEHGEVVGVWLRQYGRPIRIDARRGVVIAAGGFEWNQA
                     LRDKHLPLPLPARFSSTPMDGNTGMAIQAGQAIGAAIEFMEGAWWVPTMVMPIHGVPN
                     IDMVHQMVFDVGRPHSLCVNQLGRRFLNESCSYDRFGIALIEEQQKTGMSIPCWLVFD
                     AQFRKLYTAGGLMPASIMPDSKIPEHWWTRYLYRADSIAELAGSIGLPPQPLSEEVRK
                     INEYARTGIDPEFGRGSFEYDRFLGDPRHTPNPCLGTIEKGPFYAVPVNLGDLGTKGG
                     LKVDPRARVLDLNDNPIPGLYAAGNASGSVYGDTYPGAGATLGQALTFGYVAANDIAA
                     NHRAAVHEAEAR"
     misc_feature    complement(386357..388030)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /note="3-ketosteroid-delta-1-dehydrogenase; Reviewed;
                     Region: PRK07843"
                     /db_xref="CDD:236111"
     misc_feature    complement(<387629..388024)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /note="lycopene cyclase; Region: lycopene_cycl; TIGR01789"
                     /db_xref="CDD:130849"
     misc_feature    complement(<387887..388024)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(386360..>387427)
                     /gene="ksdD1"
                     /locus_tag="CNE_BB1p03860"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(388110..389468)
                     /gene="hsaB"
                     /locus_tag="CNE_BB1p03870"
                     /db_xref="GeneID:10915367"
     CDS             complement(388110..389468)
                     /gene="hsaB"
                     /locus_tag="CNE_BB1p03870"
                     /EC_number="1.5.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin-dependent monooxygenase reductase
                     subunit"
                     /protein_id="YP_004687849.1"
                     /db_xref="GI:339328157"
                     /db_xref="GeneID:10915367"
                     /translation="MTMRLNGSGEITLAASASGAPEDPCVLLLPGFGQTAAAWARASK
                     ALVAAGRYVVTVELRGHGESDWSPNRRYELGDIIQDIVAVIQQLPSKPAVVGANLGGL
                     AALAAISESPEPLASALVLIDAAPRMAPAGLDRMASLMTMDADGFSTVADAGRVVAEH
                     LPAKQQLDLEEVKRHLRRCDDGRFRWHIDPAYQGFKVDASDRKAAQRRFTAAALALDI
                     PTFFVRGESSTKVDRESMHEFRELVPHAEFADIPGMGDAIIGGRNDAFDAAIIGFLER
                     AIPRSKLRPQGGVEPRMLRDAMGCFATGVTVITTSDPDGTPMGFTANSFTSVSLDPPL
                     VLFCVKRESASVEALRKRGAFAVNVLHIGQQAISGKFASRIEDRFAATEWELWEYQVP
                     IILDAIANFECSIREIVDGGDHVIVLGLVKRVHYDPVRDPLLFFQGKYRRIHVAREES
                     EK"
     misc_feature    complement(388704..389393)
                     /gene="hsaB"
                     /locus_tag="CNE_BB1p03870"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<389091..389312)
                     /gene="hsaB"
                     /locus_tag="CNE_BB1p03870"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(388149..388577)
                     /gene="hsaB"
                     /locus_tag="CNE_BB1p03870"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            complement(389823..390989)
                     /locus_tag="CNE_BB1p03880"
                     /db_xref="GeneID:10915368"
     CDS             complement(389823..390989)
                     /locus_tag="CNE_BB1p03880"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004687850.1"
                     /db_xref="GI:339328158"
                     /db_xref="GeneID:10915368"
                     /translation="MLCAGNQTWSKNGSAAVWASTPNSALQTCSLILAATTAACTTCR
                     HKETDVTSKHWNNVEAEVALDPDLPIVDPHHHIWGKGWTHPLFEPYDADELIADTADS
                     GHNVIATVLVDSHAQHYTDGPEAMRPVGETVYAERVVQESERRGGKAAGVCAAIMPHA
                     NLCLGASVGEVLDAHAEASRRFRGIRHMLAYDAELPPIYGASEAEISKRPEFRKGFAE
                     LARRDLNFEAWALQPQLGEVLDLAHAFPQVTIVLNHLGGPLGIGRFAERRTEGFKAWK
                     EAMAQLATCSNIVVKLGGIYVTQTDPTKIQWPARPLTSEEFADLHRQYVLTAIDLFTP
                     SRCMFESNFPVDMLYTSYNALWNGYKRIASGFSPSERSDMFAAVAKRVYKLQQT"
     misc_feature    complement(389835..390803)
                     /locus_tag="CNE_BB1p03880"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            complement(391026..391805)
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /db_xref="GeneID:10915369"
     CDS             complement(391026..391805)
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase PaaG"
                     /protein_id="YP_004687851.1"
                     /db_xref="GI:339328159"
                     /db_xref="GeneID:10915369"
                     /translation="MNEYKYVTFREEEGVARLVLNRPEALNALHVDTLAEIIHALDRV
                     RDEETVRVLLLTGAGRAFSSGADLTSGGPSKDSGSKLEDYYNPILERLFALPVPFITA
                     VNGPAVGAGCALALAGDIVLAAREAYFLQAFVNIGLIPDAGTTWILPRQIGRARAQAM
                     MMLGERIPAETAAQWGMVYKVVDQDALAAESQALAMRFARGPTRAYALIRQGIRYSLD
                     HTLTETLAAERNSQRLAGVTQDFAEGVAAFRQKRPAAFTGR"
     misc_feature    complement(391029..391799)
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK08140"
                     /db_xref="CDD:236163"
     misc_feature    complement(391215..391787)
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(391398..391400,391407..391412,
                     391476..391484,391488..391490,391602..391616,
                     391626..391628,391722..391724,391728..391730))
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(391476..391478,391608..391610))
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(391215..391217,391224..391226,
                     391269..391271,391278..391280,391311..391313,
                     391320..391325,391329..391334,391338..391343,
                     391356..391361,391365..391373,391377..391379,
                     391395..391406,391440..391451,391512..391514,
                     391536..391538))
                     /gene="paaG2"
                     /locus_tag="CNE_BB1p03890"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            392140..393174
                     /locus_tag="CNE_BB1p03900"
                     /db_xref="GeneID:10915370"
     CDS             392140..393174
                     /locus_tag="CNE_BB1p03900"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004687852.1"
                     /db_xref="GI:339328160"
                     /db_xref="GeneID:10915370"
                     /translation="MEHFSFSSLKSHSSERPCSFSAVTFENSKRYYTGEGTLLDAGQS
                     PHLDVTMVLEVPYPMGKVSSRSRYVYRRGWDHIRDNKENIITLWYIKRGGMTLSQMGN
                     TCEMKAGDFAFTRSNSPMRYENIPCNYEPAEWMFIMFPLEVIHRYFPHGAPICTGINI
                     SNERKAAMPMLISMLCEVAESLNREVTDSLIDALLKEAALLTDQQGAQVGRRQSIGEK
                     RIEDINSYISLHLSNPELSLSMVAQGCKISPRYLCHLLKEHNTTFSQLLWTGRLNEAK
                     KWLVRLDKRHYGINEIAYMTGYKSVAHFSRMFREKFGRSPREFRRQEASAEALTGVAE
                     QEDRKGVAVA"
     misc_feature    <392398..392553
                     /locus_tag="CNE_BB1p03900"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    392737..393105
                     /locus_tag="CNE_BB1p03900"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    <393004..393102
                     /locus_tag="CNE_BB1p03900"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            393324..393476
                     /locus_tag="CNE_BB1p03910"
                     /db_xref="GeneID:10915371"
     CDS             393324..393476
                     /locus_tag="CNE_BB1p03910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687853.1"
                     /db_xref="GI:339328161"
                     /db_xref="GeneID:10915371"
                     /translation="MGRPQALAPGCEIFALSAAMHRDNVTRDAEQIRLEEIQVVTQAP
                     VPVYVL"
     gene            complement(393527..394456)
                     /gene="etfA"
                     /locus_tag="CNE_BB1p03920"
                     /db_xref="GeneID:10915372"
     CDS             complement(393527..394456)
                     /gene="etfA"
                     /locus_tag="CNE_BB1p03920"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="YP_004687854.1"
                     /db_xref="GI:339328162"
                     /db_xref="GeneID:10915372"
                     /translation="MTALVIAEHDNASLKGSTLHTVTAAAACGGEVHILIAGHHCGGA
                     AEAASKLAAVTKVLVADAPPLAEGLAEAVAEQVLALANAYSHVLAPATAYGKNILPRV
                     AARLDVAQVSDVTKVIAEDTFERPIYAGNAIATVQSTDAVKVITVRTTGFDAAATGGN
                     AAVEPVAPVADSGKSTFLSREVARSDRPELTTAKVIVSGGRGMGSAENFKVLEPLADK
                     LGAAMGASRAAVDAGFVPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDAKTIVA
                     INKDPEAPIFSVADYGIVGDLFTVVPELVKALG"
     misc_feature    complement(393533..394453)
                     /gene="etfA"
                     /locus_tag="CNE_BB1p03920"
                     /note="electron transfer flavoprotein subunit alpha;
                     Provisional; Region: PLN00022"
                     /db_xref="CDD:215032"
     misc_feature    complement(393968..394447)
                     /gene="etfA"
                     /locus_tag="CNE_BB1p03920"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_alpha; cd01715"
                     /db_xref="CDD:238848"
     misc_feature    complement(393641..393898)
                     /gene="etfA"
                     /locus_tag="CNE_BB1p03920"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            complement(394480..395292)
                     /gene="etfB"
                     /locus_tag="CNE_BB1p03930"
                     /db_xref="GeneID:10915373"
     CDS             complement(394480..395292)
                     /gene="etfB"
                     /locus_tag="CNE_BB1p03930"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="YP_004687855.1"
                     /db_xref="GI:339328163"
                     /db_xref="GeneID:10915373"
                     /translation="MVGFSGPPHGGPDSLCGRVTMKILVPVKRVVDYNVKPRVKSDGS
                     GVDLANVKMSMNPFDEIAVEEATRLKEGGKATEVVAVSCGVAQCEETLRTAMAIGADR
                     GILVETTEALQPLAVAKLLQALANKEQPQLIILGKQAIDDDANQTGQMLAALLGWPQA
                     TFASKLTLEDGKATVTREVDGGLETLALTLPAVVTTDLRLNEPRYVTLPNIMKAKKKT
                     LDVVTPADLGVDVGPRLRTLRVAEPPRRCAGVIVPDVATLLHKLKNEAKVIQ"
     misc_feature    complement(394624..395229)
                     /gene="etfB"
                     /locus_tag="CNE_BB1p03930"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_beta; cd01714"
                     /db_xref="CDD:238847"
     misc_feature    complement(order(394852..394863,394876..394881,
                     394885..394890,395044..395046,395116..395118,
                     395125..395127,395212..395217))
                     /gene="etfB"
                     /locus_tag="CNE_BB1p03930"
                     /note="Ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:238847"
     gene            complement(395375..396130)
                     /locus_tag="CNE_BB1p03940"
                     /db_xref="GeneID:10915374"
     CDS             complement(395375..396130)
                     /locus_tag="CNE_BB1p03940"
                     /codon_start=1
                     /transl_table=11
                     /product="p-nitrobenzoate reductase"
                     /protein_id="YP_004687856.1"
                     /db_xref="GI:339328164"
                     /db_xref="GeneID:10915374"
                     /translation="MTTDIRTALQSSDSSHGAMPEDAAMLGRLLSGRFSCRGFMPDPV
                     PRHVIERMLAMAQLSPSWCNSQPWQVIVTSGLGTERLREALFAHAEADCASNGGAPAT
                     QPDFPFPAAYRGVYRERQREVGWQLYQSVGARHGDREASAVQALKNFRLFDAPHMLLI
                     TSERDLGAYGAIDCGIYLSTVLLAGQSLGVASVAQAALAAYSPFMRAYFNIPDHRVIV
                     AGASFGYADTGHPANAFRSRRAALAEVVEWVTN"
     misc_feature    complement(395393..396049)
                     /locus_tag="CNE_BB1p03940"
                     /note="Proteins of this family catalyze the reduction of
                     flavin or nitrocompounds using NAD(P)H as electron donor
                     in a obligatory two-electron transfer,  utilizing FMN or
                     FAD as cofactor. They are often found to be homodimers.
                     Enzymes of this family are...; Region:
                     Nitro_FMN_reductase; cl00514"
                     /db_xref="CDD:260471"
     misc_feature    complement(order(395540..395545,395942..395944,
                     396020..396022,396026..396028,396032..396034))
                     /locus_tag="CNE_BB1p03940"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239015"
     misc_feature    complement(order(395582..395584,395591..395596,
                     395603..395608,395612..395614))
                     /locus_tag="CNE_BB1p03940"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239015"
     gene            complement(396209..397846)
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /db_xref="GeneID:10915375"
     CDS             complement(396209..397846)
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase FadD"
                     /protein_id="YP_004687857.1"
                     /db_xref="GI:339328165"
                     /db_xref="GeneID:10915375"
                     /translation="MRYDRSQAGKPEHHTHLHSLARAVEEAGDKPFIECGGKSMTFRE
                     FDRASTRLAHSLAALGVSAGHSVVTFMESSLDVYLCWFAINKLGAIWCPVNTAYRKTF
                     LRHQVDDSLAALAICDAELVDRFHEIDDQLPIMKLILVRGDVPEQECAIPMRSLDDYR
                     GADDTPIPLTAKPSDLSCLIYTSGTTGLSKGCMIPYASLYNVGIQTLEAIPVESRDIL
                     WTCLPLFHMSAISSVTQAALQMQVRLSICPQFSVSGFWEEIERSGAAHALLMGSIFPL
                     VAKAPDTEAMKRCHGQLRSITGVPITPEIGKIWKERFGVGYLNSYGYGQSEGAKLAHL
                     VYGEPLPPPLSSGHIAHDDYEVIIADENDNPLLAGTPGEILFRPRKPHIMFSGYWRRP
                     EDSAKVWRNLWMHTGDIGKIDEDGWFYFLDRKKDYIRSRGENISSFEVEATYMTHPAI
                     AEVAFHGVILEEGGEEQIKVTAVIRDGHSLAHEALCRWSMESLPYFAVPRFYEFRDAL
                     PKTPTGRVQKYKLREDGCTPVTWDAWAIGLIAKKRAA"
     misc_feature    complement(396212..397789)
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="crotonobetaine/carnitine-CoA ligase; Provisional;
                     Region: PRK06155"
                     /db_xref="CDD:235719"
     misc_feature    complement(396281..397738)
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(397277..397282,397286..397303,
                     397310..397312))
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(396302..396304,396545..396547,
                     396578..396580,396587..396589,396623..396625,
                     396869..396883,396890..396892,396947..396952,
                     397301..397303))
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(396359..396361,396545..396556,
                     396578..396580,396587..396589,396623..396625,
                     396869..396883,396890..396892,396947..396952,
                     397013..397015,397022..397027,397031..397033,
                     397178..397183,397301..397303))
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(396359..396361,396377..396379,
                     396548..396556,396950..396952,397013..397015,
                     397022..397027,397181..397183))
                     /gene="fadD1"
                     /locus_tag="CNE_BB1p03950"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(398017..399018)
                     /locus_tag="CNE_BB1p03960"
                     /db_xref="GeneID:10915376"
     CDS             complement(398017..399018)
                     /locus_tag="CNE_BB1p03960"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH dependend quinone reductase"
                     /protein_id="YP_004687858.1"
                     /db_xref="GI:339328166"
                     /db_xref="GeneID:10915376"
                     /translation="MRQVRLNSPSTIDNLKLVAIDQPEPRENEVLVRVRASSLNFHDY
                     LVVAGIMPAAEGRVPLSDGAGEVVAVGRDVRAFKPGDRVVGTYFPDWIDGAPSPVKVS
                     RMRGEHVDGFASEYVSLPENAFVKIPSGLSYEEAATLPCAGLTAWRALMVESKVKPGD
                     TVLVQGTGGVSIFALQFARMAGANVIAITSSEEKISRLNKLGAAHVVNYRAEEQWGAK
                     VREITGGRGVDHVVEVVGGDLVQTLRACRTAGQVNLVGALSRKPLQFPASHVITGNLR
                     IAGLTVGSREHLEQMIEAIAANGLKPQLHRTFPLEELTQAFRHQEAKAHFGKICISV"
     misc_feature    complement(398020..399018)
                     /locus_tag="CNE_BB1p03960"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR7; cd08276"
                     /db_xref="CDD:176237"
     misc_feature    complement(398020..399018)
                     /locus_tag="CNE_BB1p03960"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    complement(order(398173..398181,398251..398256,
                     398308..398310,398314..398319,398392..398394,
                     398437..398439,398449..398454,398506..398523,
                     398584..398586,398596..398598,398884..398886,
                     398893..398901))
                     /locus_tag="CNE_BB1p03960"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176237"
     gene            complement(399120..400400)
                     /locus_tag="CNE_BB1p03970"
                     /db_xref="GeneID:10915377"
     CDS             complement(399120..400400)
                     /locus_tag="CNE_BB1p03970"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004687859.1"
                     /db_xref="GI:339328167"
                     /db_xref="GeneID:10915377"
                     /translation="MQQRTVFTNVNLFAGRGAIRPGMTVVVEGDKIAGVDIEIAPQEG
                     DRRIDLNGKTLMPGMTVGHWHGEFVDIGPPLFSKGRAGTFLGEEKPPAILALQYANAM
                     QVALMSGVTQVVSGSCGHNHDIQLKMAVDMGLIKGPCITPCSRHVTTTGDYEDRGLWW
                     ATSAPPRDGIRRYGQNVFADGVADMIKAVREEILFGAEIIKVLPTGGHGFTWSTTYRG
                     LSKAELRAVVETAHERDKRVRAHVATREAILECLEAGVDILDHADYMDEECLERMIKQ
                     GTILVPSMLFTRILGHLKTDQPHDLSDPDQRGWLNMLEMLPKANRAGLRMVPGDDFGA
                     QGMPHELGVYARELEVYVKDMGIPAADVMRWATANGAELAGQDHITGTIEVGKAADIL
                     VVDGDPTEDISILTEPGRYLKAIMQNGRFVKNEL"
     misc_feature    complement(399129..400394)
                     /locus_tag="CNE_BB1p03970"
                     /note="Imidazolonepropionase and related amidohydrolases
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: HutI; COG1228"
                     /db_xref="CDD:224149"
     misc_feature    complement(<400203..400388)
                     /locus_tag="CNE_BB1p03970"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(399186..400268)
                     /locus_tag="CNE_BB1p03970"
                     /note="Metallo-dependent hydrolases, subgroup A is part of
                     the superfamily of metallo-dependent hydrolases, a large
                     group of proteins that show conservation in their
                     3-dimensional fold (TIM barrel) and in details of their
                     active site. The vast majority of the...; Region:
                     Met_dep_hydrolase_A; cd01299"
                     /db_xref="CDD:238624"
     misc_feature    complement(order(399408..399410,399618..399620,
                     399678..399680,400206..400208,400212..400214))
                     /locus_tag="CNE_BB1p03970"
                     /note="active site"
                     /db_xref="CDD:238624"
     gene            complement(400515..400634)
                     /locus_tag="CNE_BB1p03980"
                     /db_xref="GeneID:10915378"
     CDS             complement(400515..400634)
                     /locus_tag="CNE_BB1p03980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687860.1"
                     /db_xref="GI:339328168"
                     /db_xref="GeneID:10915378"
                     /translation="MLSSACRRTARAGIFLALLAQAKLLTEWVAVKLESNSYD"
     gene            400688..401623
                     /locus_tag="CNE_BB1p03990"
                     /db_xref="GeneID:10915379"
     CDS             400688..401623
                     /locus_tag="CNE_BB1p03990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687861.1"
                     /db_xref="GI:339328169"
                     /db_xref="GeneID:10915379"
                     /translation="MHECLAYRHHSRPTFGGPLLAKLYGYAMHRFKVTGGLSVAADVG
                     GDVQNPVVVLLHGGGQTRHSWRKGFDALVEAGYHVVSLDARGHGDSDWAPDGDYRLDA
                     LVSDLRSVLAQIPEMPIVIGASLGGMTGLAAVGEAQAPIARALVLVDITPGYDTRGTD
                     HIAAFMNANLDGFGSIDEAADAVARYNPNRPRPKNPEGLRRNLRERDGRLYWHWDPRF
                     LSHGELHPDFVQGRLEAAAQRVRVATLLIRGGFSDVIGDEQVDAFRKLMPAAECVTVA
                     GAGHMVAGDRNDAFNRGILEFIARQDNRSESAYSR"
     misc_feature    400841..401563
                     /locus_tag="CNE_BB1p03990"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    400916..401584
                     /locus_tag="CNE_BB1p03990"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            401705..402841
                     /gene="caiB1"
                     /locus_tag="CNE_BB1p04000"
                     /db_xref="GeneID:10915380"
     CDS             401705..402841
                     /gene="caiB1"
                     /locus_tag="CNE_BB1p04000"
                     /EC_number="2.8.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetainyl-CoA:carnitine CoA-transferase
                     CaiB"
                     /protein_id="YP_004687862.1"
                     /db_xref="GI:339328170"
                     /db_xref="GeneID:10915380"
                     /translation="MANGPLQGLRVVEFAGIGPGPFCGMLLSDMGADVVRIDRKGSAA
                     GPNAKYNIDARGRRSVALDLKRPESLELCLKLCERADIVFEGYRPGVMERLGLGPDVV
                     LGRNRRIVYGRMTGWGQHGPYANRAGHDINYIAITGALDAIGTGEKPIPPLNLVGDYG
                     GGAMFLAFGLLAAVLNARSTGRGQVVDVAMTDGAAYLTAVFHRLRAMGLWKDERCANL
                     LDGGAPFYDTYRCADGTWIAVGAIEPQFYQILLEKTGLAGTMTDDQMDRSRWPDMKRQ
                     FAEVFATKTREEWCAVMGSDDACFAPVLSIEEAMQDPHQVARETFVEIDGVPQPAPAP
                     RFSVTPGQIQAMSQRLDTDSQSILADWGIGSDYTAELAAAGVVS"
     misc_feature    401714..402835
                     /gene="caiB1"
                     /locus_tag="CNE_BB1p04000"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            402867..403310
                     /locus_tag="CNE_BB1p04010"
                     /db_xref="GeneID:10915381"
     CDS             402867..403310
                     /locus_tag="CNE_BB1p04010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687863.1"
                     /db_xref="GI:339328171"
                     /db_xref="GeneID:10915381"
                     /translation="MSTDTGSLPSEVAIHALKLLAARDFEGLRALLAPDVTLDWPFHQ
                     SGSPVRIEGADSLMDAVRIIKVFQDLEIRILEFNEQKDGGTSIIEARSRGTYADGRPD
                     YTNHYIFILKIVNGKVTRWREFYNPLEVMKAAAGTKAGKTAPARA"
     misc_feature    402915..403229
                     /locus_tag="CNE_BB1p04010"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            complement(403424..404194)
                     /locus_tag="CNE_BB1p04020"
                     /db_xref="GeneID:10915382"
     CDS             complement(403424..404194)
                     /locus_tag="CNE_BB1p04020"
                     /EC_number="1.1.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta-hydroxysteroid dehydrogenase"
                     /protein_id="YP_004687864.1"
                     /db_xref="GI:339328172"
                     /db_xref="GeneID:10915382"
                     /translation="MGDLEGKVALVSGGSKGMGEAIARLFAREGARVVLTARSEADAR
                     RVAESIGPSACGMALEVSNRSNWVRVIDAVSERWGRLDILVNSAGVSIGGSIEDTNEE
                     NWRLHMATNLDGVYYGCQTALPLMKSSGEPSSIINIASVIASRPMSSLMAYGASKTAM
                     VAMTKSIALHCALNGYAIRANTIHPGGIETPMFEDALVQTGLPREQAYAMWCSAHPMG
                     RIGKPEEVAQAALWLASDASSFTTGGEVTVDGGSAIRH"
     misc_feature    complement(403442..404191)
                     /locus_tag="CNE_BB1p04020"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(403442..404188)
                     /locus_tag="CNE_BB1p04020"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    complement(order(403631..403642,403724..403726,
                     403736..403738,403775..403783,403928..403936,
                     404078..404086,404141..404143,404147..404152,
                     404156..404158))
                     /locus_tag="CNE_BB1p04020"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(403724..403726,403736..403738,
                     403775..403777,403862..403864))
                     /locus_tag="CNE_BB1p04020"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(404216..405361)
                     /locus_tag="CNE_BB1p04030"
                     /db_xref="GeneID:10915383"
     CDS             complement(404216..405361)
                     /locus_tag="CNE_BB1p04030"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH oxidase"
                     /protein_id="YP_004687865.1"
                     /db_xref="GI:339328173"
                     /db_xref="GeneID:10915383"
                     /translation="MTRQLLGEPLAIRGTTLSNRIVMSPMTRGFCPRGAPTEQVCSYY
                     SRRAAGGFGLVITEAIGVDHRSALGDAGLGEDDIPVLHGEAPLAGWRRVVEAVHAAGG
                     KIIPQLWHQGVMRLPGTGPHPEAPTLGPSGLWGPLRRTTSIDAGKIPSQPLIGEPMSE
                     QDIEDVIEAHVRSARNAIQAGFDGIAIHGGHGYLIDTFLWEETNRRTDRWGGNRARRS
                     AFAAEIVHRIRAAIGPNLPIFFRFSQWKQQDFRAQLGNTPQELADVLQPLADAGVDVF
                     DASVRYFDRPAFSGSDLSLAGWAKKLTGKHAMAVGGVGVNKGMYDGNSNLSAVDNVDA
                     VVKRVSSGEIDLVAVGRAAIGDPAWARKSLAGDTAEPFDPASLAELR"
     misc_feature    complement(404219..405346)
                     /locus_tag="CNE_BB1p04030"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 5.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_5_FMN; cd04747"
                     /db_xref="CDD:240095"
     misc_feature    complement(order(404309..404314,404627..404629,
                     404783..404785,405041..405043,405185..405187,
                     405281..405283,405287..405289))
                     /locus_tag="CNE_BB1p04030"
                     /note="putative active site [active]"
                     /db_xref="CDD:240095"
     misc_feature    complement(order(404309..404314,404627..404629,
                     405041..405043,405185..405187,405281..405283,
                     405287..405289))
                     /locus_tag="CNE_BB1p04030"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240095"
     misc_feature    complement(order(404783..404785,404789..404791))
                     /locus_tag="CNE_BB1p04030"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240095"
     misc_feature    complement(404783..404785)
                     /locus_tag="CNE_BB1p04030"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240095"
     gene            complement(405366..406130)
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /db_xref="GeneID:10915384"
     CDS             complement(405366..406130)
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687866.1"
                     /db_xref="GI:339328174"
                     /db_xref="GeneID:10915384"
                     /translation="MDIKGISAVVTGGASGLGRATVEKLLASGARVVIADLPTSAGVE
                     IASELGSACRFVPADVTSEEQMIEVFRTAQAMAPLRATVHCAGRGGPIRVVDKSGVPG
                     SLEHYEQIVRINLVGTFNVVRLAAAEMAKLEELDGERGAIVLTSSVAAFEGQIGQIPY
                     ASAKAGIVGMTIVAARDLASRKIRVCTIAPGTFDTPILARVSAEAREGLAKAVPHPSR
                     LGRPPEFAMLATHIIENPMMNGETIRLDGAIRMPPR"
     misc_feature    complement(405378..406130)
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK08217"
                     /db_xref="CDD:181297"
     misc_feature    complement(405372..406121)
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(405552..405563,405639..405641,
                     405651..405653,405690..405698,405870..405878,
                     406017..406025,406080..406082,406086..406091,
                     406095..406097))
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(405639..405641,405651..405653,
                     405690..405692,405789..405791))
                     /gene="fabG7"
                     /locus_tag="CNE_BB1p04040"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(406153..407331)
                     /locus_tag="CNE_BB1p04050"
                     /db_xref="GeneID:10915385"
     CDS             complement(406153..407331)
                     /locus_tag="CNE_BB1p04050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687867.1"
                     /db_xref="GI:339328175"
                     /db_xref="GeneID:10915385"
                     /translation="MKNPVIVDAIRSPMARGKAGGALSSLHPTDMLGNLFKALMTRHD
                     IDPASVDDVIVGCVSQVGEQSGNPGRLAWLGAGLPETVPSTTVDRRCGSSQQAVHFAA
                     QGIAAGAYDIVIAGGVESMSRIPMFSARIGQDPVGSQVYERYANGLILQGTAAERIAG
                     RWGISREEMNAYSARSHQRAQAARDSGAFASEIVPVTANGVDFRHDETIRDNCTAESI
                     AHLKPSFVDEKMQALYPEIRWSVTAGNSSQLCDGASALLLMSEETAVRLRLKPRARFV
                     AFDVIGDDPNMMLTAPIPATKRALAKAGLKPGDIDHFEVNEAFASVPLAWLREIGADP
                     ERLNPRGGAIALGHPLGASGGRLMTTMLHALEQTGGRYGLQTMCEAGGLANATIIERL
                     "
     misc_feature    complement(406156..407331)
                     /locus_tag="CNE_BB1p04050"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK07801"
                     /db_xref="CDD:181123"
     misc_feature    complement(406159..407319)
                     /locus_tag="CNE_BB1p04050"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(406186..406191,406426..406428,
                     406486..406488,406492..406494,406498..406500,
                     406966..406968,407011..407013,407020..407025,
                     407044..407046,407068..407079,407110..407112,
                     407122..407124,407131..407133,407176..407178,
                     407257..407259))
                     /locus_tag="CNE_BB1p04050"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(406198..406200,406288..406290,
                     407059..407061))
                     /locus_tag="CNE_BB1p04050"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            407246..407635
                     /gene="fadA1"
                     /locus_tag="CNE_BB1p04060"
                     /db_xref="GeneID:10915386"
     CDS             407246..407635
                     /gene="fadA1"
                     /locus_tag="CNE_BB1p04060"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="YP_004687868.1"
                     /db_xref="GI:339328176"
                     /db_xref="GeneID:10915386"
                     /translation="MGCKDESAPPALPRAIGERIASTITGFFIVVPFLFIPDQIAAHG
                     DGLMLNRNKCASPLQEKLRSSISHRQNEGHGESMLDKCDCALKQLRMVFNAACVAIRR
                     TPRSVKLTLPAAVRCAAAEKMRHVQNQ"
     gene            407820..408056
                     /locus_tag="CNE_BB1p04070"
                     /db_xref="GeneID:10915387"
     CDS             407820..408056
                     /locus_tag="CNE_BB1p04070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687869.1"
                     /db_xref="GI:339328177"
                     /db_xref="GeneID:10915387"
                     /translation="MLDFARLQALPDLLSHHAQVRPLATALEFEGRVTSYAELDERST
                     RLAALVHRDRPGSSAQSERQGAAPAVAGALLDRL"
     misc_feature    407868..>407990
                     /locus_tag="CNE_BB1p04070"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     gene            408053..408895
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /db_xref="GeneID:10915388"
     CDS             408053..408895
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687870.1"
                     /db_xref="GI:339328178"
                     /db_xref="GeneID:10915388"
                     /translation="MTGASIDAIHSSRSAAHRLPQPAGIQEAGKQEIAMMENTFNLSG
                     KSALVVGGSSGIGNGIARAYLERGATVHVWGTRACAADYAGEAGSNLDGLCYAQVDVS
                     DADALTRFEPSFTELDILVLAQGAVKYRRQEFEIESFRHVVDVNLNSVMHCSLRFFEM
                     LKRSTGSIIIISSIGAYKSVKGNPAYAASKAGLLGLTRTLGDAWGAEGVRVNAIAPGM
                     VATKMTAVTTAHPDRRQAALDTISVGRFGTPEDMAGVALFLASPLASYITGQTLIVDG
                     GRSL"
     misc_feature    408170..408883
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    408170..408883
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    order(408203..408205,408209..408214,408218..408220,
                     408275..408283,408419..408427,408563..408571,
                     408608..408610,408620..408622,408698..408709)
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(408488..408490,408569..408571,408608..408610,
                     408620..408622)
                     /gene="fabG8"
                     /locus_tag="CNE_BB1p04080"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            408949..410049
                     /locus_tag="CNE_BB1p04090"
                     /db_xref="GeneID:10915389"
     CDS             408949..410049
                     /locus_tag="CNE_BB1p04090"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_004687871.1"
                     /db_xref="GI:339328179"
                     /db_xref="GeneID:10915389"
                     /translation="MSQIQLAQPSAAAATEDVSAPVDLVALARWMDENGLESGPVHAV
                     SRIGGGTQNILLRFRRGAREFIFRHPPAHPRPESNKTMIRESRVLAALASTGVPHPRL
                     IATCTDETVLGAVFYLMEPVAGFNATVAMPGQAKESPELRHAMGFALIDGLVALANVD
                     HEAVGLSDFGRLDGFLERQVGRWAAELESYHRYPEWSGRGELGDVHGIGAWLEQNRPV
                     GMRPGIMHGDYHIGNVLYHADGSLAAIVDWEMATLGDPLMDLGRLLSTWPDGDGPPVL
                     SMRVDPSTGFPTREALIARYAKKSARDLSNLPWFEILACYKLGILLEGTYARAQAGKA
                     DPATGARLHATAIALLERARQRITSNREKVQQ"
     misc_feature    409075..409755
                     /locus_tag="CNE_BB1p04090"
                     /note="Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal
                     domain, and similar proteins. This subfamily is part of a
                     larger superfamily that includes the catalytic domains of
                     other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs); Region:
                     ACAD10_11_like; cd05154"
                     /db_xref="CDD:240175"
     misc_feature    409078..409776
                     /locus_tag="CNE_BB1p04090"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(409099..409101,409111..409113,409144..409146,
                     409150..409152,409246..409248,409303..409314,
                     409630..409632,409642..409647,409651..409653,
                     409684..409689,409744..409746)
                     /locus_tag="CNE_BB1p04090"
                     /note="putative active site [active]"
                     /db_xref="CDD:240175"
     misc_feature    order(409099..409101,409630..409632,409744..409746)
                     /locus_tag="CNE_BB1p04090"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240175"
     misc_feature    order(409111..409113,409144..409146,409150..409152,
                     409246..409248,409303..409314,409630..409632,
                     409642..409647,409651..409653,409684..409689)
                     /locus_tag="CNE_BB1p04090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240175"
     misc_feature    <409615..409899
                     /locus_tag="CNE_BB1p04090"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(409630..409632,409744..409746)
                     /locus_tag="CNE_BB1p04090"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     gene            410046..411281
                     /locus_tag="CNE_BB1p04100"
                     /db_xref="GeneID:10915390"
     CDS             410046..411281
                     /locus_tag="CNE_BB1p04100"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004687872.1"
                     /db_xref="GI:339328180"
                     /db_xref="GeneID:10915390"
                     /translation="MNFEYSDRQRQLGERVRGFMTEHVYPAVPAYFAELQQQRWQQPA
                     VLQTLKQTAREAGLWNLFLPPSPEHDTDEFRGAGYSNLEYALAAEEMGRLTWASEVFN
                     CSAPDTGNMEVLHRYGTQAQQERWLRPLMRGEIRSAYAMTEPDSACSDATNVQTRIER
                     QGDEYVINGRKWWISGVGDPRCKLLIVMGKTNPESPRHAQQSQILVPIDTPGIHIGRM
                     MTNFGYDDAPHGHFEVTFDNVRVPAENLVLGEGRGFEISQGRLGPGRIHHCMRIVGLA
                     EVALEKMTRRLLERRTFGKVIADHSIWEQRVAQARIDIEMTRLLTLKAADMMDKVGNK
                     VARLEISMIKVAAPRTALRIIDHAIQSFGAGGLDSDAGTAALFARVRALRIADGPDEV
                     HARTIAKLEYAKYAAKAAA"
     misc_feature    410046..411242
                     /locus_tag="CNE_BB1p04100"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    410085..411248
                     /locus_tag="CNE_BB1p04100"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(410370..410372,410460..410462,410466..410468,
                     410562..410564,410568..410570,411198..411206,
                     411210..411212,411216..411218)
                     /locus_tag="CNE_BB1p04100"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            411399..412733
                     /locus_tag="CNE_BB1p04110"
                     /db_xref="GeneID:10915391"
     CDS             411399..412733
                     /locus_tag="CNE_BB1p04110"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004687873.1"
                     /db_xref="GI:339328181"
                     /db_xref="GeneID:10915391"
                     /translation="MGNVIGQPNTKRDHVGQRTIFTSATLYDGRNSKQTGMTVVVEGG
                     RISAIHRERADPGGGRHIDLAGRTIMPGMTVGHWHGEFVNIGPPLFASGRAGTFVGTE
                     QPPAILALQAASALRSALMSGVLRVISAACSNNLDGQMKMALESGLIEGADIVPCSRH
                     ILGTADQEDRGQWWRSPAPVCDGLRRIGGNVFADGVDAMVRAVRQEILFGAEIVKTYI
                     DGGHGLDWTPGYRSISLSELRALVDAAHERDKRVRVHVTNKASILKCIEAGVDILDHC
                     DYLDEQCIEAMAGHGTYFIPSPVFGKLASSAARGERLDPANPVDRTWLNLLEMVPKAN
                     AAGVRIVPGDDFGAQGMLHAPGVYGRELEIYVKDFGIPADDVIRWATANGAQMALADH
                     ESGTLETGKAADLIVLDGDPGEDIGILCDPARYLKLILQRGRIVKDELGSAH"
     misc_feature    411453..>411638
                     /locus_tag="CNE_BB1p04110"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    411510..412712
                     /locus_tag="CNE_BB1p04110"
                     /note="Imidazolonepropionase and related amidohydrolases
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: HutI; COG1228"
                     /db_xref="CDD:224149"
     misc_feature    411582..412655
                     /locus_tag="CNE_BB1p04110"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(411627..411629,411633..411635,412161..412163,
                     412221..412223,412431..412433)
                     /locus_tag="CNE_BB1p04110"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            412822..416307
                     /locus_tag="CNE_BB1p04120"
                     /db_xref="GeneID:10915392"
     CDS             412822..416307
                     /locus_tag="CNE_BB1p04120"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
                     /protein_id="YP_004687874.1"
                     /db_xref="GI:339328182"
                     /db_xref="GeneID:10915392"
                     /translation="MRDVTVEDKYLLEAGMAMMTGIQALVRLPMLQRGLDRKRGLNTA
                     GFISGYRGSPLGAYDLELWKAKAHLEREDILFQPGVNEDLAATAVWGTQTLGPLHRPT
                     KDGIFAIWYGKGPGVDRSGDPLRHGNIAGTHPNGGVLVVAGDDHAGKSSSIAHQSESV
                     LMHAGIPVLAPSNVQDILDFGLLGFALSRYTGLYAGLKVCNEVIEQTMTVAIPAHAGA
                     WALPERGSAPPTGFHNYPSDRDRIQSEIVVKRYRLPLVERFLRANYVNRVLVEATQRR
                     LGIVTAGKAVQDVRQALGLLGLSDAHATRLGISVYQLGCVYPLEPQGMADFARGQQEL
                     LFIEEKNPIVEHQAKVALYGQPGMPRIVGKTDEDGIAMIACDTQLEPLKLAIVIGERL
                     RRLGIEDAEVAARVQRLIGQAELAAALNPPTDVVRAPYFCSGCPHNTGTRFPEGSVAA
                     GGIGCHAMAMYSGPEMLTTSHMGGEGAHWYSVAHFSGVPHIFQNMGDGTYYHSGLLAI
                     RGAIAANVNMTFKILFNDAVAMTGGQPVDGPLTPGDITRQVLAEGVKRCVLVTDRPDL
                     YGPRSGLADGVAVHHRDHYDTVQRQLREIKGVTVVIYEQTCAAEKRRRRKRDKFSDPP
                     RRMFIHAEVCEGCGDCSTQSNCVSVWPKETELGRKREIDQSNCNKDYSCVKGFCPSFV
                     TVLGAEPRKPETADLAGLSLTGLPAPAVAPIGEAGFNLMISGIGGTGVVTIGALLGMA
                     AHLERKACSIFDMTGLSVKNGAVFSHVRIAANQGQLRAARLGAAEADLALAFDAVAAL
                     SREPAATYDATRTRTVANARIVPVAAFQRNPDLTIDQRQIVRKLEKQCAELEVVDATG
                     LGLALLGDAIAANLFLLGHACQRGLLPVTPEAVERAVEINGVAIAFNKKAFALGRYYA
                     IDPAALEAAAGARQKINFKSLSELPDIVAHRSHMLTAYQNAAYAERYRRLVQRVVTAE
                     ERVMPGKTALAVAVARNFARLMAYKDEYEVARLYSDPAFKRQLRDAFEDGATIRYNLA
                     PPLLARRDPGSGHLIKREFGPWLAKLFPLLANLKGLRGTPLDLFGYTAERRMERSLID
                     HYEMQMTMVADCLTPSSHAVAIELAGIAGQIRGFGHVKEANVVKARALERRTLERFHA
                     ACASACVEPRTAVQA"
     misc_feature    412822..416262
                     /locus_tag="CNE_BB1p04120"
                     /note="indolepyruvate ferredoxin oxidoreductase;
                     Validated; Region: PRK09193"
                     /db_xref="CDD:236404"
     misc_feature    412882..413400
                     /locus_tag="CNE_BB1p04120"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    order(412957..412962,412978..412980,412990..412992,
                     412999..413001,413050..413061,413080..413085,
                     413089..413097,413104..413106,413110..413112,
                     413188..413190,413197..413199,413209..413211,
                     413257..413262,413308..413313)
                     /locus_tag="CNE_BB1p04120"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(412957..412962,412969..412974,412978..412980,
                     412996..413001,413050..413061,413080..413085,
                     413089..413097,413104..413106,413110..413112,
                     413188..413190,413197..413199)
                     /locus_tag="CNE_BB1p04120"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(412972..412974,413065..413067)
                     /locus_tag="CNE_BB1p04120"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(412978..412980,413251..413253)
                     /locus_tag="CNE_BB1p04120"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     misc_feature    414097..414642
                     /locus_tag="CNE_BB1p04120"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(414235..414237,414307..414318,414394..414396,
                     414400..414402)
                     /locus_tag="CNE_BB1p04120"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     misc_feature    414973..415554
                     /locus_tag="CNE_BB1p04120"
                     /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
                     Region: POR; cl00546"
                     /db_xref="CDD:260490"
     misc_feature    <415408..416235
                     /locus_tag="CNE_BB1p04120"
                     /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
                     Region: POR; cl00546"
                     /db_xref="CDD:260490"
     gene            complement(416362..416793)
                     /locus_tag="CNE_BB1p04130"
                     /db_xref="GeneID:10915393"
     CDS             complement(416362..416793)
                     /locus_tag="CNE_BB1p04130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687875.1"
                     /db_xref="GI:339328183"
                     /db_xref="GeneID:10915393"
                     /translation="MVPDDLSPNARLALRALACASERNLEGFRTCCAPDIVLDFPFHP
                     NGAQTHYGVDEMIREFSVEKVFETFRIDPQEVLDCGDKIIIEGRSHGTYRSGRPPYGN
                     HYIFIMACKDGKVTHWKEFYNPLEALKQNYGKPRPEKQAGA"
     misc_feature    complement(416440..416757)
                     /locus_tag="CNE_BB1p04130"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            417184..418920
                     /gene="kstD"
                     /locus_tag="CNE_BB1p04140"
                     /db_xref="GeneID:10915394"
     CDS             417184..418920
                     /gene="kstD"
                     /locus_tag="CNE_BB1p04140"
                     /EC_number="1.3.99.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxosteroid 1-dehydrogenase KstD"
                     /protein_id="YP_004687876.1"
                     /db_xref="GI:339328184"
                     /db_xref="GeneID:10915394"
                     /translation="MAETYDVVVVGSGAAGLMAAARAAYHGLSVLVVEKAHQWGGTSA
                     SSGGGVWVPNHGLGSPGDSREKALTYLQAVSKGDVRRDRLESFVDNGPRMLQFLEQIG
                     VRLHVLDGYPDYFPDAPGAHIGRALFPYEIDAMEVGDSVHAMRSAPVRGKLFNRYSFG
                     LDEAFTLATRAPRWRRVIISIFKRYWLDFEWRRITRRDRRLTMGNALTGGLRREVDRR
                     GVKIQLNTALEDLVLHEGTVTGVRLVRNDRHYVAHVRHGVVMASGGFEWNQEMRNRYF
                     TVPTPANWSSSPERANDGAGTLAAQRVGAATEFMETGWFIPSMLLPTIGVPNAEMTHQ
                     MSFDHGRPHSVCVNRNGVRFVKECIAYDQFGLAMLEDHATTGANMTVWLVFDAQFREK
                     YNAGGFMLNAIMPDRKVPREWWNHYVYRADTIEELAARIEIDPKALSQTVRKMNEYAR
                     TGVDPEFGRGSDDYDRFTGDARITPNSSIGSIDTPPYYAVPVVLGDMGTKGGLKCDAN
                     ARVLGPSDKPIPGLYAAGNAAGSPFGVCYPGAGGTIGPAMTFGFVAVEDIVARMPRRC
                     QTDTVPPKAQSM"
     misc_feature    417190..418866
                     /gene="kstD"
                     /locus_tag="CNE_BB1p04140"
                     /note="3-ketosteroid-delta-1-dehydrogenase; Reviewed;
                     Region: PRK12844"
                     /db_xref="CDD:183787"
     misc_feature    <417793..418875
                     /gene="kstD"
                     /locus_tag="CNE_BB1p04140"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            418937..419050
                     /locus_tag="CNE_BB1p04150"
                     /db_xref="GeneID:10915395"
     CDS             418937..419050
                     /locus_tag="CNE_BB1p04150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687877.1"
                     /db_xref="GI:339328185"
                     /db_xref="GeneID:10915395"
                     /translation="MKPIGTRHLSSRVAAYSIETQQPRHVAVELHPAWLIV"
     gene            419311..420945
                     /locus_tag="CNE_BB1p04160"
                     /db_xref="GeneID:10915396"
     CDS             419311..420945
                     /locus_tag="CNE_BB1p04160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687878.1"
                     /db_xref="GI:339328186"
                     /db_xref="GeneID:10915396"
                     /translation="MSNIKGWARGLHAAAALGLLIGVARDAQAFKFDLPDPDFEVRWD
                     NTVRYNIGIRAEGRDSRIINNPLFDTSDMKFDQGDLVTNRVDLLSEMDVVYKGRHGFR
                     ISAAGWYDNAYSDTKVEGNPIFGPPSSYPGGNYTNYVKRYNRGPSGEFLDAFAFTKFD
                     LGNVPVNLKLGQHTTYWGESLFSLSNSIAYSQGPVDVIKATANPGSQAKELFLPIAQI
                     SGQAQLTEELSVAALYFLDWKPWRLPDGGTYFGSANFFSVGGGTFVQPGVPFLGASDR
                     PRNTGDWGVMGRWSPDWLQGTVGFYYREFDEKLPWVVFNPGFSSARLAYAENTKLYGV
                     SLAKQLGGASIGAEVSYRKDAALNSNAALSAQGARGDTVHALVNGIAYFGNSPLWGAA
                     PLTAELNYTHLIKAKSNGGLLPLEGTAACVSATPGVPGDVYDGCVTKNAWALNLSFEP
                     VWYQVLPGVDLKAPLSYSIGLGGNAATLGGSRKGNGAYSIGLTAEVHNRYSISLKYND
                     YLVKFRDNGTAVTTNNGGGALYSDRGWVSLTFQTSL"
     misc_feature    419398..420939
                     /locus_tag="CNE_BB1p04160"
                     /note="Protein of unknown function (DUF1302); Region:
                     DUF1302; pfam06980"
                     /db_xref="CDD:254001"
     gene            421154..422527
                     /locus_tag="CNE_BB1p04170"
                     /db_xref="GeneID:10915397"
     CDS             421154..422527
                     /locus_tag="CNE_BB1p04170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687879.1"
                     /db_xref="GI:339328187"
                     /db_xref="GeneID:10915397"
                     /translation="MNYGMKSIALTLAALGAGTAIAAIPAEEAKQLEGALTPFGAIKA
                     GNKSGTIPEYTGVPLTPPASFDPKNPGYLPDPFASDKPLFSIDAKNMAQHVDKLAEGV
                     KAMLARHPGYHLNVYPSRRTMIYPKYALDGSMANATNCKLENDNLTGCQAGVPFPIPR
                     NGEEAIWNHLLAFYGVSSTYTLGSYVVDRSGRMTLMSWFRASEDKPYWDSSNKGDGSA
                     KLLSRVRYDTDEPARSAGERLLLISPIDQKEVAPVYQYLPGQRRVKLSPDLAYDTPNP
                     SSGGVSAMDEVRGFYGKTDRFNWKLIGKKEMYIPYNAYKTLSPECSEEKMHTKDFLNP
                     ACVRWELHRVWHIEATLKEGKRHIFSKRIMYIDEDSFGAGVYDGYDAAGNLYRTTQQL
                     PYYVYSDPKQGTGMFSQPFVTYDLQTGAYGSFNHVAFSRKGQVPVPGRVADREYTPGA
                     LAGGGIR"
     misc_feature    421406..422512
                     /locus_tag="CNE_BB1p04170"
                     /note="Protein of unknown function (DUF1329); Region:
                     DUF1329; pfam07044"
                     /db_xref="CDD:254034"
     gene            422676..423752
                     /locus_tag="CNE_BB1p04180"
                     /db_xref="GeneID:10915398"
     CDS             422676..423752
                     /locus_tag="CNE_BB1p04180"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="YP_004687880.1"
                     /db_xref="GI:339328188"
                     /db_xref="GeneID:10915398"
                     /translation="MNRPFRVLAICLACALPFTANAFQNPLSLPSKTIPHPDQAPMFA
                     IAQAGSRTVSVGRHGVIAYQDRNGKAWRQAKVPVSSDLVGVSFVDERMGWAVGHGGVV
                     LHSADGGATWAKQLDGKDAGQAALAYYRKHADDLGPENRDTVLKQAARWAEEATAQPF
                     LDVWFKNESTGYIVGSFNRIMRTDDGGKQWIPLIDKIDNPGELHFYTVRGNGDDVYIA
                     GESGSVWRWDEHKGKFILVKTPYDGSLFGLVLAGRAVLAYGMRGSLFRTFDRGASWEK
                     IKTDVRGGIVAGDVSQTGEIIVASQSGDILRSSDNGGSFARAADPLPTAVAGLLAFPT
                     GAYVTVGPRGVRTGESANRVPQSR"
     misc_feature    422694..423710
                     /locus_tag="CNE_BB1p04180"
                     /note="Uncharacterized protein related to plant
                     photosystem II stability/assembly factor [General function
                     prediction only]; Region: COG4447"
                     /db_xref="CDD:226855"
     misc_feature    422880..>423281
                     /locus_tag="CNE_BB1p04180"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     gene            423779..426214
                     /locus_tag="CNE_BB1p04190"
                     /db_xref="GeneID:10915399"
     CDS             423779..426214
                     /locus_tag="CNE_BB1p04190"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_004687881.1"
                     /db_xref="GI:339328189"
                     /db_xref="GeneID:10915399"
                     /translation="MVNAPMHQEAGPVHRDPAQFDRSSGSLVERLIFNHRTWVMLACL
                     LVTAVFGYQLRLLHVNASFEKMLPHSHEFVRHYLENRDELRGLGNTVRVVVENTQGDI
                     YNRDYLTTLGKANDKIFLSPAVDRAWMKSLFSPAVRWSEVTETGFDGGPLMPNSYDGS
                     EAAIAELKLNIERAGQIGNLVSIDQRSSMIVIPLLDRDADGKPVDYAALSAVLEEVRS
                     EIQKDSRYRVHIIGFAKLVGDLIEGLEKVMTFFALAAFTATAIIYLYTRDVRSTMLVM
                     ACSIVAVIWQLGIVASLGMEIDPFSILVPFLVFAIGVSHGAQKMNGVMQDIGRGMHQW
                     VAARFTFRRLFLAGLTALLADAVGFAVLMIIDIPVIRELALSASVGVAVLIFTNLILL
                     PVLLSYVGVSSSAACRSLAGASGGGKKRVASGIWGWLGRFTERGYALCAVGVGVALAV
                     LAFGKSMDVKIGDLDPGAPELRSDSRYNLDNAFITEKFGISSDVFAVMVKTPMDGCRS
                     FETMIEMDRLGAELDRVPGVQQTTSLVDTLRLFTVGAYEGNPKWLTVAWDPLVLKDRI
                     NLAQNWKSEMLNNDCSFMPVLAYLEDHKAGTLKRVVAVAQDFAARNSVPDRQYLMAAG
                     NAGIEAATNAVVEKANREMLLWVYVAVALLCAITFRNWRAVLVAVLPLMLTSIMAEAL
                     MAMLGIGIKVATLPVVALGVGIGVDYALYLLSVQLSFQRQGYSLRESYQHALERTGKM
                     VALVGVTLAAGVITWAVSPIKFQADMGIMLTFMFLWNMIGALILIPALSHFLLKDVNV
                     SKAGQVPAFGGAH"
     misc_feature    423860..426142
                     /locus_tag="CNE_BB1p04190"
                     /note="Predicted exporters of the RND superfamily [General
                     function prediction only]; Region: COG1033"
                     /db_xref="CDD:223964"
     misc_feature    <425666..426142
                     /locus_tag="CNE_BB1p04190"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(426487..427728)
                     /locus_tag="CNE_BB1p04200"
                     /db_xref="GeneID:10915400"
     CDS             complement(426487..427728)
                     /locus_tag="CNE_BB1p04200"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004687882.1"
                     /db_xref="GI:339328190"
                     /db_xref="GeneID:10915400"
                     /translation="MSEQKADPVIEVNPENQWRLITPGSDSWPRSPRPNSNKKKYFMV
                     TVDSHMSPPPTLFKDRIDKRFVDRLPRFEVRDGKKYIVQEGLPPARVAETRLEGEDEL
                     RTKAGAYLIHDPMTIEERHRNLDLDGVDGEIIFPNGAALLMFTSRDAEFLMAQARVWN
                     DWLWQECAPYKHRTKAIAAIPTVDIDMAVAEVQRVAKMGYDIIMLPNKPVFGPPELGQ
                     PNYNLPEYDRLWAAIQDADLAITFHVSTGQDPRTASGNGGAILNFCIHSLGPTIEPVV
                     ALCASGVIERFPGIRFATIEANGGWAPWLLDRMDEAYRTHHFWVRPKLKNLPSEYYRA
                     NGAASVGEDRAALMLADAYGLENNFMWANDYPHHEGTWPHSAESIERTCATLKEESRA
                     KILGLNAARFFKFDIPKHYLD"
     misc_feature    complement(426514..427407)
                     /locus_tag="CNE_BB1p04200"
                     /note="Amidohydrolase; Region: Amidohydro_2; pfam04909"
                     /db_xref="CDD:252869"
     gene            428151..431645
                     /locus_tag="CNE_BB1p04210"
                     /db_xref="GeneID:10915401"
     CDS             428151..431645
                     /locus_tag="CNE_BB1p04210"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
                     /protein_id="YP_004687883.1"
                     /db_xref="GI:339328191"
                     /db_xref="GeneID:10915401"
                     /translation="MTKSVTTLNDKYLLESGRVFISSNQALVRLPLDQARRDRAQGLV
                     TTGYISGYRGSPLGVYDAALWGAQSLLDEHDVRFHAGLNEELAATAIRGTQELSWFGK
                     SKYQGVFGLWYGKGLGADRASESLKLGNLEGSAAHGGVLAVVGDDHGGKSSASAHQSE
                     HTLIAGFVPTLYPSTIREILEFGIFGWALSRYSGLYVGLKCITDTLDLAASVELPDAC
                     RQFVIPADLELPPEGLNLRPKLPPLVQEDWVLNQRLPAAAAFVRANGIDRVILDSPRR
                     NLSIVAAGKAYLDVRQALADLGLDEARCRELGVRLYKPGMIWPLERETAVAFAQGSKA
                     VLVVEEKRPVIEDQLARHLYGISADRRPALAGKQDLNGAALLPLNGELTAAAVRRAIK
                     RVLDQIGLTPPDVTARFDAFNRIEEKTSVAGGGVSRPAFYCSGCPHNTSTRIPDGSIA
                     ISAVGCHGLAAYVMPERRTMQPMPMGGDGMPWVSVGPLVDTPHVFQNIGDGTYSHSGI
                     LAIRAAVAAKANMTFKVLYNDAVAMTGGQPLEAAIGPVDVIRQLVAEGVSPVMLVTDD
                     PDKFSGVLPAGVKVHHRDLLDKLQRELREVKGVSGIVYEQTCATEKRRRRKRGKFPDP
                     DKRVFINQDVCEGCGDCSVQSNCVSIQPLETEFGRKRMIHQSTCNKDFSCVKGFCPSF
                     VTVRGAGIARKPVVDADGFETLIAALPAPARVSQDEECNVLVAGIGGTGVLTVGALLG
                     MAAHLEGKGCTILDMTGMAQKGGAVTSHIRISRNHEQAHSSRLGAGMTDVILACDMIV
                     ASGAEVMKTVKPGRTRAVVNTDVVPTGEFQTRRDFQIGEDELLEVIRQGIDGGELLAF
                     QASRLATDFIGDSIATNVLMVGYAVQKGLLPLSVESIQEAIRLNGTFVEGNLRTFALG
                     RLAAHSPDAFAPHEKGGNVSRLDTIEEILASRIGLLTDYQDAAYAKVYEDFMLAIEGR
                     VQQKKLSRGAVFVREVAMTLARLMAYKDEYEVARLHSDGKFRERLLTQFSGDIKLTFH
                     LAPPMLPGRDRASGRPRKREFGQWIVPAFRVLKSFKGLRGTLLDPFGYSAERRMERGL
                     IREYRSLIETVTDKLGQHNIQVAIDLARAPADIRGFGPVKQAALKEYRARETALLAAL
                     DAPEPAGHEQPIFLMKRR"
     misc_feature    428151..431618
                     /locus_tag="CNE_BB1p04210"
                     /note="indolepyruvate ferredoxin oxidoreductase;
                     Validated; Region: PRK09193"
                     /db_xref="CDD:236404"
     misc_feature    428268..428735
                     /locus_tag="CNE_BB1p04210"
                     /note="Pyrimidine (PYR) binding domain of thiamine
                     pyrophosphate (TPP)-dependent enzymes; Region:
                     TPP_enzyme_PYR; cl11410"
                     /db_xref="CDD:264357"
     misc_feature    order(428292..428294,428307..428309,428334..428336,
                     428382..428387,428397..428399,428406..428408,
                     428415..428420,428424..428432,428466..428468,
                     428520..428525,428532..428534)
                     /locus_tag="CNE_BB1p04210"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(428307..428309,428334..428336,428382..428387,
                     428397..428399,428508..428513,428517..428519,
                     428637..428639,428643..428645)
                     /locus_tag="CNE_BB1p04210"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(428307..428309,428400..428402,428511..428513)
                     /locus_tag="CNE_BB1p04210"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    429432..429974
                     /locus_tag="CNE_BB1p04210"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(429573..429575,429645..429656,429732..429734,
                     429738..429740)
                     /locus_tag="CNE_BB1p04210"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     misc_feature    430299..430907
                     /locus_tag="CNE_BB1p04210"
                     /note="Pyruvate:ferredoxin oxidoreductase and related
                     2-oxoacid:ferredoxin oxidoreductases, gamma subunit
                     [Energy production and conversion]; Region: PorG; COG1014"
                     /db_xref="CDD:223946"
     gene            431703..432476
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /db_xref="GeneID:10915402"
     CDS             431703..432476
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase PaaF"
                     /protein_id="YP_004687884.1"
                     /db_xref="GI:339328192"
                     /db_xref="GeneID:10915402"
                     /translation="MSSKNLSTLSLEIHDHIAHLRFTRPALLNRFDELAHLEFADVLD
                     DIGRDPAIRALVISAEGKVFSAGGDFEEIIQARDSVQVRERIMRDARRVFRSLVTLPV
                     PVIAAVQGASVGMGATVMTLCDIVVAYENAKVSDPHVSIGLVAGDGGIVGWSQAAGLM
                     RAKRFLLTGDAMSARDAYEMGLVTDLVETPEKALERALQIARRIADLPRAGVEGTKRA
                     FMRLTEQTAHTVFEAGLAYEMESMTRPEVAEMIASLKKK"
     misc_feature    431721..432449
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    431727..432314
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(431784..431786,431790..431792,431886..431888,
                     431898..431912,432033..432035,432039..432047,
                     432111..432116,432123..432125)
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(431904..431906,432045..432047)
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(431985..431987,432009..432011,432072..432083,
                     432117..432128,432144..432146,432150..432158,
                     432162..432167,432180..432185,432189..432194,
                     432198..432203,432210..432212,432243..432245,
                     432252..432254,432300..432302,432309..432314)
                     /gene="paaF"
                     /locus_tag="CNE_BB1p04220"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            432588..433349
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /db_xref="GeneID:10915403"
     CDS             432588..433349
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /EC_number="4.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="carnitinyl-CoA dehydratase CaiD"
                     /protein_id="YP_004687885.1"
                     /db_xref="GI:339328193"
                     /db_xref="GeneID:10915403"
                     /translation="MSELEFTVSEGVAVITINRPEAKNAINAAVALAIADATDQIDQR
                     SDVSVAILTGAAGVFSAGMDLKAFLRGENVKPRGRGLAGLTNATVRKPLIAAVEGYAL
                     AGGFELALACDLIVAAETAKFGLPEVRRGLVANAGGLVRLPRQLPYRIAMELVLTGAM
                     VSARELHAHGLINRVAPEGQALDAALDLARTIAANGPMATMVSKQVMKESQDWASTEL
                     FERQDAYTMPVFRSNDAREGALAFAEKRKPVWAGN"
     misc_feature    432588..433343
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK08252"
                     /db_xref="CDD:181325"
     misc_feature    432597..433163
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(432654..432656,432660..432662,432756..432758,
                     432768..432782,432885..432887,432891..432899,
                     432963..432968,432975..432977)
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(432774..432776,432897..432899)
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(432855..432857,432861..432863,432924..432935,
                     432969..432980,432996..432998,433002..433010,
                     433014..433019,433032..433037,433041..433046,
                     433050..433055,433062..433064,433095..433097,
                     433104..433106,433149..433151,433158..433163)
                     /gene="caiD"
                     /locus_tag="CNE_BB1p04230"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            433534..434670
                     /gene="acdA1"
                     /locus_tag="CNE_BB1p04240"
                     /db_xref="GeneID:10915404"
     CDS             433534..434670
                     /gene="acdA1"
                     /locus_tag="CNE_BB1p04240"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase AcdA"
                     /protein_id="YP_004687886.1"
                     /db_xref="GI:339328194"
                     /db_xref="GeneID:10915404"
                     /translation="MSAIHVDPPGFMATEELACSRPWQDASSTAMRARPMSSAGAPMA
                     PWTGSYGTRPARPACSASAFRKNTAAVAATSGMRSCSWNSSVCVGSRDSRFPCTMRLS
                     HPTWSVTGWKRKSASGCPRLSPARRVLAVAMSEPAAGSDLQGMRTTARRDGDHYVING
                     QKTFITNGLHATLVIVAAKTGQDEGAKGISLFAVEADKVEGFDRGRLLHKLGQEGRDT
                     TELFFHDMRVPAENLLGGVEGRGFQQLMEKLPQERMVIAWQSMASIERALEATIDYAK
                     ERQAFGKRVIDFQNTQFKLAECKTQAKSPKSSCTTARNACYSAPWTTPPRQWRNTGSA
                     RSAARSSTNACSCIAATDICSNIRSHRCSRIRASTGSTAARTKS"
     misc_feature    <433891..>434496
                     /gene="acdA1"
                     /locus_tag="CNE_BB1p04240"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    <433891..>434439
                     /gene="acdA1"
                     /locus_tag="CNE_BB1p04240"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     gene            434829..436052
                     /locus_tag="CNE_BB1p04250"
                     /db_xref="GeneID:10915405"
     CDS             434829..436052
                     /locus_tag="CNE_BB1p04250"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004687887.1"
                     /db_xref="GI:339328195"
                     /db_xref="GeneID:10915405"
                     /translation="MPRSSTSILGRSIMTDDRKKLAELRAEVRSWLAQNVPADWRSEM
                     TGTRTEDFVSFQRKWMKTLVDAGYATAHWPEGWHGGGRSLDEQLVIVEEMVRAGAPRL
                     ILYFISLYHTAMTLAEWGTEEQKARHLPAILHGEIWCQGFSEPNAGSDLASLKTRAHR
                     DGDHYVVNGQKIWSTLGQHADYCLLLVRTDATGPKQAGITFLLMDMKSPGVECRPIRQ
                     ITGDEEFAEIFLTDVRIPVANRIGEENQGWRVAQTTLSSERGVTIFELAERLSWSRWR
                     LLEAISDGNGAVVDDQLRREAVDVFIKIEALRALVRAMMSDMMAGKDIGGAASIVKQL
                     YAQVLREFTALGLRADPAAPLLAPFTLGGGHETGNWSFDYMNSFMWTIAGGTNEIQRN
                     IIAERVLGMPREKSA"
     misc_feature    434892..436028
                     /locus_tag="CNE_BB1p04250"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    434898..436031
                     /locus_tag="CNE_BB1p04250"
                     /note="pimeloyl-CoA dehydrogenase, large subunit; Region:
                     pimC_large; TIGR03204"
                     /db_xref="CDD:132248"
     misc_feature    order(435159..435161,435246..435248,435252..435254,
                     435345..435347,435351..435353,435972..435980,
                     435984..435986,435990..435992)
                     /locus_tag="CNE_BB1p04250"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            436128..437234
                     /locus_tag="CNE_BB1p04260"
                     /db_xref="GeneID:10915406"
     CDS             436128..437234
                     /locus_tag="CNE_BB1p04260"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004687888.1"
                     /db_xref="GI:339328196"
                     /db_xref="GeneID:10915406"
                     /translation="MEVLIDNDELRDSARRVLERHVDRKTLLGDPCATPSFDRHLWQL
                     IAELGWLGLTIAEGKGGLEQPFAALSTLYFELGRALSPQPFLGASVGLEIIAHPGATD
                     CAAGLVQAALQGDAIIVAAATGVGSVTCRPYGGVHMVEGTMRNVLDAVHATHLLVPVE
                     GNQAAIALVALPHPGVDITYRPTWDPTRQVADVAFRELELYEDDIILRGDAAVDAQRR
                     MNAHFDLALACDALGGADAALEGTLVYMHQRHQFNRPIASFQALKHRCAEHKVSIEAA
                     RALIHSVCRSAFEAKKEGQAQAAGARIYAGSVYRSLTEDCVQLHGGIGFTWEYPCHLF
                     LKRARSGEVLGGTAEQRKDRVAPALFTLCHRERR"
     misc_feature    436128..437195
                     /locus_tag="CNE_BB1p04260"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    436152..437195
                     /locus_tag="CNE_BB1p04260"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
                     /db_xref="CDD:173838"
     misc_feature    order(436281..436283,436485..436487,436491..436493,
                     436560..436562,436566..436568,437154..437162,
                     437166..437168,437172..437174)
                     /locus_tag="CNE_BB1p04260"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            437331..438794
                     /gene="ifcA1"
                     /locus_tag="CNE_BB1p04270"
                     /db_xref="GeneID:10915407"
     CDS             437331..438794
                     /gene="ifcA1"
                     /locus_tag="CNE_BB1p04270"
                     /EC_number="1.3.99.1"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_004687889.1"
                     /db_xref="GI:339328197"
                     /db_xref="GeneID:10915407"
                     /translation="MSLKSEAVKQSGIGRWDRSADVVVVGQGIAGACAALEARRGGAE
                     VLIIERASGGGGASAISAGVFYLGGGTDVQKACGYEDSADNMARFLMANTEHPNDELV
                     RLFCNHSVEHFHWLESQGVPFERSGYPGKVFFPPGTECLYSTGNEKVWPYREIAEPVP
                     RGHKAAGAGETGGAVAMHALLAKCAEEGIPALYDSRVTALVVNEAGHVTGVRVRQTTG
                     DLHIEARRGVILATGGLNMNEAMAREHIALLSDTSIPIGIPYNDGIGIVLGQSVGAAV
                     AAMDGVMATAPIYPPEQLIKGIIVNRNGERFVAEDAYHGRTAQFTMEQPGQTAYLIVD
                     AEIFAYPEMTTARHALIDGWETVQEMEKALGMPTGALQKTMAAYNRDAAAGEDNQFHK
                     QGDWIKPLDVGPYAAFDISFTKSAYVYMTLGGLETGIHGEALDAAGRPIQGLYVVGAC
                     AAHIPRSGKSYASGLSLAPGSFFGRRAGRHASGAVSL"
     misc_feature    437376..438788
                     /gene="ifcA1"
                     /locus_tag="CNE_BB1p04270"
                     /note="hypothetical protein; Validated; Region: PRK07121"
                     /db_xref="CDD:180854"
     misc_feature    437400..438776
                     /gene="ifcA1"
                     /locus_tag="CNE_BB1p04270"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(439073..440266)
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /db_xref="GeneID:10915408"
     CDS             complement(439073..440266)
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /EC_number="1.14.12.21"
                     /codon_start=1
                     /transl_table=11
                     /product="benzoyl-CoA oxygenase subunit A"
                     /protein_id="YP_004687890.1"
                     /db_xref="GI:339328198"
                     /db_xref="GeneID:10915408"
                     /translation="MLQEPSYHRQHLIDPAQCIRCNTCLESCPESAIQFDGANYIVDA
                     TICNDCGICKPDCPTGAIDNYRLVPREAPYSLADQSDWEALPEQGPLADGVAPDIVHE
                     AGPGPQISVAPWSATRATTMLFPPAKPVVAKIKSNLRLTAEDAENDIRHIVLDFGEQP
                     HGLLEGQTLAVVPPGSGTSGQPHHLRNYSVASTRHGETAGSNDVAFTVKRVVEARDSG
                     IYRGIASNYLCDARPGDPVQCVGPFGNAFLLPLHPGAKLLMICVGTGVAPFRSFIQHR
                     QRHPQPAAGPWILLYGGRSPQEMAYHDELGLLPAAEVDVRFAYSRLPEHPKTYVHDLL
                     LHAGQEVASLLDDTETYIYICGLRAMEDGVMSAFETICTSSQKNWTELRKAMQEQGRL
                     HIETY"
     misc_feature    complement(439076..440242)
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="benzoyl-CoA oxygenase/reductase, BoxA protein;
                     Region: benzo_boxA; TIGR03224"
                     /db_xref="CDD:132268"
     misc_feature    complement(440087..440215)
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     misc_feature    complement(439076..439900)
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="Ferredoxin reductase (FNR), an FAD and NAD(P)
                     binding protein, was intially identified as a chloroplast
                     reductase activity, catalyzing the electron transfer from
                     reduced iron-sulfur protein ferredoxin to NADP+ as the
                     final step in the electron transport...; Region: FNR_like;
                     cl06868"
                     /db_xref="CDD:263080"
     misc_feature    complement(order(439475..439477,439592..439603,
                     439640..439648,439700..439711,439763..439765))
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99778"
     misc_feature    complement(order(439700..439705,439709..439711))
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="conserved FAD binding motif [chemical binding];
                     other site"
                     /db_xref="CDD:99778"
     misc_feature    complement(order(439565..439567,439583..439585,
                     439592..439594,439601..439603))
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99778"
     misc_feature    complement(order(439463..439465,439469..439480,
                     439490..439492))
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99778"
     misc_feature    complement(order(439196..439201,439385..439393,
                     439472..439477))
                     /gene="boxA"
                     /locus_tag="CNE_BB1p04280"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99778"
     gene            complement(440413..441675)
                     /locus_tag="CNE_BB1p04290"
                     /db_xref="GeneID:10915409"
     CDS             complement(440413..441675)
                     /locus_tag="CNE_BB1p04290"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004687891.1"
                     /db_xref="GI:339328199"
                     /db_xref="GeneID:10915409"
                     /translation="MDLHDNSPAKATLSFDPAGSGHDAWSENFATSRKECPVFWSEAH
                     GGYWTVANHESATRVARDWQTFSSQKSWDPATGHHEGGNVIPSIPGPAFIPVETDPPL
                     WKRYRLLLNPFFAPKAAERFRPIAEEIATALMDRVIEKGSFDIVKDFSNPVPALTTLR
                     ILGIPFDADNWERFADPFHKLAYARELPEFPEVLANLEWIRGKLADLADACHQHPGDG
                     LFSTLCHAEAEGASLSKQELVDIGMMLLVGGVGTTNALFANTMIYLDKHRAILERLVS
                     NPDMLPIAIEEFVRFFSPVSGQARLVKCPVDVGSQHMRPGEPLLLALSSANRDESVFR
                     NPDEVMVDRMPNPHIGFGGGNHRCLGSFFAREMFTAMFREMTKRMPDYAVDHDRASRY
                     PCVASVNGWISAPARFTPGKKVGSAVKL"
     misc_feature    complement(440446..441579)
                     /locus_tag="CNE_BB1p04290"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(441825..442019)
                     /locus_tag="CNE_BB1p04300"
                     /db_xref="GeneID:10915410"
     CDS             complement(441825..442019)
                     /locus_tag="CNE_BB1p04300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687892.1"
                     /db_xref="GI:339328200"
                     /db_xref="GeneID:10915410"
                     /translation="MKVRIKNELCVGHGMCRLACPQIFHLNDQDGHAYILTEEVPPEL
                     EDGVEFAIGSCPEQAIEIFE"
     misc_feature    complement(441828..442019)
                     /locus_tag="CNE_BB1p04300"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: Fer; COG1141"
                     /db_xref="CDD:224064"
     gene            complement(442172..444292)
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /db_xref="GeneID:10915411"
     CDS             complement(442172..444292)
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /EC_number="1.1.2.8"
                     /note="cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_004687893.1"
                     /db_xref="GI:339328201"
                     /db_xref="GeneID:10915411"
                     /translation="MPGSRPTTVLATCLRLTIAAFLALGTSGVPAAPGAQASAHRLAD
                     GNTGGDWAGWGRTYGEQHFSPLSEINGGNVNKLGLAWSVDLPPGNAVSVPLAVGGTLF
                     YTTGYSVIHAVNAASGKPLWRFDPKAAEAAGERLRQGWGSRGIAWWNGMIFTGTQDGR
                     LIAVNAATGREIWSTQTLEPGDHRFISGAPRVFDGKVIIGHGGADSGAARGYVTAYDA
                     RTGKQLWRFWTVPGNPANGFENDAMKMAARTWSGEWWKFGGGGTVWNAMSYDADTDTV
                     FIGTGNGAPWNHRIRSKGKGDNLFLCSIVAIDGKTGAYKWHYQVNPGESWDYNAAMDM
                     HLADLAINGTMRKVLIQAPKNGFLYVIDRLTGQLISAEKIAKVTWADRIDIATGRPVE
                     HPGARFPDGTTFEMWPSNSGAHSWQPSAYSPLTRLVYIPVRETGIAMNDQGIDPDTWT
                     YQGGNKPNLGLNLAPVKPDPLNNTSRLLAWDPVARQEAWRVATPGAWNGGLMATAGNL
                     VFQGQIDGRINGYDSKTGRRLWSFDAGAGILAPPITYTANGKQYLTVLTGVGTSAGID
                     SSQLAATPDYRTQQRRVLTFALNGKAVLSANKTVVPEPVRDADYRPDNQMAMRGMMTF
                     LSHCIECHGIGAIAAGAAPDLRASAIPLYGEAFRHIVHGGALVSQGMPRFTEFTGPQL
                     DDLRQYIRSEAAAWRQRESERNPG"
     misc_feature    complement(442613..444202)
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /note="PQQ-dependent dehydrogenase, methanol/ethanol
                     family; Region: PQQ_enz_alc_DH; TIGR03075"
                     /db_xref="CDD:234102"
     misc_feature    complement(442511..444148)
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    complement(order(442532..442534,442538..442540,
                     442703..442705,442712..442720,442727..442729,
                     442733..442735,442826..442828,442835..442843,
                     442850..442852,442856..442858,443183..443185,
                     443192..443200,443207..443209,443213..443215,
                     443345..443347,443354..443362,443369..443371,
                     443375..443377,443618..443620,443627..443635,
                     443642..443644,443648..443650,443774..443776,
                     443783..443791,443798..443800,443804..443806,
                     443927..443929,443936..443944,443951..443953,
                     443957..443959,444050..444052,444059..444067))
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199833"
     misc_feature    complement(order(442799..442801,443231..443233,
                     443501..443503,443684..443689,443732..443734,
                     443864..443866,443879..443881,444020..444022))
                     /gene="adh"
                     /locus_tag="CNE_BB1p04310"
                     /note="active site"
                     /db_xref="CDD:199833"
     gene            complement(444381..445154)
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /db_xref="GeneID:10915412"
     CDS             complement(444381..445154)
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_004687894.1"
                     /db_xref="GI:339328202"
                     /db_xref="GeneID:10915412"
                     /translation="MNKALNGKIALVTGAGSGIGHASALAFARAGATVVVSDMLLERC
                     EAVVSEITREGGSASARQCDVRDPRQIDALFQTVLESYGQLDCAFNNAGVGGPITPLA
                     EYPDDAWSEVIGTNLASVFHCMKHEIRQMVKQGAGSIVNCASVTGLNGMRGMPVYSAA
                     KHGILGLTKSAALDYAQQGVRINAVCPGVIHTPAVDQWIEKDPDGARQFMREMTAREP
                     IGRLGTPDEVASAVVWLCSPGASFMIGHGLAVDGGYTAQ"
     misc_feature    complement(444384..445154)
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06172"
                     /db_xref="CDD:180440"
     misc_feature    complement(444402..445127)
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(444576..444581,444585..444596,
                     444672..444674,444684..444686,444723..444731,
                     444810..444812,444876..444884,444960..444968,
                     445035..445043,445098..445109,445113..445115))
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(444672..444674,444684..444686,
                     444723..444725,444807..444809))
                     /gene="fabG9"
                     /locus_tag="CNE_BB1p04320"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            445517..446323
                     /locus_tag="CNE_BB1p04330"
                     /db_xref="GeneID:10915413"
     CDS             445517..446323
                     /locus_tag="CNE_BB1p04330"
                     /EC_number="4.2.1.116"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxypropionyl-coenzyme A dehydratase"
                     /protein_id="YP_004687895.1"
                     /db_xref="GI:339328203"
                     /db_xref="GeneID:10915413"
                     /translation="MEYQDITYEVVGAVARICHNRPAKANAESERLLAEMDDALQRAK
                     TDDRVGAVIIGGTGKHFSSGHDLTDPLSTRRGLNTERAWVWETERYLGNAMRIWDFPK
                     PTIAQVQGACVAGGFMVANMCDLVVAADDAFFSDPVNHSLGVAAVEVLVHPWVLGLRK
                     AKELLFTGQRISATEAREWGMVNHVVPRAELEAFTLELAQRIAAAPPMSTQMLKRSLN
                     RTADMMGFRTSVMAHFDTHHVTHSTDEHKAIMDAGRERTIQSAKKVQGDA"
     misc_feature    445517..446284
                     /locus_tag="CNE_BB1p04330"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    445532..446122
                     /locus_tag="CNE_BB1p04330"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(445589..445591,445595..445597,445691..445693,
                     445703..445717,445847..445849,445853..445861,
                     445925..445927,445934..445936)
                     /locus_tag="CNE_BB1p04330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(445709..445711,445859..445861)
                     /locus_tag="CNE_BB1p04330"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(445799..445801,445823..445825,445886..445897,
                     445928..445939,445955..445957,445961..445969,
                     445973..445978,445991..445996,446000..446005,
                     446009..446014,446021..446023,446054..446056,
                     446063..446065,446108..446110,446117..446122)
                     /locus_tag="CNE_BB1p04330"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            446464..447633
                     /locus_tag="CNE_BB1p04340"
                     /db_xref="GeneID:10915414"
     CDS             446464..447633
                     /locus_tag="CNE_BB1p04340"
                     /codon_start=1
                     /transl_table=11
                     /product="thiolase"
                     /protein_id="YP_004687896.1"
                     /db_xref="GI:339328204"
                     /db_xref="GeneID:10915414"
                     /translation="MDSAVTICAIHEMKPGRYPGLGPHDIFHAVLNGALSEWSIRPQD
                     IDGLLTCPGGQASGATDAYIHERLIAELGIQPGFAETISSGGATFALMVQRASMAIAA
                     GQANTVLCIGAGKFMKPGAGAAEMMARAISEEDFEFPYGTFVPALYALIAQQFMAERG
                     VTRADLARVAVSARKWALLNPDARMHDQGPITIGDVMQSRPIAEPFHYLDCSVPSDGG
                     GAILVTRADIGKRLSGRPAYVKGYGESHLSGSISSTRNLTQTGAVVSGEQAFRRAGLT
                     PADIDVVELYDAFTAAPLLLLENLGFCERGASGRFVQSGATDPGGSLPMNTNGGLLSF
                     GHTGDASGMSVLIEGARQVMGLAGANQVRQAENALIHCYGGMMYDHATLILGSEP"
     misc_feature    446503..447615
                     /locus_tag="CNE_BB1p04340"
                     /note="Thiolase domain associated with sterol carrier
                     protein (SCP)-x isoform and related proteins; SCP-2  has
                     multiple roles in intracellular lipid circulation and
                     metabolism. The N-terminal presequence in the SCP-x
                     isoform represents a peroxisomal...; Region:
                     SCP-x_thiolase; cd00829"
                     /db_xref="CDD:238425"
     misc_feature    446509..447627
                     /locus_tag="CNE_BB1p04340"
                     /note="thiolase; Provisional; Region: PRK06158"
                     /db_xref="CDD:180434"
     misc_feature    order(446719..446721,447319..447321,447469..447471)
                     /locus_tag="CNE_BB1p04340"
                     /note="active site"
                     /db_xref="CDD:238425"
     gene            447630..448034
                     /locus_tag="CNE_BB1p04350"
                     /db_xref="GeneID:10915415"
     CDS             447630..448034
                     /locus_tag="CNE_BB1p04350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687897.1"
                     /db_xref="GI:339328205"
                     /db_xref="GeneID:10915415"
                     /translation="MTAKPKPKVSSLNAPYWEGTAVGELRLRHCQKCEALFRFTHPRC
                     PCCWSDDLDWKRARGKGTVATFTVVHVAPFPAMESSVPYILALVDLEEGVRMMCNIVL
                     CDPLEARIGMAVSVAFEDRDGISLPQFKPSEM"
     misc_feature    447678..447788
                     /locus_tag="CNE_BB1p04350"
                     /note="Rubredoxin-like zinc ribbon domain (DUF35_N);
                     Region: DUF35_N; pfam12172"
                     /db_xref="CDD:256889"
     misc_feature    447789..447986
                     /locus_tag="CNE_BB1p04350"
                     /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
                     /db_xref="CDD:250873"
     gene            448371..449309
                     /gene="pqqB"
                     /locus_tag="CNE_BB1p04360"
                     /db_xref="GeneID:10915416"
     CDS             448371..449309
                     /gene="pqqB"
                     /locus_tag="CNE_BB1p04360"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein B"
                     /protein_id="YP_004687898.1"
                     /db_xref="GI:339328206"
                     /db_xref="GeneID:10915416"
                     /translation="MKIKVLGSAAGGGLPQWNCNCANCAAVRRGDPGITARTQSSLCI
                     SENDRDWVLLNASPDILQQIRATPELQPARALRDSGIVCALVTDAQIDHTAGLLLLRE
                     RQTPLPLHATPSVWAELREGFPLGPMLSHYCGLDYREIPMNGRGFRIPGLPHTRFTAV
                     PLSSAAPPYSPNRNRPAPDDNIGLLIENETSGAVVFYAPGLGQIDTPVREAMAGADLL
                     LIDGTFWQEDEMMRVGLSTKSASDMGHLPQSGPTGMIAALGGLPDISGRAAARQRKVL
                     IHINNTNPILRDDSPERRELDRHGIEVAVDGMTFCV"
     misc_feature    448371..449300
                     /gene="pqqB"
                     /locus_tag="CNE_BB1p04360"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqB;
                     Provisional; Region: PRK05184"
                     /db_xref="CDD:235361"
     gene            449319..450044
                     /gene="pqqC"
                     /locus_tag="CNE_BB1p04370"
                     /db_xref="GeneID:10915417"
     CDS             449319..450044
                     /gene="pqqC"
                     /locus_tag="CNE_BB1p04370"
                     /EC_number="1.3.3.11"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline-quinone synthase PqqC"
                     /protein_id="YP_004687899.1"
                     /db_xref="GI:339328207"
                     /db_xref="GeneID:10915417"
                     /translation="MHLTDPLSTSREEGDAWTRLEFEARLRDMGKRYHIHHPFNVRLN
                     SGECSPQQIRGWVANRFYYQINIPLKDAAILSNCGDRATRREWVVRLLDHDGWGEQEG
                     GIEAWTRLGKAVGLSREALWSLELVVPGVRFAVDAYVNFAQRAPWQEGVCASLTEMFA
                     PQIHRDRLAAWPLNYPWIAADGLEYFRSRIPLAQRDVDHGLRVTLDHFTTRSQQERAL
                     GILQFKLDILWQMLDAIEHAFPG"
     misc_feature    449364..450038
                     /gene="pqqC"
                     /locus_tag="CNE_BB1p04370"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqC;
                     Provisional; Region: PRK05157"
                     /db_xref="CDD:235353"
     gene            450079..450357
                     /gene="pqqD"
                     /locus_tag="CNE_BB1p04380"
                     /db_xref="GeneID:10915418"
     CDS             450079..450357
                     /gene="pqqD"
                     /locus_tag="CNE_BB1p04380"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis D"
                     /protein_id="YP_004687900.1"
                     /db_xref="GI:339328208"
                     /db_xref="GeneID:10915418"
                     /translation="MTEWDLSTPVLNVGFRLQWEAAQQAHVLLFPEGMIRLNVSAAEI
                     LKRCDGTRVTDELVTELETVFSVQGIRAEVQAFLAHATQRGWVGWVRE"
     misc_feature    450091..450339
                     /gene="pqqD"
                     /locus_tag="CNE_BB1p04380"
                     /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
                     PqqD; cl05126"
                     /db_xref="CDD:262441"
     gene            450368..451504
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /db_xref="GeneID:10915419"
     CDS             450368..451504
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein E"
                     /protein_id="YP_004687901.1"
                     /db_xref="GI:339328209"
                     /db_xref="GeneID:10915419"
                     /translation="MSGDRLLANPPLWLLAELTYRCPLHCAFCSNPTDYARNREELTT
                     SEWFEVLRQARALGAVQVGFSGGEPMMRDDLEVLVGEAHRLGYYTNLITSGVGATAER
                     LAALKAAGLDHIQLSFQDSTRELNDFLSNTRTFELKQRVARLIKANGYPMVLNVVLHR
                     HNLPHVDKIIEMAVALEADYLELANTQYYGWALVNRDQLLPDVEQVRTAEEAVRMWRS
                     RLGERCQILFVVPDYFERRPKACMNGWGSVFLAISPDGTALPCHAARVIPGLEFPNVR
                     DTTLAEVWRDSEAFNAFRSDGWMKEPCRSCDERHKDYGGCRCQAYLLTGSAANADPVC
                     ERSPSHGEVERVIAVVAQRPRAAAQAMIFRSDENSRRLHPGEQS"
     misc_feature    450395..451495
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqE;
                     Provisional; Region: PRK05301"
                     /db_xref="CDD:235397"
     misc_feature    450416..450913
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(450431..450433,450437..450439,450443..450445,
                     450449..450457,450560..450562,450566..450571,
                     450641..450649,450716..450718,450836..450838)
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    451088..451369
                     /gene="pqqE"
                     /locus_tag="CNE_BB1p04390"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            452607..453872
                     /locus_tag="CNE_BB1p04400"
                     /db_xref="GeneID:10915420"
     CDS             452607..453872
                     /locus_tag="CNE_BB1p04400"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004687902.1"
                     /db_xref="GI:339328210"
                     /db_xref="GeneID:10915420"
                     /translation="MHHGSRETQVSKERRLDDGARDGRKWSLVLLCLLAQNCVMGFAF
                     GSFGPLLASTEQDFGVSRALATAGMSLITLALGGLSPVLGGWMERVSVRTGMAGGALL
                     SAIGYVGLACAGSFAVALGMYGLIGIGVCLTAILGPLILISRWFDKNRGKVLSIVNLP
                     ILLFLTPYIVAKLLPHYGRAGLLSAMGAICALLALLLLRLVEPAPVAAHQAQPGVPAA
                     QCASGASLLKRPAFWLLSLGIGIMAGAGTGFVVHIVPFGMCRQMPLQAAAALLSVYAG
                     AGIGGTLLFGWICDRIGAPAALALSAFLQAALWWGLLLVDGTHLYALAGLLGICVVPL
                     VTLHGAAISQMFGIESVSRAMGYSYSIKLPFILGFAPALGLIFDRVGRYDLAFLATAS
                     LLTAAGVFLCCLLLILRRQRSLPAVPAIP"
     misc_feature    452694..453806
                     /locus_tag="CNE_BB1p04400"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    452703..453689
                     /locus_tag="CNE_BB1p04400"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(452736..452738,452745..452753,452757..452762,
                     452811..452813,452820..452825,452832..452834,
                     452844..452849,452853..452858,452994..452999,
                     453006..453011,453018..453023,453030..453032,
                     453066..453071,453078..453083,453333..453335,
                     453342..453347,453354..453359,453366..453368,
                     453405..453407,453417..453419,453429..453431,
                     453438..453440,453450..453452,453588..453590,
                     453597..453602,453609..453611,453621..453626,
                     453633..453635,453666..453671,453678..453683,
                     453690..453695,453702..453704)
                     /locus_tag="CNE_BB1p04400"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            454745..455050
                     /locus_tag="CNE_BB1p04410"
                     /db_xref="GeneID:10915421"
     CDS             454745..455050
                     /locus_tag="CNE_BB1p04410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687903.1"
                     /db_xref="GI:339328211"
                     /db_xref="GeneID:10915421"
                     /translation="MEEDLVQRIESNSNYRRLVSARSTYGWVLTAMMMVVYYGYILLV
                     AFGKTLLSTRIGDGVMTWGIPIGLFVIVFTVVVTGIYVRRANGEFDNLTAQIRKEVL"
     misc_feature    454769..455041
                     /locus_tag="CNE_BB1p04410"
                     /note="Protein of unknown function, DUF485; Region:
                     DUF485; pfam04341"
                     /db_xref="CDD:202977"
     gene            455050..456714
                     /gene="actP"
                     /locus_tag="CNE_BB1p04420"
                     /db_xref="GeneID:10915422"
     CDS             455050..456714
                     /gene="actP"
                     /locus_tag="CNE_BB1p04420"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="YP_004687904.1"
                     /db_xref="GI:339328212"
                     /db_xref="GeneID:10915422"
                     /translation="MSARNRILCALMLLAIGGAAWGAGGDLGQMQKQPTNWTAISMFA
                     VFVVFTLFITKWAAAKTKSAADFYTAGGGITGFQNGLAIAGDYMSAASFLGISAAVYL
                     NGYDGLIYSIGFLVGWPVITFLMAERLRNLGRFTFADVAAYRFAQTPIRVFAASGTLV
                     VVAFYLIAQMVGAGQLIKLLFGLEYWLAVVIVGTLMMVYVLFGGMTATTWVQIIKAGL
                     LLAGASFMAFMVLAQFHFNPEALFAKAVEIHAKKDAIMGPGTFIKDPISAISFGMALM
                     FGTAGLPHILMRFFTVPSAKEARKSVFWATTWIGYFYLLTFIIGFGAIVLVSTNPVYK
                     DALGGLLGGNNMAAIHLAKAVGGNVFLGFISAVAFATILAVVAGLTLSGASAVSHDLY
                     ATVFKKGKAASDKELRVSRVTTIALGVVAVILGIAFEKQNIAFMVSLAFAVAASATFP
                     VLFMAVLWKDCTTRGATIGGFLGLITAVGLTIVSKSVWVDVFGYTDAIFPYTSPALFS
                     MTVAFVGIWLFSTLDHSERARIDRAGYPAQKVRSETGIGASEASGH"
     misc_feature    455167..456609
                     /gene="actP"
                     /locus_tag="CNE_BB1p04420"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u4; cd11480"
                     /db_xref="CDD:212050"
     misc_feature    order(455302..455304,455311..455313,456160..456162,
                     456169..456174)
                     /gene="actP"
                     /locus_tag="CNE_BB1p04420"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212050"
     gene            456770..457018
                     /locus_tag="CNE_BB1p04430"
                     /db_xref="GeneID:10915423"
     CDS             456770..457018
                     /locus_tag="CNE_BB1p04430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687905.1"
                     /db_xref="GI:339328213"
                     /db_xref="GeneID:10915423"
                     /translation="MSRRSLLGHRLIALFALGWLLFNYPLLALFNDSRTWFGVPRLYC
                     YLFAAWALLITLLAFTAEQRAPRGRPSQSDPSAPVPED"
     gene            457020..459773
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /db_xref="GeneID:10915424"
     CDS             457020..459773
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase ResE"
                     /protein_id="YP_004687906.1"
                     /db_xref="GI:339328214"
                     /db_xref="GeneID:10915424"
                     /translation="MLDGWVIALASFAYLGMLFAIAFYGDRRADAGASMINNPYLYGL
                     SLAVYATSWTYYGSVGRAAVSGIGFLPIYLGPTLMAALWWTLLRKIIRISKNNRITSI
                     ADFLASRYGKSALLGGLVTLVSVIGIVPYIALQLKAVSASVAVLAHSPGLGMRGDEAG
                     PVWSDTTLYLALMLAVFTILFGTRHVDAAERHEGMVAAIAFESLVKLVAFLAVGVFVT
                     FGIYDGFGDLFGRAEGVPALKALLTLNGDAAGAGNVTFGAWAVLIVLSMFSMLLLPRQ
                     FQIAVVENIDENHLKTATWLLPLYLLAINVFVLPIAFAGILHFPGGEVDPDMYVLALP
                     IGEQSPALTLLVFIGGLSAATGMVIVETIALSTMVCNDLVMPLLLHLKPLRFSHRADI
                     NALLLTIRRAAIVLLMMLGYAYFRLAGEAYALVSIGLISFAAVAQFAPAMLGAIYWKN
                     GTRQGALVGLGAGFLLWAYTLLLPSFAQSGWVPASFVEYGPFGIGWLRPQQLFGLDGL
                     DPVSHALFWSLLANVGGYVGVSLTTTQSAVERVQAILFVDAYAHSGSAPGPHVWRGSA
                     SVDAVLALLRRFLGAARADEAYARFREQGRADGRSTDADLVHFAEIQLAGAIGAASAR
                     AVIASAVNEAPLGLDEAMAILDETAQAVAYSRQLEQKSRELETVSAGLKAANVRLTEL
                     DHMKDDFISTVTHELRTPLTSIRAFSEILRDHPDLAADKRSEYLDLVIKESERLTRLI
                     NNVLDLAKIESGSTEWHTVPLDLKQVIQDAVDATRHLFLEQRIQLALQLPPQVPLLLA
                     DPDRLMQVMLNLLSNAVKFCDRAHGRVAVSLEVVGNDLRVAVRDNGGGVRPQDRELIF
                     DKFRQGGDRLAGKPQGTGLGLPISREIIRHFGGSLWLEATPENGAVFVFTLPLQKGPE
                     TTS"
     misc_feature    457020..458477
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Na+/proline symporter [Amino acid transport and
                     metabolism / General function prediction only]; Region:
                     PutP; COG0591"
                     /db_xref="CDD:223664"
     misc_feature    order(457158..457160,457167..457169,458076..458078)
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212031"
     misc_feature    458736..459761
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    459066..459263
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(459084..459086,459096..459098,459108..459110,
                     459117..459119,459129..459131,459138..459140,
                     459192..459194,459204..459206,459213..459215,
                     459225..459227,459234..459236,459246..459248)
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    459102..459104
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    459426..459740
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(459444..459446,459456..459458,459465..459467,
                     459537..459539,459543..459545,459549..459551,
                     459555..459560,459639..459650,459696..459698,
                     459702..459704,459717..459722,459726..459728)
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    459456..459458
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(459549..459551,459555..459557,459639..459641,
                     459645..459647)
                     /gene="resE"
                     /locus_tag="CNE_BB1p04440"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            459770..460156
                     /locus_tag="CNE_BB1p04450"
                     /db_xref="GeneID:10915425"
     CDS             459770..460156
                     /locus_tag="CNE_BB1p04450"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_004687907.1"
                     /db_xref="GI:339328215"
                     /db_xref="GeneID:10915425"
                     /translation="MTHKVLIVDDEPNIVIPLEFLMQQSGYEVGIARDGQAALEQMTA
                     FQPDLVLLDIMLPLLSGFEVCQKIRENKAWDRVKVVMLSAKGRDLEVAKGLALGADAY
                     ITKPFSTRALVEQVSALLASGQRARE"
     misc_feature    459776..>460129
                     /locus_tag="CNE_BB1p04450"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    459785..460129
                     /locus_tag="CNE_BB1p04450"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(459794..459799,459926..459928,459950..459952,
                     460016..460018,460073..460075,460082..460087)
                     /locus_tag="CNE_BB1p04450"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    459926..459928
                     /locus_tag="CNE_BB1p04450"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(459935..459940,459944..459952)
                     /locus_tag="CNE_BB1p04450"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    460082..460090
                     /locus_tag="CNE_BB1p04450"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            460153..462315
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /db_xref="GeneID:10915426"
     CDS             460153..462315
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="YP_004687908.1"
                     /db_xref="GI:339328216"
                     /db_xref="GeneID:10915426"
                     /translation="MIQKWIAQHRFGVTLALLFLVQLLVVGAMLLPLAIDLPAAQRAW
                     LTALVLQRGALWIALAALLLLALGVGLKALFNAYPTPVTRLAEDAALLAANPGHRIEP
                     QGARGVRSLGEALNLLAASHQTLHDGVQQKIELANRALAEEKNRLAALMAELSLSVLV
                     CNIEGQILLYNDSARQLLEAGRGGAPAAGTAAIGLGRSVFGAIERGLILHALEQIQQQ
                     LRENEDGAARPVSGFVATLAQGQIVRAQMAPVFDSAHTLNGFVLTLEDITRNVEADSR
                     RDALLQSLTQDARATLASIRTAVEAIQAYPEMSAEKRTQLTSIIDDESQRLVYQIDRA
                     VDQRGAGMDSRQELEEMRGADLLALLVRRIGSPSLSVTASDTVDATLWLKVDSYALTQ
                     ALAYLAQRLATEASVTELRFGLHRAGRLAYLDLTWRGTPLTADTLRVWENAPLPITAA
                     GAALSLSALIARQGGEAVCSAGASPDVARYRLMLPLSEPGPALDIPPAQEGRPEFYDF
                     DLFHRPGQSAEADQCLLSQLNFTVFDTETTGLDPAAGDEIISIGALRIVNGRLLQRES
                     FDQLIQPRGALSAGSIAIHGITQAMLNGQPPIETVLPQFHRFAADTVLVAHNAAFDMK
                     FLQMLEARTGTAFTQPVLDTLLLSQVIHPHQAEHTLEAIAGRFGVAIIGRHTALGDAI
                     VTGEVFLKMTPLLAEKGIFTLKEARDAAQQTHYARIRY"
     misc_feature    460615..460956
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    461746..462219
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    order(461752..461763,461767..461769,462001..462006,
                     462010..462018,462175..462177,462190..462192)
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    order(461752..461763,461767..461769,462001..462006,
                     462010..462015,462175..462177,462190..462192)
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    order(461752..461754,461758..461760,462016..462018,
                     462175..462177,462190..462192)
                     /gene="dnaQ"
                     /locus_tag="CNE_BB1p04460"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            462326..463444
                     /locus_tag="CNE_BB1p04470"
                     /db_xref="GeneID:10915427"
     CDS             462326..463444
                     /locus_tag="CNE_BB1p04470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687909.1"
                     /db_xref="GI:339328217"
                     /db_xref="GeneID:10915427"
                     /translation="MSDPPTIHPDAAFDPTAVGGGAFSRDIAGARLRIASAQDERGLQ
                     RAAAEIRSLWQRVAGQAASEPTTRLISTLNDALTQRVIDLACAGEEMAGMRWCWIALG
                     SEGRQEQTLSSDQDNGMILAGSGGAEAMRDRMLPLALRINETLDACGFPLCTGQIMAS
                     NPQWCLDLHEWRERFASWIIEGDPPGLLNATIFFDLRPLYGAGELAQALMGWLGKMAP
                     DNPRFLFQMTANALRRKAPLGLLRDFVVAKRGEFAGTIDLKLDAATLFVDAARIYGLA
                     CGARASNTAHRLRRAGEMGRLAPKDVQAWILAFDCIQRLRLKTQQRCFERGMPMHNHV
                     DPDELETGERRALLDALRQARVLQKHLALDYLDARQGI"
     misc_feature    462455..462952
                     /locus_tag="CNE_BB1p04470"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(462665..462667,462671..462673,462791..462793)
                     /locus_tag="CNE_BB1p04470"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    462986..463420
                     /locus_tag="CNE_BB1p04470"
                     /note="Putative nucleotidyltransferase substrate binding
                     domain; Region: DUF294_C; pfam10335"
                     /db_xref="CDD:150931"
     gene            463603..465504
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /db_xref="GeneID:10915428"
     CDS             463603..465504
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A synthetase AcsA"
                     /protein_id="YP_004687910.1"
                     /db_xref="GI:339328218"
                     /db_xref="GeneID:10915428"
                     /translation="MKSIESVLHEHRLFPPPAELAADAAISGMDAYKTLVAEAEADYN
                     GFWGRLARETLTWKAPFSKVLDESNAPFYTWFEDGELNASYNCLDRHVEAGNGDRVAI
                     LFEADDGTVATVTYQDLLQRVCRFANAFRRRGVKKGDRVVIYLPMSVEGVVAMQACAR
                     IGATHSIVFGGFSAKSLHERLVGVGAVALVTADEQMRGGKALPLKSIADEALALGGCE
                     AVKSVIVYQRTGGKIQWNADRDLWMHELAQAEASTCEPEWVGAEHPLFILYTSGSTGK
                     PKGVQHSTGGFLLWAAQTMKWTFDWKPTDVFWCTADIGWITGHSYITYGPLAVGGTQV
                     LFEGVPTYPHAGRFWDMIAKHQVTVFYTAPTAIRSLIKAAAVDEKVSPSNYDLSSLRI
                     LGSVGEPINPEGWMWYYTNIGGARCPILDTWWQTETGGHMISPLPGATPLVPGSCTLP
                     LPGIMAAVVDETGQDVPAGQGGILVIKRPWPAMLRTIWGDPERYQSSYFPEELGGKLY
                     LAGDGAVRDPVTGYFTIMGRIDDVLNVSGHRLGTMEIESALAANALVAEAAVVGRPDE
                     ITGETVIAFVVLKGARPEGEEAVKIANALRAWVSKEIGPIAKPRTFDLATTCLRRVRA
                     RSCAGCCVR"
     misc_feature    463639..465432
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    463714..465432
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(464401..464403,464410..464427,464431..464436)
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(464410..464412,464533..464538,464689..464691,
                     464695..464700,464707..464709,464788..464793,
                     464863..464880,465136..465138,465175..465177,
                     465184..465186,465208..465219,465418..465420)
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(464410..464412,464788..464793,464863..464880,
                     465136..465138,465175..465177,465184..465186,
                     465217..465219)
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(464533..464535,464695..464700,464707..464709,
                     464788..464790,465208..465216,465400..465402,
                     465418..465420)
                     /gene="acsA2"
                     /locus_tag="CNE_BB1p04480"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            465818..465985
                     /locus_tag="CNE_BB1p04490"
                     /db_xref="GeneID:10915429"
     CDS             465818..465985
                     /locus_tag="CNE_BB1p04490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687911.1"
                     /db_xref="GI:339328219"
                     /db_xref="GeneID:10915429"
                     /translation="MDIVLFAAVSGDNNAVHIDEEFSQDLLPPPRRDGVGDYRRCLPA
                     NPQRFLSTGDN"
     misc_feature    465821..>465886
                     /locus_tag="CNE_BB1p04490"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     gene            465985..466401
                     /locus_tag="CNE_BB1p04500"
                     /db_xref="GeneID:10915430"
     CDS             465985..466401
                     /locus_tag="CNE_BB1p04500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687912.1"
                     /db_xref="GI:339328220"
                     /db_xref="GeneID:10915430"
                     /translation="MTTQTNPFANVTKMMLDFKVTGLDMSSIIESQRKDMEALAESNK
                     VTYEAMQAMAQKQSEILTRTMQGIQDFAQAQAGGAGLIDPGKQAEMIRVAYQTALTDM
                     KDLAEMARKSQVDALATITQRATEHMEEIKKLLHPK"
     misc_feature    466057..466359
                     /locus_tag="CNE_BB1p04500"
                     /note="Phasin protein; Region: Phasin_2; pfam09361"
                     /db_xref="CDD:204210"
     gene            466457..466834
                     /locus_tag="CNE_BB1p04510"
                     /db_xref="GeneID:10915431"
     CDS             466457..466834
                     /locus_tag="CNE_BB1p04510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687913.1"
                     /db_xref="GI:339328221"
                     /db_xref="GeneID:10915431"
                     /translation="MASPYNVPDEYLQGFIQSGQSLWPAMMLNPAAQVPGSSDAPSVQ
                     PGAGPFADLQWHYFQQQFALWTRMLASMADRPPEAEVAPERGDRPFSAVDRCDNPFYS
                     LLKQSYLLNARLAEDMVEAAAFD"
     misc_feature    466709..>466822
                     /locus_tag="CNE_BB1p04510"
                     /note="Poly-beta-hydroxybutyrate polymerase (PhaC)
                     N-terminus; Region: PhaC_N; pfam07167"
                     /db_xref="CDD:254087"
     gene            466930..468036
                     /locus_tag="CNE_BB1p04520"
                     /db_xref="GeneID:10915432"
     CDS             466930..468036
                     /locus_tag="CNE_BB1p04520"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004687914.1"
                     /db_xref="GI:339328222"
                     /db_xref="GeneID:10915432"
                     /translation="MDKFSKYVGLDVHQETIAVAVADTAGDVRYVGEIGNTPEVIRKL
                     VTQLKRDGARLSFCYEAGPGGYVLYRQLRDLKQDCQVVAPSLIPRKPGERVKTDRRDS
                     LSLARLHRAGELTAVWVPGEAQEALRDLTRAREDMKHLQRQAKQRLLSFLSRHGHRYS
                     GKSRWTQAHWRWLEGIKFAYPVQQIVLQEYIDTVKACSQRVARLEQEIARAVQDSPVW
                     PVIEALMALRGVSLITAVTVVAELGDLRRFTDAPQLMAYLGLVPSEHSSGKRERRGSI
                     TKAGNSHVRRVLVEAAWTYRHPARKTATLQRRAERTTTEIQGIAWEAQKRLCHRYRHL
                     SARGKLPVQVCTAIARELTGFIWAVGQQAEVRRP"
     misc_feature    466945..467946
                     /locus_tag="CNE_BB1p04520"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    466948..467370
                     /locus_tag="CNE_BB1p04520"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    467593..467811
                     /locus_tag="CNE_BB1p04520"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            468381..469466
                     /locus_tag="CNE_BB1p04530"
                     /db_xref="GeneID:10915433"
     CDS             468381..469466
                     /locus_tag="CNE_BB1p04530"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687915.1"
                     /db_xref="GI:339328223"
                     /db_xref="GeneID:10915433"
                     /translation="MRGRPKAELILSEAEREQLKALTMRRKTAQALALRARIVLASAE
                     GLDNKTVAAKQRVDVHTVSKWRSRFVADRLDGLLDAPRPGAPRTIADAQVDAIIAKTL
                     ESVPAGATHWSTRSMARAADLSQSTVTRIWRAFGLQPHRQETFKLSSDPLFVEKVRDI
                     VGLYLDPPLKAMVLCVDEKSQIQALDRTQPILPMAPGIPERRTHDYMRHGTTTLFAAL
                     DIATGKVIGELHRRHRSSEFLQFLRTIEANVPPKLDVHLVMDNYGTHKTASIKAWFAR
                     HPRFHVHFTPTSASWINQVERWFATITEQYIRRGTHRSTRQLEQAIRQYLDLNNANPT
                     PFVWTKSADDILASIKRFCLRISDSGH"
     misc_feature    468474..468614
                     /locus_tag="CNE_BB1p04530"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     misc_feature    468483..468788
                     /locus_tag="CNE_BB1p04530"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    468561..468776
                     /locus_tag="CNE_BB1p04530"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    468897..469337
                     /locus_tag="CNE_BB1p04530"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            469804..470139
                     /locus_tag="CNE_BB1p04540"
                     /db_xref="GeneID:10915434"
     CDS             469804..470139
                     /locus_tag="CNE_BB1p04540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687916.1"
                     /db_xref="GI:339328224"
                     /db_xref="GeneID:10915434"
                     /translation="MQPENSFVRFAVEQGHTLFLMSWRNPDATCGHVTWGDYLSQGVM
                     KAIEVALVISGADKETVQVLVFRSADPDFFISHVDVTRVEEYRQEAAKLTGEASIALL
                     FRISLAILR"
     misc_feature    <469804..>469977
                     /locus_tag="CNE_BB1p04540"
                     /note="poly(R)-hydroxyalkanoic acid synthase, class I;
                     Region: PHA_synth_I; TIGR01838"
                     /db_xref="CDD:213656"
     gene            complement(470117..471472)
                     /locus_tag="CNE_BB1p04550"
                     /db_xref="GeneID:10915435"
     CDS             complement(470117..471472)
                     /locus_tag="CNE_BB1p04550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687917.1"
                     /db_xref="GI:339328225"
                     /db_xref="GeneID:10915435"
                     /translation="MPPRSPKARIGVVLAVTNARVARSIAQVEMLQGLQRDSFAYFVN
                     EANPANGLVFDKTRLEWPASIAAIGMALTVYPVGVDHHFMSRNHAAQRTLATLRFLAC
                     CEQSTAPDASGYKGFYYHFLSMTSGRRAWLCELSSVDTAILMAGILTAAAFFQEETAS
                     EAEIRRLADMLYRRVDWHWMLGANPLLCHGWTPEHGFLKWHWEGYDEALILYILALGS
                     PTFPIPAHSYPAWVASYCWKTVYGIEYLYAGPLFTHQLSHARVDFRGIRDPFMQQHQC
                     DYFENSRRATLVQQQYAIRNPMDFEQYGEFCWGTTASDGPGTVTRTVNGVQRTFFDYI
                     ARGVPYGPDDGTLAPWAVVASLPFAPDIVLPTIAHFNRLRLCEANPYGFKASFNPTFP
                     CEPARAAGWVSEYHFGINEGPTIIMIENYQSGRIWALMRQCPYIKAGLRRAAFSGGWL
                     D"
     misc_feature    complement(470123..471409)
                     /locus_tag="CNE_BB1p04550"
                     /note="Putative glucoamylase; Region: Glycoamylase;
                     cl19893"
                     /db_xref="CDD:268246"
     gene            471806..471955
                     /locus_tag="CNE_BB1p04560"
                     /db_xref="GeneID:10915436"
     CDS             471806..471955
                     /locus_tag="CNE_BB1p04560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687918.1"
                     /db_xref="GI:339328226"
                     /db_xref="GeneID:10915436"
                     /translation="MREIIAADLLGATVDANGKPKQAIVSMLVARDDAKEKAAALPYH
                     ISAGL"
     gene            complement(472587..473129)
                     /locus_tag="CNE_BB1p04570"
                     /db_xref="GeneID:10915437"
     CDS             complement(472587..473129)
                     /locus_tag="CNE_BB1p04570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687919.1"
                     /db_xref="GI:339328227"
                     /db_xref="GeneID:10915437"
                     /translation="MAKVSPAGAIRRWIAVVVYALALPIFAPAMSHAQSPENVKQAME
                     SLKAKTVKLGVPGIKGEDAVAGKPAPALYFGATKMNNNFAVVDEVKKEHSGTATLFVK
                     NGDDFVRVATNVQKDDGSRAIGTVLDPKGKAIAAIRSGGAYYGDADILGKPYITGYEP
                     IRDASGNVIGIYYVGYPKTK"
     gene            474003..475157
                     /locus_tag="CNE_BB1p04580"
                     /db_xref="GeneID:10915438"
     CDS             474003..475157
                     /locus_tag="CNE_BB1p04580"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687920.1"
                     /db_xref="GI:339328228"
                     /db_xref="GeneID:10915438"
                     /translation="MNADHATELHAEDAILAVSLELSAAQWKVALHDGFREQPAVHSV
                     GALQAASRLQAVLDLIEQQKRKWSLPSHVRVVVSYEAGQDGFWILRSLRSRGIDCYMV
                     DAASIPVERHKRRAKTDRLDAIKLVTNLRAWLHGERDRMRVVRAPSLQDEASRHLIRD
                     RGQLQKEVMQHRDRMRKLLVTVGCWDEVDHRAFAKRLARGELTCHDGSPLPDELRERL
                     LRESHRLELAEQQLKDLQRTLHDRLPEPVRERITWLKRLRGVGDIGASRLMLELFWRQ
                     FRNRRQLGACVGLVPQPYDSGQSRVDQGISKQGNRRVRVQLIEMAWGWLRYQPGSALT
                     RWFNERTQGTGPNRRARRIAIVALARRLVIALWRYLTEGIIPDGAQFKLA"
     misc_feature    474054..474524
                     /locus_tag="CNE_BB1p04580"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    474219..475112
                     /locus_tag="CNE_BB1p04580"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    474762..474998
                     /locus_tag="CNE_BB1p04580"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(475454..475576)
                     /locus_tag="CNE_BB1p04590"
                     /db_xref="GeneID:10915439"
     CDS             complement(475454..475576)
                     /locus_tag="CNE_BB1p04590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687921.1"
                     /db_xref="GI:339328229"
                     /db_xref="GeneID:10915439"
                     /translation="MSGLAINCAFFDALAGQAIFLFAGADSGGERAVADRFYGE"
     gene            complement(475942..476274)
                     /locus_tag="CNE_BB1p04600"
                     /db_xref="GeneID:10915440"
     CDS             complement(475942..476274)
                     /locus_tag="CNE_BB1p04600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687922.1"
                     /db_xref="GI:339328230"
                     /db_xref="GeneID:10915440"
                     /translation="MLECGRPVGAWCEWSREKVALDQVAIVPDFQQWVYDRLQDGKTA
                     ELLDYRRLAASGVRAHPTEEHLMPLFVALGAAAGNGAAPAMQREFAEVDHGILAMDVY
                     RFARQGSD"
     misc_feature    complement(475963..>476190)
                     /locus_tag="CNE_BB1p04600"
                     /note="Subunit B of Class III Extradiol ring-cleavage
                     dioxygenases; Region: Extradiol_Dioxygenase_3B_like;
                     cl00599"
                     /db_xref="CDD:260521"
     misc_feature    complement(476080..476082)
                     /locus_tag="CNE_BB1p04600"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153371"
     gene            476112..476741
                     /locus_tag="CNE_BB1p04610"
                     /db_xref="GeneID:10915441"
     CDS             476112..476741
                     /locus_tag="CNE_BB1p04610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687923.1"
                     /db_xref="GI:339328231"
                     /db_xref="GeneID:10915441"
                     /translation="MPRGVCSPAVRPSCHPGGGRTPIAGSPVRSLPDPTPPSRATIRT
                     MHQLGDRIRATRAGDGMLIDQAAGHCGVAIGMLSKLENGKGVNLEHALHAMDGLGLTM
                     LVVPKAHAPWLEQAAAHAAKIGEDAVWLEESRGAMISAGVMLGCGLRAMYSWICPVGQ
                     RIASRNSAGSFTTCMPRPTCYSGPLCAPELSQLFPLECRGIATFDVALR"
     misc_feature    476250..>476387
                     /locus_tag="CNE_BB1p04610"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    476256..476417
                     /locus_tag="CNE_BB1p04610"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(476268..476270,476280..476282,476355..476357)
                     /locus_tag="CNE_BB1p04610"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(476277..476279,476352..476354)
                     /locus_tag="CNE_BB1p04610"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(476298..476303,476334..476336,476343..476345,
                     476355..476360)
                     /locus_tag="CNE_BB1p04610"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(476757..477248)
                     /locus_tag="CNE_BB1p04620"
                     /db_xref="GeneID:10915442"
     CDS             complement(476757..477248)
                     /locus_tag="CNE_BB1p04620"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase MaoC-like domain-containing protein"
                     /protein_id="YP_004687924.1"
                     /db_xref="GI:339328232"
                     /db_xref="GeneID:10915442"
                     /translation="MTDDAARYQPRGLYFEDFEIGKTIVTSRRTVTLTDIVNFACLSG
                     DHNAPHIDHEFCKTQPYGEPIAHGPLVLAIAGGLQCLSGINDGTIVAMLGLDKWRMHL
                     PVKAGDTVQVFITPTEKKLTSSGKQGIVICDRIVKNQRGETVHSMVISLMYKCRSTEE
                     PPQ"
     misc_feature    complement(476793..477209)
                     /locus_tag="CNE_BB1p04620"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    complement(order(476940..476951,477045..477050))
                     /locus_tag="CNE_BB1p04620"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    complement(order(476967..476975,477009..477011,
                     477018..477023,477030..477032))
                     /locus_tag="CNE_BB1p04620"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            complement(477339..478268)
                     /locus_tag="CNE_BB1p04630"
                     /db_xref="GeneID:10915443"
     CDS             complement(477339..478268)
                     /locus_tag="CNE_BB1p04630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687925.1"
                     /db_xref="GI:339328233"
                     /db_xref="GeneID:10915443"
                     /translation="MSMACAGASAEPGYPTRPIRIIVPFTAGSTSDITARAVATRIAA
                     PLGQPVIVENRPGANGVLGMQAAMRTNPDGYTLVLSSASSTMVPPALLRSPPFDPRKH
                     FTPISLVAATPLLLVTRKDASINSVSDLIAQAKRAPGTVTYGSSAGLYQLAMESLNQR
                     VGTDITPIPYKGPAEAQSDLIGGRLTVISDSLGPIMPHIRSGRVKPLAMLSAKRSDLL
                     PDTPTMQELGYKDFEFTGWLGLLAPAGTPREIVSRLNAEIVKAVESGEVRRQFALLGI
                     EAKSSTPEAYASLIGRDTARYVRIAELAGIEKQ"
     misc_feature    complement(477351..478166)
                     /locus_tag="CNE_BB1p04630"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            complement(478362..479765)
                     /locus_tag="CNE_BB1p04640"
                     /db_xref="GeneID:10915444"
     CDS             complement(478362..479765)
                     /locus_tag="CNE_BB1p04640"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="YP_004687926.1"
                     /db_xref="GI:339328234"
                     /db_xref="GeneID:10915444"
                     /translation="MTSPPTAATFLDHLHTRAAHCRFDRLPDAVVTQAKLCILDTIGC
                     IVAGMQAEESRLVAGPSATSTQAGDQASVFVHGSKMPIAAAVIANGYAGDILELNDLI
                     GGHASIGCVTAAVATAEAVGASGRQLIEAVVRAIELTSAVYTAVYPSLKPYGEVGLTP
                     VGLPSSVGAASGVAHLRGLDDKQTRHALAISGALAGWCPAEVIFRQGGTVKPMLFGAQ
                     PAATAVTAVQYASHGMTGPLQLLDGDLGYFSTVSKSGRQNTGVSLENWALLAPRRKLH
                     ACCGYIHSAVDALAALRRGWQGDLAECDIEVRLPAYVHEAVAKTEPPRTANEARFDIR
                     YCLALAACGFDVILPGHGLELHQYLDRPDVRAVISNIVAVSDPSLNHYERSQVSIRHR
                     HSDRSQSLYQDAPRGAPSNPLSASDIVEKFVALVSWHISPDKAHAYAKRVLALEEYTD
                     CEWLVDSLQTDPRVACA"
     misc_feature    complement(478425..479714)
                     /locus_tag="CNE_BB1p04640"
                     /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
                     /db_xref="CDD:260693"
     gene            complement(479849..480802)
                     /locus_tag="CNE_BB1p04650"
                     /db_xref="GeneID:10915445"
     CDS             complement(479849..480802)
                     /locus_tag="CNE_BB1p04650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687927.1"
                     /db_xref="GI:339328235"
                     /db_xref="GeneID:10915445"
                     /translation="MTALVIAEHDNQSIKAATLNTVTAAAQCGGHVHVLVAGSNAKAA
                     ADAAAKIAGVTKVLLADAPYFGDGLAENVAEQALTIANDYSHILAPATPYGKNILPRV
                     AAKLDVAQISEISKVDAPDTFERPIYAGNAIATVKSEDKIKVITVRGTAFDAAAAEGG
                     SAAEGGSAAVETLPAMADAGVSQFVSREVAKSDRPELTAAKIIVSGGRGVGSGENYTK
                     VLTPLADKLGAALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYIAAGISGAIQHLAGM
                     KDSKVIVAINRDAEAPIFSVADYGLVGDLNTVVPELVAALG"
     misc_feature    complement(479855..480799)
                     /locus_tag="CNE_BB1p04650"
                     /note="electron transfer flavoprotein subunit alpha;
                     Provisional; Region: PLN00022"
                     /db_xref="CDD:215032"
     misc_feature    complement(480344..480793)
                     /locus_tag="CNE_BB1p04650"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_alpha; cd01715"
                     /db_xref="CDD:238848"
     misc_feature    complement(479963..480223)
                     /locus_tag="CNE_BB1p04650"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            complement(480821..481582)
                     /locus_tag="CNE_BB1p04660"
                     /db_xref="GeneID:10915446"
     CDS             complement(480821..481582)
                     /locus_tag="CNE_BB1p04660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687928.1"
                     /db_xref="GI:339328236"
                     /db_xref="GeneID:10915446"
                     /translation="MKVLVAVKRVVDYNVKVRVKADDSGVDLANVKMSMNPFDEIAVE
                     EAVRLKEVGAATEVIAVSCGVTQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLK
                     ALIDKEQPQLVILGKQAIDDDSNQTGQMVAALAGLPQATFASKVVVADEGGQKRASVT
                     REVDGGLETLSLKLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVKPR
                     LATLKVVEPAKRSAGVMVPDVATLVQKLKNEAKVI"
     misc_feature    complement(480962..481579)
                     /locus_tag="CNE_BB1p04660"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_beta; cd01714"
                     /db_xref="CDD:238847"
     misc_feature    complement(order(481202..481213,481226..481231,
                     481235..481240,481394..481396,481466..481468,
                     481475..481477,481562..481567))
                     /locus_tag="CNE_BB1p04660"
                     /note="Ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:238847"
     gene            481911..482663
                     /locus_tag="CNE_BB1p04670"
                     /db_xref="GeneID:10915447"
     CDS             481911..482663
                     /locus_tag="CNE_BB1p04670"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004687929.1"
                     /db_xref="GI:339328237"
                     /db_xref="GeneID:10915447"
                     /translation="MHMDQTGQAAVSEEAAFEPISVSRAVDEIARQIRQEVMAGRLKP
                     GQKLPPERDLCVRFGVSRNTLREALRALEISGLVELKKGATGGAFIKKGDKDVVITGL
                     TDLYYLGSITPEQLTEARVMLADLVVRDVCLKATEADLEALQANVAAAEAAQKTGNIE
                     ERARINLEFHRLLVRISGNPILILTMEAILKVMVDYIAEIGYNENRFVLPSRRRLVKF
                     LVERNADEAASEMTAHLRRVHRYYLSQVGNNG"
     misc_feature    481956..482639
                     /locus_tag="CNE_BB1p04670"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    481989..482183
                     /locus_tag="CNE_BB1p04670"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(482055..482057,482061..482066,482088..482102,
                     482106..482111,482118..482120,482148..482153,
                     482157..482162,482169..482174)
                     /locus_tag="CNE_BB1p04670"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    482253..482621
                     /locus_tag="CNE_BB1p04670"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(482557..483594)
                     /locus_tag="CNE_BB1p04680"
                     /db_xref="GeneID:10915448"
     CDS             complement(482557..483594)
                     /locus_tag="CNE_BB1p04680"
                     /EC_number="5.1.99.4"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-methylacyl-CoA racemase"
                     /protein_id="YP_004687930.1"
                     /db_xref="GI:339328238"
                     /db_xref="GeneID:10915448"
                     /translation="MAGNGNMILRESNAVVQKKGPLAGVRIAEFAGLGPGPFACMLLA
                     DMGADIVRIDRPGARQVHPHDLIGRGRRTVLLDLKHPGDRDQALALLAHTDALVEGFR
                     PGVMERLGLGPEAVAAVNPRLVYGRMTGWGQEGPLSQTAGHDINYIALSGALAAIGER
                     DGAPVPPLNLLGDYGGGSLYLVTGILAALIEARTSGRGQVVDAAICDGALSLMSLSQS
                     QSLRGLYTEHRGDNMLDGGAPYYAVYRAADGEYICIGAIEPQFFALLCERIGLNPALR
                     DAQHDRSRWPALRAELTRIFAADPVCLDCNEDRPLSHYSRPATDSSDARAEDARSSRW
                     QPRPHFVRQGT"
     misc_feature    complement(<482701..483546)
                     /locus_tag="CNE_BB1p04680"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(483603..484883)
                     /gene="caiB2"
                     /locus_tag="CNE_BB1p04690"
                     /db_xref="GeneID:10915449"
     CDS             complement(483603..484883)
                     /gene="caiB2"
                     /locus_tag="CNE_BB1p04690"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_004687931.1"
                     /db_xref="GI:339328239"
                     /db_xref="GeneID:10915449"
                     /translation="MFNQGYIEELPVRETPSQPRESAVSGLKVVDFSHFIAGPFATMI
                     LGDFGADVIKIERPGRGEDFRYYPPLDPELPAQGGPYLWSNRNKRSLALDIKTEEGAK
                     VALDLIATADVVFENFSSGVMERLGLGYERCAQLNPRLIYCSVSAYGRTGPYADRLGF
                     DPVVQAESGYMSMNGYPDRPGVRSGPVVMDMGTALMASNALLLALLARERTGKGQFVE
                     VSLFDTAVMMTGFAGMQNLLTGKDPQRHGNSTPDTCPSGVFRAADRPFYLHCGNDKIF
                     ARLFGDVLGRPDIAARPDLVRSFDRLNHRDELFGILNEAFSAQPWSHWQAKLRAASIP
                     HGEVRTLGEALRSGEAQSRGLTNRIPHPVKGWIPHIESPMRLSETPAVAPRPAPAVGQ
                     HTLEVLREVLHYDDARIAALERAGALGAAPVPQA"
     misc_feature    complement(483630..484829)
                     /gene="caiB2"
                     /locus_tag="CNE_BB1p04690"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            485098..486297
                     /locus_tag="CNE_BB1p04700"
                     /db_xref="GeneID:10915450"
     CDS             485098..486297
                     /locus_tag="CNE_BB1p04700"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acyltransferase"
                     /protein_id="YP_004687932.1"
                     /db_xref="GI:339328240"
                     /db_xref="GeneID:10915450"
                     /translation="MSKKKRIAIIGASAIPVGRHQTADTEDIHTLEHEILLRLVLEAT
                     RDAGVEKRDIESLVFTLPRPYTRQKYLHTFMVGKLKLPCRGTVLEVMGNGMTAALALD
                     QACNEILLGRAKVALALGVNMETAVSSAEHAMSSMRATGDVDFHVPAGFTPISWYAMD
                     ATRYMHEYGATREQLAAVAVKNRFHASMNPLAQYRKPVTMQDVLEQRPIVEPLGLYDV
                     PPRGDGAACLVLASEDVALATGRPYVLIQGRGFHHDGSHQISDVPNDMIGFEAARVAS
                     AYAYAEAGITPADLDMAEPYAPCTIVEILVSEALGLVPRGRGSIAALEGETTLGGRIP
                     ISTSGGLISRGHPSYVTSLYNYVEIAEQLRGRAGDRQVKDARWGVATGELGNYNAALV
                     HVFEGVQ"
     misc_feature    485110..486282
                     /locus_tag="CNE_BB1p04700"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06064"
                     /db_xref="CDD:235688"
     misc_feature    485125..486279
                     /locus_tag="CNE_BB1p04700"
                     /note="Thiolase domain associated with sterol carrier
                     protein (SCP)-x isoform and related proteins; SCP-2  has
                     multiple roles in intracellular lipid circulation and
                     metabolism. The N-terminal presequence in the SCP-x
                     isoform represents a peroxisomal...; Region:
                     SCP-x_thiolase; cd00829"
                     /db_xref="CDD:238425"
     misc_feature    order(485377..485379,485983..485985,486133..486135)
                     /locus_tag="CNE_BB1p04700"
                     /note="active site"
                     /db_xref="CDD:238425"
     gene            486294..486722
                     /locus_tag="CNE_BB1p04710"
                     /db_xref="GeneID:10915451"
     CDS             486294..486722
                     /locus_tag="CNE_BB1p04710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687933.1"
                     /db_xref="GI:339328241"
                     /db_xref="GeneID:10915451"
                     /translation="MMLKTVDMAAARAYPPRVSKATEPFWSALAQGRWITTGCCDCGK
                     QSFPPQIICPHCWSDSLEWTELSQRGVIYSWTRVHAAPTIFAAEAPYCVCIVDLDCGV
                     RIACKLLETEAVAPSVGMPVEMVRLRYEDGDLFAARALQR"
     misc_feature    486315..486695
                     /locus_tag="CNE_BB1p04710"
                     /note="Predicted nucleic-acid-binding protein containing a
                     Zn-ribbon [General function prediction only]; Region:
                     COG1545"
                     /db_xref="CDD:224462"
     misc_feature    486369..486479
                     /locus_tag="CNE_BB1p04710"
                     /note="Rubredoxin-like zinc ribbon domain (DUF35_N);
                     Region: DUF35_N; pfam12172"
                     /db_xref="CDD:256889"
     misc_feature    486480..486668
                     /locus_tag="CNE_BB1p04710"
                     /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
                     /db_xref="CDD:250873"
     gene            486804..488579
                     /gene="ksdD2"
                     /locus_tag="CNE_BB1p04720"
                     /db_xref="GeneID:10915452"
     CDS             486804..488579
                     /gene="ksdD2"
                     /locus_tag="CNE_BB1p04720"
                     /EC_number="1.3.99.4"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxosteroid 1-dehydrogenase KsdD"
                     /protein_id="YP_004687934.1"
                     /db_xref="GI:339328242"
                     /db_xref="GeneID:10915452"
                     /translation="MRDTPPSTDTVDCDLLVIGSGAGGLSTAVTARKHGLNVLVVEKD
                     SMFGGTTAFSGGVLWIPGNPVSRRANQKDSRDAARSYLAAEAGAAFDAAAVDAFLENG
                     PKMVEWFERETSVRFVPTLYPDYHPTQIGGVDVGRSILAAPFDIRELGKDMPRLRPPL
                     ATITFIGMMFNSSNADLKHFFNVTKSVRSFFYVARRLASHLKELVRYRRGVNVTSGNA
                     LAARLAKSALELGIPIWTASPALRLVTRDGAVVGAVVSRDGREVEIRARQGVVLASGG
                     FSHDIERLRKAYPHIARGGEHFSPVPVTNTGDGARLAEQAGGTVPLRYRDAAAWMPVS
                     KVPMRGGRFVAFPHLLDRYKPGVIGVLRNGQRFTNESNSYHDVGADLIRACEGQPETA
                     MWLICDQGTISKYGLGYAKPAPLPLGGLLRKGYLMRGRSLAELAQKCGIDANALEQTV
                     RDFNAGAQHGDDRQFGRGTTSFNRYLGDPEHKPNPCVAPVAQGPFYALKVVMGDLGTF
                     DGIATNVEGAVLREDGVPIEGLYAVGNDRASIMGGNYPGAGITLGPIMTFGYITGRHI
                     ARRANVPAGSRALQGTRQEKVHAAR"
     misc_feature    486822..488534
                     /gene="ksdD2"
                     /locus_tag="CNE_BB1p04720"
                     /note="putative succinate dehydrogenase; Reviewed; Region:
                     PRK12842"
                     /db_xref="CDD:237224"
     misc_feature    486843..>486992
                     /gene="ksdD2"
                     /locus_tag="CNE_BB1p04720"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    <487449..488513
                     /gene="ksdD2"
                     /locus_tag="CNE_BB1p04720"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            488566..488919
                     /locus_tag="CNE_BB1p04730"
                     /db_xref="GeneID:10915453"
     CDS             488566..488919
                     /locus_tag="CNE_BB1p04730"
                     /codon_start=1
                     /transl_table=11
                     /product="NIPSNAP family containing protein"
                     /protein_id="YP_004687935.1"
                     /db_xref="GI:339328243"
                     /db_xref="GeneID:10915453"
                     /translation="MQPDNALTLVDHRIYTIRLRKMNEFLDVFGKMAMPILLETLGNP
                     LGAYVSQVGPQNQFVHLWGYVDLADYERRSRARDAHPRFSDYLAASEHLIVAQETRLI
                     RAVAMPGVTIPTSHR"
     misc_feature    488602..488883
                     /locus_tag="CNE_BB1p04730"
                     /note="NIPSNAP; Region: NIPSNAP; pfam07978"
                     /db_xref="CDD:254560"
     gene            488962..489963
                     /gene="bugT2"
                     /locus_tag="CNE_BB1p04740"
                     /db_xref="GeneID:10915454"
     CDS             488962..489963
                     /gene="bugT2"
                     /locus_tag="CNE_BB1p04740"
                     /codon_start=1
                     /transl_table=11
                     /product="extra-cytoplasmic solute receptor BugT"
                     /protein_id="YP_004687936.1"
                     /db_xref="GI:339328244"
                     /db_xref="GeneID:10915454"
                     /translation="MKFLPRIARTSRGLAAAFSGVLLSMAALAPVAAADAYPSKPITV
                     VVPYSAGGASDIQVRAISQQLSKILGQPIIVDNRAGASGAIGAAFVARAAPDGYTLLY
                     PNNGLLIAALLNKAAGYDPLKDLAPISTVTAMPMVLVVNKDLPVNNLREFFAYAKGRP
                     NTLNYATAGPGSYGNLATHLLSQAASLRMTQVPYRGEANTTMSVRSGESQVLFTSPSA
                     TMMGQVNAGNLKLLGVGSAGRSEVAPNAQPIAEVLPGFKSEIWFGLMAPAKTPQPIID
                     KLNQAVQQVLKDPAIRAKLLANSAVAQPSSPQTFEKLLRTEHAQYAEIIRKHNITAD"
     misc_feature    489136..489951
                     /gene="bugT2"
                     /locus_tag="CNE_BB1p04740"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            490091..491245
                     /locus_tag="CNE_BB1p04750"
                     /db_xref="GeneID:10915455"
     CDS             490091..491245
                     /locus_tag="CNE_BB1p04750"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004687937.1"
                     /db_xref="GI:339328245"
                     /db_xref="GeneID:10915455"
                     /translation="MTLMNIAGLSEEQRMMREGVLDLLSRHLPWDKVRKMDEAREFPH
                     EAFNALAEAGYLGIFYPESLGGMGGSFKDIAVFLETLGYYYTGIAQAVTTTAIYAGMH
                     IAKFGSPELQQAIVPGIIAGKTKLALAMSEPGTGSDVAGIKTNARRDGDEFVLNGNKV
                     WITCAHVADYLVVITKTDTGAARHQGISTLLVDAKAPGVTIKPLAMLGRRTSHANEVF
                     FDNVRVPATNLIGGEGMAWKNIMKCLGLERMALAAISSGHCFKITEYARDYAKDRIQF
                     GQPISKFQVIQHKLADMLIMSESARQATYRVAELLDGGHPALQETSIAKIVATDNNFK
                     CADIGLQVLGGAGYSMEYDMQMFFRDSRVGPIGGGSNEIQRNVLAKLMDL"
     misc_feature    490112..491236
                     /locus_tag="CNE_BB1p04750"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    490121..491230
                     /locus_tag="CNE_BB1p04750"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
                     /db_xref="CDD:173838"
     misc_feature    order(490259..490261,490472..490474,490478..490480,
                     490571..490573,490577..490579,491186..491194,
                     491198..491200,491204..491206)
                     /locus_tag="CNE_BB1p04750"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            491307..492491
                     /gene="pobA"
                     /locus_tag="CNE_BB1p04760"
                     /db_xref="GeneID:10915456"
     CDS             491307..492491
                     /gene="pobA"
                     /locus_tag="CNE_BB1p04760"
                     /EC_number="1.14.13.2"
                     /codon_start=1
                     /transl_table=11
                     /product="P-hydroxybenzoate hydroxylase"
                     /protein_id="YP_004687938.1"
                     /db_xref="GI:339328246"
                     /db_xref="GeneID:10915456"
                     /translation="MKTQVAIIGAGPSGLLLGQLLTRAGIDNIILERQTPEYVLGRIR
                     AGVLEQGTVDLMREAGVSERMDAEGLVHEGIELVYGGERDRLDLKALTGGSTVLVYGQ
                     TEVTRDLMDARLAAGAPTIYQAANVRLHDVKGAQPYVTFERDGETIRLDCDYIAGCDG
                     FHGISRQAIPAEIQKHYERVYPFGWLGLLSDTPPVSHELIYAHHSRGFVLCSQRSQTR
                     SRYYLQVPLTERVEDWSDDRFWEELKRRLPAEVADKLVTGPSLEKSIAPLRSYVVEPM
                     QYGKLFLVGDAAHIVPPTGAKGLNLAASDVNTLYRILRLFYQKGRTDLLDKYSDIALR
                     RVWKAERFSWFMTNLLHEFPDKEPFDQRMQRTDYDYYTSSEAGLRNIAENYVGLPYDP
                     VE"
     misc_feature    491307..492482
                     /gene="pobA"
                     /locus_tag="CNE_BB1p04760"
                     /note="4-hydroxybenzoate 3-monooxygenase; Validated;
                     Region: PRK08243"
                     /db_xref="CDD:236198"
     misc_feature    491307..492398
                     /gene="pobA"
                     /locus_tag="CNE_BB1p04760"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases [Coenzyme metabolism
                     / Energy production and conversion]; Region: UbiH;
                     COG0654"
                     /db_xref="CDD:223727"
     gene            492605..493702
                     /gene="omp1"
                     /locus_tag="CNE_BB1p04770"
                     /db_xref="GeneID:10915457"
     CDS             492605..493702
                     /gene="omp1"
                     /locus_tag="CNE_BB1p04770"
                     /note="porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_004687939.1"
                     /db_xref="GI:339328247"
                     /db_xref="GeneID:10915457"
                     /translation="MKYRFQIGATMAFAAMASGASAQSNVTLYGVVDVGIEYANHQAG
                     GGKDLVRETAGNISGSRWGLRGTEDLGAGLKGLFLLESGFDPDTGKSGQGNRLFGRSA
                     YVGLSQAGVGSLLLGRQQNLLFDFVASFDPMGLAPRYSIFTQDLGFVGRSDNTVKYVG
                     TFGGLNAAAMYSFGAESGTVNGSEVPGHAKLGREYGAKLDYSIGRASFGGAYDETNTG
                     TLTTNPDATTRRATFAGTYAFDKVTAYAGYRWANASGGARLPGTTSAAATQGANLWWA
                     GARWQVTPAVTLAGAAYYQDFRHSSADPWLFVGFANYSFSKRTDVYLSAAYTKNKNGS
                     ALGAGQGAAGWGNTDPGMNQFAANVGVRHKF"
     misc_feature    492674..493699
                     /gene="omp1"
                     /locus_tag="CNE_BB1p04770"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    order(492674..492676,492680..492682,492698..492700,
                     492704..492712,492800..492814,492830..492832,
                     492836..492844,492848..492850,492854..492865,
                     492899..492904,492908..492922,492950..492958,
                     493055..493057,493061..493066,493547..493552,
                     493559..493561,493685..493687,493691..493693,
                     493697..493699)
                     /gene="omp1"
                     /locus_tag="CNE_BB1p04770"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    order(492695..492697,492785..492787,492902..492904,
                     492995..492997,493055..493057)
                     /gene="omp1"
                     /locus_tag="CNE_BB1p04770"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(493800..493967)
                     /locus_tag="CNE_BB1p04780"
                     /db_xref="GeneID:10915458"
     CDS             complement(493800..493967)
                     /locus_tag="CNE_BB1p04780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687940.1"
                     /db_xref="GI:339328248"
                     /db_xref="GeneID:10915458"
                     /translation="MAVRAGESRCSMTRALRQPEHYCLVSRRYGIRQKTAATVALLME
                     PFQELEFVLAQ"
     gene            494134..495501
                     /locus_tag="CNE_BB1p04790"
                     /db_xref="GeneID:10915459"
     CDS             494134..495501
                     /locus_tag="CNE_BB1p04790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687941.1"
                     /db_xref="GI:339328249"
                     /db_xref="GeneID:10915459"
                     /translation="MLTGRRAMAFPWKQGTATAAMPILMLADMLLRHRFSVALLAVGY
                     LIFLLLQHRQAATGVRRTSIALTSLTVLLLPVIDMPMKALESGVRIGGMISSLLISVS
                     LLSRASMRVPRMRKVVADLFALQRSQRPLALGIAAQFLGGFLGLAGLTMMMDVAAQRD
                     GVVKTDQIADFSAISRGYAALSLWSPMYSNMSIVLALYGGIGWTEVLPYAFVISALFI
                     GLGALLEKAKRRGAMPSEAQATSVVPLLREGLPIMAVILCFVALMVLTSNRLNLSISA
                     VIIFGAPAVAWLLNVLHTSDRTRRWAAGSRQLGQDLLGQSAMAGEVMLFLASGCAGTV
                     FSQALPVSWSAAIAQMTGGSSYLSCLLVIVAIVLLSGTAIHPMLSAILVGSSLSPMLL
                     NLPSLVHVCAVLVGWGLAIIVTPFSVVSLMAARFSGIPILVISLRANLAFVLVSMGGA
                     ALVLG"
     gene            495821..495928
                     /locus_tag="CNE_BB1p04800"
                     /db_xref="GeneID:10915460"
     CDS             495821..495928
                     /locus_tag="CNE_BB1p04800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687942.1"
                     /db_xref="GI:339328250"
                     /db_xref="GeneID:10915460"
                     /translation="MIERNADVAPASGLGLFIRESQEILRRLQTVVLTE"
     gene            496237..497325
                     /locus_tag="CNE_BB1p04810"
                     /db_xref="GeneID:10915461"
     CDS             496237..497325
                     /locus_tag="CNE_BB1p04810"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_004687943.1"
                     /db_xref="GI:339328251"
                     /db_xref="GeneID:10915461"
                     /translation="MVTPASASALRLRHQLIGDHHAASVTLVGIDLGKHSFHLHGQDR
                     RGKGVFRKKLSRKQLVEFFATFHACTIVMEACAGSHHMARKLAALGHQVKLISPQFVR
                     PFVKSNKNDFVDAEAICEAASRPSMRFVTPKTESQQTLSALHRARESLIRDRTKTVNQ
                     MHGFLLEFGVSLPVGQAVIKRLPAVLAEHPLPPQLVAILERLHSHFKYLAEQIGEIDK
                     EMTLQLADDDTGQRLLSIPGIGPITASVLAAEMGDGKQYGSSRDFAASIGLVPRQHST
                     GGKANLLGISRRGDKNIRRLLVLCARAYMRQLDRRTGRLADWVRAMLLRRHSNVVACA
                     LANKLARTAWAITTRRAVFDAGCTGAPA"
     misc_feature    496312..497271
                     /locus_tag="CNE_BB1p04810"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    496318..496716
                     /locus_tag="CNE_BB1p04810"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    496927..497154
                     /locus_tag="CNE_BB1p04810"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(497478..497789)
                     /locus_tag="CNE_BB1p04820"
                     /db_xref="GeneID:10915462"
     CDS             complement(497478..497789)
                     /locus_tag="CNE_BB1p04820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687944.1"
                     /db_xref="GI:339328252"
                     /db_xref="GeneID:10915462"
                     /translation="MMTTRKLRLGPLPKSESTKLTFACPASLKADLDRYAALHAQTYG
                     EAVDAATLIPHMLETIMAGDRGFRKSMVTPIFATLSLDADVGLRKSIRRRRGEWLPAP
                     R"
     misc_feature    complement(497580..497780)
                     /locus_tag="CNE_BB1p04820"
                     /note="Uncharacterized conserved small protein [Function
                     unknown]; Region: COG5639"
                     /db_xref="CDD:227926"
     gene            complement(497786..499063)
                     /gene="trbI"
                     /locus_tag="CNE_BB1p04830"
                     /db_xref="GeneID:10915463"
     CDS             complement(497786..499063)
                     /gene="trbI"
                     /locus_tag="CNE_BB1p04830"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="YP_004687945.1"
                     /db_xref="GI:339328253"
                     /db_xref="GeneID:10915463"
                     /translation="MSQDDTPDLATPQAGKVAPEAVALRAQPRPVTRLNRRTLAILAG
                     TLSVAVLGALMWSLQPQRRGAGEQTELYNVDRVSKSEGLDALPADYSKLPPPLPASVP
                     ELGPPLPGDLGPAIVKSQQPVTAAYTAPGHDPNDALRKEAEAAAASLVFFRSGSQQAA
                     QVAQTQVAAAPGFAANAAFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLTGGSTETR
                     NSGNLTLPASPYQVMAGTVVAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQG
                     SRILGKYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLAGTDPAGYAGLEDGVDWHWD
                     RIFASAALTTLLGVGAELAAPENRQDGDRVIIAGRDSAQDSINQVGQEMTRRNMNIQP
                     TLTERPGLPVRIIVNRDLVLRPYQPLFFNKGTS"
     misc_feature    complement(497804..499027)
                     /gene="trbI"
                     /locus_tag="CNE_BB1p04830"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    complement(497828..498376)
                     /gene="trbI"
                     /locus_tag="CNE_BB1p04830"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            complement(499066..500058)
                     /gene="trbG"
                     /locus_tag="CNE_BB1p04840"
                     /db_xref="GeneID:10915464"
     CDS             complement(499066..500058)
                     /gene="trbG"
                     /locus_tag="CNE_BB1p04840"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
                     /protein_id="YP_004687946.1"
                     /db_xref="GI:339328254"
                     /db_xref="GeneID:10915464"
                     /translation="MNQSFRFYAFVLTVAALSGCASQGKPPPSISLDKPAQAQALPEP
                     PAPVEVVTVPEPLALPAQLKPLPEADTAPAAPEPADEKVRVSRANAEARIAPTREGYV
                     NAIQVWPFTDGAVYQVYAAPRHVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGSGDAL
                     RINVLVKPIRSSLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYPKDRMLALQRQSQ
                     AAQTAAPVDTGLALEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPL
                     FVIGGQGDGQLVNYRFRPPYYIVDRLFGAAELRLGGDGGDVVRIERTDGVARRN"
     misc_feature    complement(499087..499362)
                     /gene="trbG"
                     /locus_tag="CNE_BB1p04840"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    complement(order(499096..499116,499138..499140,
                     499297..499314,499330..499350))
                     /gene="trbG"
                     /locus_tag="CNE_BB1p04840"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            complement(500055..500759)
                     /gene="trbF"
                     /locus_tag="CNE_BB1p04850"
                     /db_xref="GeneID:10915465"
     CDS             complement(500055..500759)
                     /gene="trbF"
                     /locus_tag="CNE_BB1p04850"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbF"
                     /protein_id="YP_004687947.1"
                     /db_xref="GI:339328255"
                     /db_xref="GeneID:10915465"
                     /translation="MRFKRPQVRYADTPQPATPYQSAAQVWDDRIGSARVQAKNWRFM
                     AFGCLTLALLMAGGLVWRSAQSIVTPYVIEVDQSGQVRAVGEAATPYRPADAQIAHHL
                     ARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAAVLNDYASKNDPFARIGKESVTVQI
                     TSVVRASDTSFNVRWTEQRFINGAPAGTERWNAVLSTVLQTPRTEQRLRKNPLGIYVN
                     GLSWSRELDSSEGAKP"
     misc_feature    complement(500076..500759)
                     /gene="trbF"
                     /locus_tag="CNE_BB1p04850"
                     /note="conjugal transfer protein TrbF; Provisional;
                     Region: PRK13872"
                     /db_xref="CDD:184356"
     gene            complement(500790..502163)
                     /gene="trbL"
                     /locus_tag="CNE_BB1p04860"
                     /db_xref="GeneID:10915466"
     CDS             complement(500790..502163)
                     /gene="trbL"
                     /locus_tag="CNE_BB1p04860"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer transmembrane protein TrbL"
                     /protein_id="YP_004687948.1"
                     /db_xref="GI:339328256"
                     /db_xref="GeneID:10915466"
                     /translation="MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIA
                     GLYWAMSHATGQGEDVIAKLLRKVLYVGAFAYIIGNFNWLSCVVFRSFAGLGITATGS
                     AITMENFLQPGRLAKTGIDAAAPILDQIGDMAGFPEVFVILDPIVVLFIAWLVVILCF
                     FVLAVQLFITLIEFKLTTLAGFVLIPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIV
                     GIGSGLFAEFQVHPDEPSIDHALVVMLASIALLALGIFGPGIATGLVSGAPQLGAGAM
                     AGAAVGAVGTGVAIGATATGVGGAVMAGARMAPAAAKLAGSGARAATSAASSAKSAFQ
                     AGSAAARGGAKGAAAGLGNVAKTGAQAAGRRAASGASAAGQKVADSFRAGWNGANAGA
                     AGSGQAAAGEGADSAASAPKQEQPAWAKRMHRRQQITHAATTAAHTLRGGDGGGSGQG
                     PSLRPDE"
     misc_feature    complement(500880..502163)
                     /gene="trbL"
                     /locus_tag="CNE_BB1p04860"
                     /note="conjugal transfer protein TrbL; Provisional;
                     Region: PRK13875"
                     /db_xref="CDD:237537"
     misc_feature    complement(500880..502163)
                     /gene="trbL"
                     /locus_tag="CNE_BB1p04860"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; cl01503"
                     /db_xref="CDD:260967"
     gene            complement(502160..503248)
                     /gene="trbJ"
                     /locus_tag="CNE_BB1p04870"
                     /db_xref="GeneID:10915467"
     CDS             complement(502160..503248)
                     /gene="trbJ"
                     /locus_tag="CNE_BB1p04870"
                     /note="protein belongs to CMGI-2"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer TrbJ signal peptide protein
                     TrbJ"
                     /protein_id="YP_004687949.1"
                     /db_xref="GI:339328257"
                     /db_xref="GeneID:10915467"
                     /translation="MKARVLSVSLAAALSVSLLAVQPASALTVFDPSNFVQNTLTAVR
                     TLEQINNQINQLQNEAQMLLNQARNLTKLDFNITNRLRSTLATTERLIAEAQGLAYDV
                     QSMDATFSRLYPEQYAATISGDRMAQDARERWKNTLDGLHTAMRMQAQVSQNLAQDES
                     ALADLVSQSQSATGALQAMQATNQLLALQAKQSIQTQQLQITQDRAASLELARQAAAT
                     ERAREVRRRFLGTGTSYTPQSVNFYNNRREAAMRGVPVLSVSLLAVLLTACGQQPAED
                     LAATLAADPVRLKVLRARCVADRQAAGKDTCRAAAEAFRRRFFAGQAGPDEYRTLAEL
                     PPIPASFDTPDDHAPEGDAPLAAAEDTP"
     misc_feature    complement(502556..503245)
                     /gene="trbJ"
                     /locus_tag="CNE_BB1p04870"
                     /note="conjugal transfer protein TrbJ; Provisional;
                     Region: PRK13874"
                     /db_xref="CDD:184358"
     gene            complement(503245..505131)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /db_xref="GeneID:10915468"
     CDS             complement(503245..505131)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="YP_004687950.1"
                     /db_xref="GI:339328258"
                     /db_xref="GeneID:10915468"
                     /translation="MLNLAEYRQRPALLADWLPWALLADSALVGGLAPMLGDQHLRVV
                     SVRGFPTSTWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQWFAKRKNVIA
                     LLRETIFQQESPLVDTDASNKAADAEAALQELGSDQVAFGYLTATVTVLDADPAVADE
                     KLRMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAV
                     WAGPEKNVHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAMLALQ
                     FRRYGGSRIFAFDMGRSMRATVLGLGGEHYDLGADGGIAFQPLARIDSEGYRTWAAEW
                     IEGRFLHEGVTVGPDEKAAIWSALGSLAGAPVEQRTMTGLSVLLQSNALRQALSPYVL
                     GGAHGKLLDADRDRLGSGDVQGFEMEELMHSPAAVQAVLRYLFARFDARFDGAPTLLI
                     LDEAWLFLDEPSFAARIRQWLKTLRKKNVSVIFATQSLADIKDSTIAPAVIESCASRI
                     FLPNPQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAAL
                     AFAGASTPQDQRDIDRVLTQAGAPGFAGTWLRHLGLDWAADLLPSSPAAASFLASQPL
                     EVSP"
     misc_feature    complement(504532..>505008)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     misc_feature    complement(503536..504372)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    complement(<504133..504369)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(504331..504339,504349..504354))
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(504262..504267,504274..504276,
                     504331..504339,504349..504351))
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(<503596..503796)
                     /gene="trbE"
                     /locus_tag="CNE_BB1p04880"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; cl17375"
                     /db_xref="CDD:266658"
     gene            complement(505144..505416)
                     /gene="trbD"
                     /locus_tag="CNE_BB1p04890"
                     /db_xref="GeneID:10915469"
     CDS             complement(505144..505416)
                     /gene="trbD"
                     /locus_tag="CNE_BB1p04890"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer transmembrane protein TrbD"
                     /protein_id="YP_004687951.1"
                     /db_xref="GI:339328259"
                     /db_xref="GeneID:10915469"
                     /translation="MSGVDSFAAGFEVPLHRSLTEPILMGGAPRTVAIANGTLAAAVG
                     LGLQLWIPGVALWIVGHSLAVWGARVDPQFMQVFARHIKHKPLLDV"
     misc_feature    complement(505147..505416)
                     /gene="trbD"
                     /locus_tag="CNE_BB1p04890"
                     /note="Type IV secretory pathway, TrbD component [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: TrbD; COG5268"
                     /db_xref="CDD:227593"
     gene            complement(505413..505796)
                     /gene="trbC"
                     /locus_tag="CNE_BB1p04900"
                     /db_xref="GeneID:10915470"
     CDS             complement(505413..505796)
                     /gene="trbC"
                     /locus_tag="CNE_BB1p04900"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbC"
                     /protein_id="YP_004687952.1"
                     /db_xref="GI:339328260"
                     /db_xref="GeneID:10915470"
                     /translation="MMQMYAHAFRISVKPVSTIARLRRLAGPAHHGLLLAALLLFLTG
                     TAQAAGSSMPWEGPLQSILESIQGPVARIVAVIIIIAMGLALAFGDTSGGFRKLIQIV
                     FGLSIAFAASSFFLSFFSFSGGAVV"
     misc_feature    complement(505416..>505670)
                     /gene="trbC"
                     /locus_tag="CNE_BB1p04900"
                     /note="TrbC/VIRB2 family; Region: TrbC; cl01583"
                     /db_xref="CDD:261006"
     gene            complement(505961..506212)
                     /gene="trbB"
                     /locus_tag="CNE_BB1p04910"
                     /db_xref="GeneID:10915471"
     CDS             complement(505961..506212)
                     /gene="trbB"
                     /locus_tag="CNE_BB1p04910"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein Trbb"
                     /protein_id="YP_004687953.1"
                     /db_xref="GI:339328261"
                     /db_xref="GeneID:10915471"
                     /translation="MTELVRATMRLRPDRVIVGEVRGGEALDLVKVWGTGHPGGTATI
                     HAGSALGALLRLEQLILEVAVNPPRALIAEAVNVVIHIA"
     misc_feature    complement(505964..>506212)
                     /gene="trbB"
                     /locus_tag="CNE_BB1p04910"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(506156..506170)
                     /gene="trbB"
                     /locus_tag="CNE_BB1p04910"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(506250..507323)
                     /locus_tag="CNE_BB1p04920"
                     /db_xref="GeneID:10915472"
     CDS             complement(506250..507323)
                     /locus_tag="CNE_BB1p04920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687954.1"
                     /db_xref="GI:339328262"
                     /db_xref="GeneID:10915472"
                     /translation="MSQYRLNLFIQPEHAKRLEELAAKKGVSKSSIVAAALASWLSPD
                     AGDQREAAIAKRLDRLSRQTERMERDQNIQIETLALFIRYFLTVSTPVPEAHQDAARA
                     QGKARFEQFVEQLGRHLLRGRSLVRDVVEELHPDPGADGRRGGAGRSPRTNCGACLMS
                     AVPQTPPERSSTAASLDRRIQMLRTAMGPVIAAALADSDVVEVMLNPDRTLWGDRLSS
                     GRTPLGVELSEDDGERIIRLVAAHVGAEVHRGRPLLTAELPETGERFEGILPPAAPGL
                     RTAQARREHHRPGSLCGRRHSDHRPSGLPAQCRARAPEHPDRRRDKQRQDHARQCLAC
                     GNRRHRRPRAGARRHDRTAMRRP"
     misc_feature    complement(<506499..506780)
                     /locus_tag="CNE_BB1p04920"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     gene            507730..507741
                     /gene="traG"
                     /locus_tag="CNE_BB1p04930"
                     /note="plasmid conjugation transmembrane protein TraG"
                     /pseudo
                     /db_xref="GeneID:10915473"
     gene            complement(509559..509813)
                     /locus_tag="CNE_BB1p04950"
                     /db_xref="GeneID:10915474"
     CDS             complement(509559..509813)
                     /locus_tag="CNE_BB1p04950"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004687955.1"
                     /db_xref="GI:339328263"
                     /db_xref="GeneID:10915474"
                     /translation="MPSLLLIGVLTACGPSETPKQPNLPTVEELAADPDRLKELRQRC
                     KTDRATLGDVLCNRVAEATRKRFYGDGKTPYTPPETPPKF"
     misc_feature    complement(509607..509804)
                     /locus_tag="CNE_BB1p04950"
                     /note="conjugative transfer region protein TrbK; Region:
                     other_trbK; TIGR04360"
                     /db_xref="CDD:213973"
     gene            complement(510055..511134)
                     /locus_tag="CNE_BB1p04960"
                     /db_xref="GeneID:10915475"
     CDS             complement(510055..511134)
                     /locus_tag="CNE_BB1p04960"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_004687956.1"
                     /db_xref="GI:339328264"
                     /db_xref="GeneID:10915475"
                     /translation="MGRKRGRLINVPDRRLCISLIREAERSGCRLAQACDELGLSLRT
                     FQRWVREGDEVVADARTTTVRPAPANKLSKAERQQILAVANSVEFASLPPSQIVPTLA
                     DRGQYVASESSFYRVLRSASQQHHRGRARKPSARVVTSHCATGPNQVWSWDITWMPAA
                     IKGQYYYWYMMLDVFSRKIVGHEVHRAESAELAALLMRRASLAEGLAGRPLVLHSDNG
                     SPMKGATMLATLENLGVVASFSRPRVSNDNPYAESLFRTCKYRPDYPRQAFGSVDEAR
                     AWTQRFVRWYNHVHKHSGLKFVTPAQRHGGVAAAVLAHREAVYAEAKARTPKRWSGPT
                     RNWSLADEVWLNPERIEPAELKQVA"
     misc_feature    complement(510781..511008)
                     /locus_tag="CNE_BB1p04960"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(510364..510708)
                     /locus_tag="CNE_BB1p04960"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(510235..510438)
                     /locus_tag="CNE_BB1p04960"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(511110..511607)
                     /locus_tag="CNE_BB1p04970"
                     /db_xref="GeneID:10915476"
     CDS             complement(511110..511607)
                     /locus_tag="CNE_BB1p04970"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3 family"
                     /protein_id="YP_004687957.1"
                     /db_xref="GI:339328265"
                     /db_xref="GeneID:10915476"
                     /translation="MRAYSAERKEALLRRMMPPENALVSALARETGVAEQTLYAWRRQ
                     MKAQGVPVPGDGKNPEAWSSEDKFAVVLETAPLNEAELAEYCRRKGLYAEQIAAWREA
                     CRSANANAGEQAREQRLQSKGDKKRIQQLEKELQRKEKALAEAAALLILRKKAQAIWG
                     EKEDD"
     misc_feature    complement(<511443..511607)
                     /locus_tag="CNE_BB1p04970"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            512220..512250
                     /locus_tag="CNE_BB1p04980"
                     /note="transcriptional regulator LysR family"
                     /pseudo
                     /db_xref="GeneID:10915477"
     gene            complement(512553..512771)
                     /locus_tag="CNE_BB1p05000"
                     /db_xref="GeneID:10915478"
     CDS             complement(512553..512771)
                     /locus_tag="CNE_BB1p05000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687958.1"
                     /db_xref="GI:339328266"
                     /db_xref="GeneID:10915478"
                     /translation="MVEYRGKVTGTLIYDQQPILDHFVMIDSQTVLGIMDFKEFPQPG
                     AFVLQRDDDSAVSVDRGDWSQLAAQRLG"
     misc_feature    complement(512622..512771)
                     /locus_tag="CNE_BB1p05000"
                     /note="Domain of unknown function (DUF4334); Region:
                     DUF4334; pfam14232"
                     /db_xref="CDD:258424"
     gene            complement(513219..513977)
                     /locus_tag="CNE_BB1p05010"
                     /db_xref="GeneID:10915479"
     CDS             complement(513219..513977)
                     /locus_tag="CNE_BB1p05010"
                     /codon_start=1
                     /transl_table=11
                     /product="DJ-1/PfpI family"
                     /protein_id="YP_004687959.1"
                     /db_xref="GI:339328267"
                     /db_xref="GeneID:10915479"
                     /translation="MPASELKIETRSGTKRKPRRILSIVSNTAKLKGVPVGFFAEEMT
                     RAFLMFTEAGHQVDLASPLGGEVMYDTHSDPRAPNGAYANDLVSLGFVHHAKFGALLK
                     NTLPISKVNVDDYDAVWVAGGGGPLVTFRDDTALHSLIASFYEKEKVVSLICHGSCLL
                     LWTRLSNGKMLAEGKKWTGFSDAEEEVVNARYGMKIHAQTIQGEAANIAGTTFICQGV
                     DEPFAVRDGRLITGQQQYSSGMTAALVLDALDEY"
     misc_feature    complement(513231..513917)
                     /locus_tag="CNE_BB1p05010"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in proteins similar to Escherichia coli Hsp31
                     protein; Region: GATase1_Hsp31_like; cd03141"
                     /db_xref="CDD:153235"
     misc_feature    complement(513222..513887)
                     /locus_tag="CNE_BB1p05010"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(order(513423..513425,513513..513518))
                     /locus_tag="CNE_BB1p05010"
                     /note="potential catalytic triad [active]"
                     /db_xref="CDD:153235"
     misc_feature    complement(513516..513518)
                     /locus_tag="CNE_BB1p05010"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153235"
     gene            complement(513959..514774)
                     /locus_tag="CNE_BB1p05020"
                     /db_xref="GeneID:10915480"
     CDS             complement(513959..514774)
                     /locus_tag="CNE_BB1p05020"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004687960.1"
                     /db_xref="GI:339328268"
                     /db_xref="GeneID:10915480"
                     /translation="MPTVLITGCSSGFGLLTAKVFLQRGWSVIATMRNVRPDILPASD
                     NLMVLPLDVTDPESIRSAVQKAGEIDVLVNNAGFGAGVPVELIELDTARQLFETNTLG
                     TLSMMQAVLPQFRERRSGTIINITSSVTIKALPLVGTYAASKTAVNALTESLALEVSP
                     FGVRVHLVLPGRSPETSFSGVARAHLRGLDSADYKPLIDGMIADFRENNGPVTFASDV
                     AEAVWHAATEPNAPFKIPAGEDARSWMAQANYVAQSQQKQSIDMKDLLCPHQS"
     misc_feature    complement(514031..514774)
                     /locus_tag="CNE_BB1p05020"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06180"
                     /db_xref="CDD:180446"
     misc_feature    complement(514052..514768)
                     /locus_tag="CNE_BB1p05020"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(514244..514252,514256..514258,
                     514343..514345,514355..514357,514394..514402,
                     514481..514483,514541..514552,514616..514624,
                     514676..514678,514736..514747,514751..514753))
                     /locus_tag="CNE_BB1p05020"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(514343..514345,514355..514357,
                     514394..514396,514478..514480))
                     /locus_tag="CNE_BB1p05020"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    complement(order(514052..514054,514184..514186,
                     514193..514195,514241..514243,514259..514264,
                     514355..514357,514373..514375,514388..514396))
                     /locus_tag="CNE_BB1p05020"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
     gene            514871..515776
                     /locus_tag="CNE_BB1p05030"
                     /db_xref="GeneID:10915481"
     CDS             514871..515776
                     /locus_tag="CNE_BB1p05030"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004687961.1"
                     /db_xref="GI:339328269"
                     /db_xref="GeneID:10915481"
                     /translation="MTVDPLSEIVTLLQPSAGLSKQVEYTGSWRIRRDPESKPVYFAV
                     LEGGCRVVGPGRSPILLRAGDFVLSPSANEQTIESIDAPPEGAYVLPVEIGEGRFRVG
                     PPTEPVNLRMQYGLCRFASPDAALLVSLLPSLVVARGEPRLEQLLQLVSDETRQFRPG
                     RDLVLERLLEVLMIEALRCGTEMASVPSLARGLSDVRLAPALRAVHARPDSDWTVTKL
                     AIEAGMSRSAFFARFGRIVGLAPMEYVLAWRMALAKRLLRAHDLATERIATQVGYSSA
                     STFTTAFTRHVGMTPLRYARSTDIP"
     misc_feature    514880..515356
                     /locus_tag="CNE_BB1p05030"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    515399..515761
                     /locus_tag="CNE_BB1p05030"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    515483..515602
                     /locus_tag="CNE_BB1p05030"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    515645..515758
                     /locus_tag="CNE_BB1p05030"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(516260..516649)
                     /locus_tag="CNE_BB1p05040"
                     /db_xref="GeneID:10915482"
     CDS             complement(516260..516649)
                     /locus_tag="CNE_BB1p05040"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="YP_004687962.1"
                     /db_xref="GI:339328270"
                     /db_xref="GeneID:10915482"
                     /translation="MADLKPQDRKFKPLDDRFPLERQLGIAAAPVVLINLFTLDYADE
                     AGFLDVFKAAAEIITKQPGFISMQLHRAIGDSPTYLNYVVWESTETVRAGLTHPEFVA
                     KLSAYPSSVVGSPHLFQKVAVPGFCTA"
     misc_feature    complement(516344..516562)
                     /locus_tag="CNE_BB1p05040"
                     /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
                     pfam03992"
                     /db_xref="CDD:252300"
     gene            complement(516706..517830)
                     /locus_tag="CNE_BB1p05050"
                     /db_xref="GeneID:10915483"
     CDS             complement(516706..517830)
                     /locus_tag="CNE_BB1p05050"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004687963.1"
                     /db_xref="GI:339328271"
                     /db_xref="GeneID:10915483"
                     /translation="MSSGPRQNNSELRQIGGDLAVATDELIAELARYRRALYRYRMQP
                     RRGLLPRGGSLRPAFLTRPPKPSPSIDKTEPITMNDVIIIGGSFAGLAAALQLGRARR
                     KVTVLDTGLPRNRFAGHSHGVLGHDHSPPLGILAEARQQLARYPTIKLVSARAESVSG
                     AIDDFSVLTGDGESLRARRLILSYGVVDQMPAVPGYVESWGTYIVPCPYCDGFEVAGQ
                     HWGLVWSGPQSINQVRLFHDWTDRLTVFADGHDIAPDTRADLARRNAPVVDGRITEIV
                     RHGGRNATVKLDSAPDVAVDILFAHPRTKPSASLHESLGLATDNTPTGIALKVDERRE
                     TSMPGIYAAGDLANPGLPSVTTASWQGATAGISAQQSMLA"
     misc_feature    complement(516712..517602)
                     /locus_tag="CNE_BB1p05050"
                     /note="Thioredoxin reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region: TrxB;
                     COG0492"
                     /db_xref="CDD:223566"
     misc_feature    complement(<517336..517593)
                     /locus_tag="CNE_BB1p05050"
                     /note="Anaerobic glycerol-3-phosphate dehydrogenase [Amino
                     acid transport and metabolism]; Region: GlpB; cl17730"
                     /db_xref="CDD:248284"
     gene            518079..518639
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /db_xref="GeneID:10915484"
     CDS             518079..518639
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /EC_number="1.3.99.16"
                     /codon_start=1
                     /transl_table=11
                     /product="isoquinoline 1-oxidoreductase subunit alpha"
                     /protein_id="YP_004687964.1"
                     /db_xref="GI:339328272"
                     /db_xref="GeneID:10915484"
                     /translation="MFFATAQFLLLGCGHTASPDPIEKHRPPNSKDAKMNLNVNGRDY
                     AFDVEPEMPLLWALRDELRITGPKYGCGVGYCGACTVHMNGTPVRSCSMPVGAVSGPV
                     VTIEGLGQPDALHAVQRAWIEHQVAQCGYCQAGQMMTAAAFLAATPAPTDKQIDDAMS
                     ANLCRCGTYPRIREATKTAAKLLKGV"
     misc_feature    518172..518630
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /note="Aerobic-type carbon monoxide dehydrogenase, small
                     subunit CoxS/CutS homologs [Energy production and
                     conversion]; Region: CoxS; COG2080"
                     /db_xref="CDD:224991"
     misc_feature    518181..518363
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(518274..518279,518289..518291,518298..518300,
                     518304..518315,518346..518351)
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(518289..518291,518304..518306,518313..518315,
                     518349..518351)
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    518388..518609
                     /gene="iorA1"
                     /locus_tag="CNE_BB1p05060"
                     /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
                     /db_xref="CDD:250876"
     gene            518642..520885
                     /gene="iorB1"
                     /locus_tag="CNE_BB1p05070"
                     /db_xref="GeneID:10915485"
     CDS             518642..520885
                     /gene="iorB1"
                     /locus_tag="CNE_BB1p05070"
                     /EC_number="1.3.99.16"
                     /codon_start=1
                     /transl_table=11
                     /product="isoquinoline 1-oxidoreductase subunit beta"
                     /protein_id="YP_004687965.1"
                     /db_xref="GI:339328273"
                     /db_xref="GeneID:10915485"
                     /translation="MGRVATITRRTFLIGSAALAGGVAFGIYKFKRELPNPLLHELSS
                     GEAAITPYVKIDANGITLITPRGDKGQGAYSVQAYLLAEELDVDPLKVRLSPGLPDAA
                     YYNGAVLEEAAPKPSYDDSWLAERMRASMEAPAKLLGMQVTGGSSTVRDAFVKLRTAG
                     AVARETLKEAAARQSGVPRDQLKTEDGHVILPDGKRIAYTQLAAAAATLEPVRGIPLR
                     SESQWRYLGKAVPRVDMMRKCTGTEVYGIDFAVEGMVYASVRANPGIGAPVKRFDATK
                     AEKMRGIKKIVPIRSGVGVIADNTWRAFQAVNAIDIEWAAANYPGDQAELWKSLADSF
                     TDKRRDSRPRNDGDVDKALRTGHVIEAEYRVPYLAHAPMEPMNAVVRVMDDRCEIWTG
                     TQIPGFVQEHAAKLTGLAKEKVLVHGLPMGGSFGHRLEDTHVLQAVELAMAVKGTPVK
                     LTWSREEDMSHDYPRPAGIARGLGAIKDGHVEVYDLSIASSSVAASWLGRLMGAPPGP
                     DQSIIAGAWDQPFAIPHYRVSGYRAPETVPVSSWRSVGASGSAFFHDGFLDELIHAAG
                     ADPLEERIRLCHHDLSRKVLEAVGQMSGWNGPKTEANRGRGVAFCMAFGVPVAQVIEV
                     TKTSKGIRIDKVFVAMEVGKVLDPRNFEAQATGGIIWGLGHAIHGELTYQGHRPRQSN
                     FTAYESLKLYQVPKIEVRALTNGSKIHGIGEPTVPPAAPALANAIFAATGQRIRELPL
                     RKHIEFA"
     misc_feature    518795..520870
                     /gene="iorB1"
                     /locus_tag="CNE_BB1p05070"
                     /note="Aerobic-type carbon monoxide dehydrogenase, large
                     subunit CoxL/CutL homologs [Energy production and
                     conversion]; Region: CoxL; COG1529"
                     /db_xref="CDD:224446"
     misc_feature    519359..519583
                     /gene="iorB1"
                     /locus_tag="CNE_BB1p05070"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    519626..>520366
                     /gene="iorB1"
                     /locus_tag="CNE_BB1p05070"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     gene            complement(520999..521943)
                     /locus_tag="CNE_BB1p05080"
                     /db_xref="GeneID:10915486"
     CDS             complement(520999..521943)
                     /locus_tag="CNE_BB1p05080"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="YP_004687966.1"
                     /db_xref="GI:339328274"
                     /db_xref="GeneID:10915486"
                     /translation="MKRMRRRLFPLLFSASLLAACAGTPDRSVGFGGAWLVDGALQTQ
                     AATPVSDRSAMPPRIAIALGGGGLRGYAHIGVLQALKDAGIHPDLVVGTSIGSIIGAA
                     YASGASPDQLWQQASSMRVRSLVDVTLSGPGFVKGEALAHWGNILVGQQTIEHFPVQF
                     AAVSTDIERSLPYVITRGDAGEALRASAAIPGVFLPVQSTGHVFVDGGVTSLVPVYAA
                     RALGADVVIAVDIYCHGPRYPSNSAVSMLLRVSQMQSCQLSLPEAASADVLIAPAITP
                     AGIDDAEGRETARRLGYEAVAAALPALRATMRRHGAAD"
     misc_feature    complement(<521251..521790)
                     /locus_tag="CNE_BB1p05080"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    complement(521251..521769)
                     /locus_tag="CNE_BB1p05080"
                     /note="Patatin-like phospholipase domain containing
                     protein 6, protein 7, and fungal NTE1; Region:
                     Pat_PNPLA6_PNPLA7_NTE1_like; cd07205"
                     /db_xref="CDD:132844"
     misc_feature    complement(order(521326..521328,521662..521664,
                     521737..521739,521743..521748))
                     /locus_tag="CNE_BB1p05080"
                     /note="active site"
                     /db_xref="CDD:132844"
     misc_feature    complement(521656..521670)
                     /locus_tag="CNE_BB1p05080"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132844"
     gene            complement(521940..522644)
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /db_xref="GeneID:10915487"
     CDS             complement(521940..522644)
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar epimerase YraR"
                     /protein_id="YP_004687967.1"
                     /db_xref="GI:339328275"
                     /db_xref="GeneID:10915487"
                     /translation="MDTVISMLADQRRVLLSGATGLVGGLMLEVLLADSTVSEVHALS
                     RRALNIRHPKLQVHIVDFRRLPALPPADEVYLALGTTIKVAGSQAAFRAVDLDANLAL
                     ARGAVAAGVQRVGLVSAVGANAQSSMFYNRVKGELEDALKAMRLNALVMAQPSLLLDN
                     RDGLQQPPRIGEKLAIPIAKLLAPILPGVYRPVRARAVAQALVNTVPTAKGVVVLASD
                     MLDRIGGKLVTETSYR"
     misc_feature    complement(<521982..522611)
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    complement(521991..522611)
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(522174..522185,522243..522245,
                     522255..522257,522288..522296,522408..522416,
                     522507..522515,522576..522578,522582..522587,
                     522591..522593))
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(522243..522245,522255..522257,
                     522288..522290,522360..522362))
                     /gene="yraR"
                     /locus_tag="CNE_BB1p05090"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(522644..523654)
                     /locus_tag="CNE_BB1p05100"
                     /db_xref="GeneID:10915488"
     CDS             complement(522644..523654)
                     /locus_tag="CNE_BB1p05100"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004687968.1"
                     /db_xref="GI:339328276"
                     /db_xref="GeneID:10915488"
                     /translation="MTRNQTFSLSIGWQTLLKDFGVQASHVLRRAGLPEDLLSREGHG
                     LTTDEYFRFWRALEMEAGDVMFPLRIAETVSAESFDPPLFAALCSATLMQAVQRLAKY
                     KQLVAPMSLEVEVGKLGELTVSPRWLSVQTDVPYSLQVAELAFFLRLARLATRETVKA
                     LRVVLPELPPSAYARRYEAFFGTPVQHGASPSITFAAADALRPFLTVNKGMWRVFEPA
                     LRQRLSELDAMAATAERVRAVLLELLPSNSATIERAAERLGMSKRTLQRRLEDEGENF
                     RALVSSTRESLARHYLQNTSMSGGEIAFLLGFEEPNSFYRAFHDWTGQTPDSIRHAMR
                     LN"
     misc_feature    complement(523043..523594)
                     /locus_tag="CNE_BB1p05100"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    complement(522653..523012)
                     /locus_tag="CNE_BB1p05100"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(<522812..522937)
                     /locus_tag="CNE_BB1p05100"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            523813..524799
                     /locus_tag="CNE_BB1p05110"
                     /db_xref="GeneID:10915489"
     CDS             523813..524799
                     /locus_tag="CNE_BB1p05110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687969.1"
                     /db_xref="GI:339328277"
                     /db_xref="GeneID:10915489"
                     /translation="MSYGLTVNVLQEVLPLDHVLAASSIRRQVTTLGRRLEAEQATDA
                     RQQAEVAASGRSPEIPEPSPVRAVGIDGGYLRLAGHRRRQDGWFEVIVGKSLRDQDGG
                     HSFAYVHKLERRPADRMWNFLLREGVQPSKPVTFLSDGGDTVRFAQLGFGDRGEYVLD
                     WFHIAMRVQNLEQMIKGRPAHCDGPSNAALIKALHGAKWHLWHGCPHPALRRLESLGW
                     DLDAEGSPEEAKLLGKLEEFIVYLDNNRHFIVNYGDRYRHGEPIASGFVESAVNQVVS
                     KRFVKRQQMAWRPRHAHNLLQIRTAVLNNQLRSYVERWYPSIAGEEDHRLAA"
     misc_feature    <523876..524751
                     /locus_tag="CNE_BB1p05110"
                     /note="Uncharacterized protein family (UPF0236); Region:
                     UPF0236; pfam06782"
                     /db_xref="CDD:253910"
     gene            524937..525104
                     /locus_tag="CNE_BB1p05120"
                     /db_xref="GeneID:10915490"
     CDS             524937..525104
                     /locus_tag="CNE_BB1p05120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004687970.1"
                     /db_xref="GI:339328278"
                     /db_xref="GeneID:10915490"
                     /translation="MPDSKAFSGLDRQILLKKYDDPNLDALRFLAQGPDNLRLEGEKK
                     REAQRNWPSAN"
     gene            complement(525101..525814)
                     /locus_tag="CNE_BB1p05130"
                     /db_xref="GeneID:10915491"
     CDS             complement(525101..525814)
                     /locus_tag="CNE_BB1p05130"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004687971.1"
                     /db_xref="GI:339328279"
                     /db_xref="GeneID:10915491"
                     /translation="MVATLKRQEDHKRRPPHAAHITRQTTATAVPAQRPPRQLRSEET
                     LAKMILAGRDLIEQHGNFDLVLISDVIRIAGTSIGAFYGRFKDKDAFIASVLDAAFAE
                     MRAGANIGLPNDAASVEQGTASEFAARIVRYYVDMCRRNHGMFKAVLRHFAARNPDLN
                     PMRCLDRHIQSLVAPALAKKMQAQAKAGSESEVRIGMQMVVGTLYLSLLIDPGPLRVD
                     GDLIETKLTAMMHRFLLLT"
     misc_feature    complement(525113..525715)
                     /locus_tag="CNE_BB1p05130"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(525530..525670)
                     /locus_tag="CNE_BB1p05130"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(525823..528108)
                     /locus_tag="CNE_BB1p05140"
                     /db_xref="GeneID:10915492"
     CDS             complement(525823..528108)
                     /locus_tag="CNE_BB1p05140"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004687972.1"
                     /db_xref="GI:339328280"
                     /db_xref="GeneID:10915492"
                     /translation="MAQEQTEFPPSARLPGDEERLMLQESLRRLLARHWPAERAVEHA
                     ADQQALASIWRVLAEQGLTSLGSNPQEGGLREIAVALEELGRVACPAPLIGAALANLA
                     LSTHLPEEPAPGEAAALLGALHRGDASVSFAFGSFDGDAQAGCVRFAKGTLHGRTAFV
                     EAASHATHLLVLAEPGPVLAIVPCGAAGLTVTETSGLAVPPLATVSFDRVAAAALQLP
                     PGLAEDLRRIGGLALLARALGAARQGFDMAVAYAKERQQFGQPIGRFQAIQHKLANCL
                     MALEAARLMLQNAASTHDLGSENWRILGAAARAFAGPAVRQVSLETHHTLGAIGYSEE
                     HEAPRHFRRTHADLARHGGVRQAREELARALLDQGATLPEYDLGPAGNAFRDEVRAWL
                     KENWSSASRKREHDHAYEEWGYDTQFTRLLGRKGWNTMSWPREYGGQGRTPYEQLAFM
                     EEIQQAGAPMGGRGDIQAHALMAFGTDEQKAEFLPRLARGEITFCLGYSEPGSGSDLA
                     SMQTTAMRDGDEWVINGQKIWTTAAEKADYMWLAARTDRNAARPHAGISIFIVPMNSP
                     GLTVIPSMAMYGHTFCQEFLDNVRVPASALVGKVNDGWTIVTSALATERMMMGSFIAN
                     ARSEFERLVRCVCSKTVFDGALADDGAVRDRIGALAAEVEAGRQLFMNSIALAEQGRV
                     PVHEAAMSKAYMGELMERLGQTALDILGTGATLSEDAEGAVARGKFEQLLRYAILTVI
                     GGGTAEIQRNLIAQRGLGLPR"
     misc_feature    complement(526999..528060)
                     /locus_tag="CNE_BB1p05140"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(527071..528057)
                     /locus_tag="CNE_BB1p05140"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(527626..527628,527632..527634,
                     527800..527802,527806..527808,527893..527895))
                     /locus_tag="CNE_BB1p05140"
                     /note="active site"
                     /db_xref="CDD:173838"
     misc_feature    complement(525835..526974)
                     /locus_tag="CNE_BB1p05140"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(525826..526962)
                     /locus_tag="CNE_BB1p05140"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(order(525871..525873,525877..525879,
                     525883..525891,526516..526518,526522..526524,
                     526615..526617,526621..526623))
                     /locus_tag="CNE_BB1p05140"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(528231..530921)
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /db_xref="GeneID:10915493"
     CDS             complement(528231..530921)
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine-protein kinase PknK"
                     /protein_id="YP_004687973.1"
                     /db_xref="GI:339328281"
                     /db_xref="GeneID:10915493"
                     /translation="MAPDRLLIPTKFAPPRISPQSTLRTKLLARLRDARDSGLTLVCG
                     SAGFGKTTLLAQWRQQLLKDGELVCWLSLSPDERLLPQFRAYLTGALQQAGLPVDDGT
                     AFASEVRADLPVAGLVATIVDAVCQQGQDVFLFIDDYHHVDDSDTHALIQGLVDHGPE
                     TLHLILASRTHPPLAVHRQRLTGELAEIAFPDLPFDFAETQDFLAKHLGEVVPDDARL
                     IHDITDGWPVCLQMICIRLKRSPANRAVLSQLLHRRTDLQRYLSEDVVRHLAPDVADF
                     IEKLSFCRRFNAELARRVTGNAQAPVLLEQIERDNLFLLPVELDSPQPWYRLHPLFAS
                     FLQDRLQQRDPALVQEIHARASQWFEQQGLLIEALRHAYHANDTEAAVHLVERADLPI
                     RSMSFISTLQHWTDELPAEVLLGHPRLLLLGCWALVAAGRWRDAQGWLERLERPHGTL
                     APEHALHALYLRASIALQRDDTEAALALVAPSDFESLSDRFLRQAHLAVLSFSYCAAG
                     RYEDARALHGHIARLPRSELQDEMALVAESTLLLSHLLAGNNREAIRTGSALVARAEA
                     AHGRRSVSAVNSAAFLANAYYEADLLAEANEVLANRLDLLRLSSPEPMTLAIIVRSRL
                     MAAQASPEEGLRALDEEEARCRELGLDRPLAYVLAGKARLQLQLNRQDEARQLQAALD
                     QLAVRHRNAAGFLAEIEAIAALAGARLALASMDWTNAMARAETLRGYGVTFGRQKCVV
                     QADLLSGTALAEMGETTEAMHRLNAAVESAQRLGLVRTLLDEGERVRQALLQLQLTLG
                     PGCAGDYLAEVLRRSIGAHVPLQQSDDAGAQANGPALKPREVEILRLAAQSMSNKRIA
                     LTLNLTLDTVKWNMKNVFEKLGVPSRYDAVIAARKRGLID"
     misc_feature    complement(528237..530906)
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /note="ATP-dependent transcriptional regulator
                     [Transcription]; Region: MalT; COG2909"
                     /db_xref="CDD:225461"
     misc_feature    complement(530421..530822)
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     misc_feature    complement(528249..528419)
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(528276..528278,528309..528323,
                     528327..528332,528336..528341,528363..528371,
                     528408..528416))
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(528249..528254,528261..528263,
                     528270..528278,528369..528371,528375..528377,
                     528381..528383))
                     /gene="pknK1"
                     /locus_tag="CNE_BB1p05150"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            531208..531993
                     /locus_tag="CNE_BB1p05160"
                     /db_xref="GeneID:10915494"
     CDS             531208..531993
                     /locus_tag="CNE_BB1p05160"
                     /EC_number="4.2.1.116"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxypropionyl-coenzyme A dehydratase"
                     /protein_id="YP_004687974.1"
                     /db_xref="GI:339328282"
                     /db_xref="GeneID:10915494"
                     /translation="MHYETIIYERRGPVAWITLNRPAELNAVNLRMLEELQDALTAVQ
                     ADAGQAVLVLTGAGRAFCAGADLKALLAGLEVAPGEPNFADRTLATLSLLRNMPKPVI
                     AAINGLTVAGGLELAMCCDILIGAAGARIGDGHANFGVFPGGGGAAVLPRRVGLSRAK
                     QLLFTGDLADAARMQAWGLLNEVVADEELLPAVAAMAERMAAKSSLVLRRMKEVAGRS
                     VDLSQEAALRDELLACQQHTRSHDFREGLAAYSEKRPPAFRGI"
     misc_feature    531208..531981
                     /locus_tag="CNE_BB1p05160"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    531223..531807
                     /locus_tag="CNE_BB1p05160"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(531280..531282,531286..531288,531382..531384,
                     531394..531408,531529..531531,531535..531543,
                     531607..531612,531619..531621)
                     /locus_tag="CNE_BB1p05160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(531400..531402,531541..531543)
                     /locus_tag="CNE_BB1p05160"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(531481..531483,531505..531507,531568..531579,
                     531613..531624,531640..531642,531646..531654,
                     531658..531663,531676..531681,531685..531690,
                     531694..531699,531706..531708,531739..531741,
                     531748..531750,531793..531795,531802..531807)
                     /locus_tag="CNE_BB1p05160"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            532040..533611
                     /gene="lcfB1"
                     /locus_tag="CNE_BB1p05170"
                     /db_xref="GeneID:10915495"
     CDS             532040..533611
                     /gene="lcfB1"
                     /locus_tag="CNE_BB1p05170"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase LcfB"