GenomeNet

Database: RefSeq
Entry: NC_016110
LinkDB: NC_016110
Original site: NC_016110 
LOCUS       NC_016110             188552 bp    DNA     linear   CON 07-FEB-2015
DEFINITION  Streptomyces pratensis ATCC 33331 plasmid pSFLA01, complete
            sequence.
ACCESSION   NC_016110 NZ_ACZH01000000-NZ_ACZH01000154
VERSION     NC_016110.1  GI:357409092
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00191232
            Assembly: GCF_000176115.2
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Streptomycineae; Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 188552)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid1 of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 188552)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/06/2014 12:35:02
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 6,695
            CDS                          :: 6,525
            Pseudo Genes                 :: 82
            CRISPR Arrays                :: 4
            rRNAs                        :: 18 ( 5S, 16S, 23S )
            tRNAs                        :: 68
            ncRNA                        :: 2
            Frameshifted Genes           :: 70
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..188552
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /plasmid="pSFLA01"
                     /collected_by="Waksman and Lechevalier"
     gene            complement(1089..1976)
                     /locus_tag="SFLA_RS31995"
                     /old_locus_tag="Sfla_6444"
                     /db_xref="GeneID:11353822"
     CDS             complement(1089..1976)
                     /locus_tag="SFLA_RS31995"
                     /old_locus_tag="Sfla_6444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140612.1"
                     /db_xref="GI:503906618"
                     /db_xref="GeneID:11353822"
                     /translation="MNPPSAPDIYKDVPGAEVVFNAVAGEKSYLWSRNLTATSVSALK
                     SGDNIGMTFAVRCQYSSGSALPQGAETGAYWAANLVPPGETSLAPGLRWLFQAPTTAT
                     YKCRLSVTSYSSIINNDRQVTMRIPAGAELGRLAVGSGATRWTLPTASATTVARGTTA
                     TTLGYTYTPTDGKQTTIVQDANLTTCVAGSRICAGGTSAYQGTEAETWIEAQPQMPNG
                     DPCGGPIKGPVAKWSIPDAKHHQAATNTLNITKTQLGGCTQIRASLKVKDTAGNPVYI
                     HAGHASEQIAATHGLAYTL"
     gene            complement(2731..>2996)
                     /locus_tag="SFLA_RS32000"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391515"
     gene            complement(3305..3484)
                     /locus_tag="SFLA_RS32005"
                     /old_locus_tag="Sfla_6447"
                     /db_xref="GeneID:11353625"
     CDS             complement(3305..3484)
                     /locus_tag="SFLA_RS32005"
                     /old_locus_tag="Sfla_6447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014043491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140614.1"
                     /db_xref="GI:503906620"
                     /db_xref="GeneID:11353625"
                     /translation="MPTSDRPLLLLLLVLVVGLVLGALAYLSYEHPALTEPLTLVLAG
                     AAVLVPCIALTVTRR"
     gene            4956..6290
                     /locus_tag="SFLA_RS32010"
                     /old_locus_tag="Sfla_6448"
                     /db_xref="GeneID:11353626"
     CDS             4956..6290
                     /locus_tag="SFLA_RS32010"
                     /old_locus_tag="Sfla_6448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="WP_014140615.1"
                     /db_xref="GI:503906621"
                     /db_xref="GeneID:11353626"
                     /translation="MLQTVFNGRGEFVLIALAAVTIAALVGYFAARKFLDRPWAYAGL
                     FATLAAELSVTIFFPSPGHVSGQCVLNRNYNEPFATEQGLLNVAMFLPIGLFGVLALR
                     RVFPVFLGGALLSVATELGQALAPWVGRSCDSGDVLTNTLGAGIGALIGWAIVRAVRG
                     EVHSLRSAGKPAVVVFAVGFIVCAVVWEAWITPLAVDSTSLQIAGGDEKAQAQQVLAA
                     AFDDHVDIKNVQLQSGQNDAPDLLMITLESGFAELSWPDKEQLTVSLESTSQPGPGSF
                     AVPGAGAAPESADDALRIATKYAKERFPWGLEDSHVKSFPVGDDAEFGWMVSWRSRVD
                     GVLMPMRLDVQINRAGRVSALLTRHAEDFTSIPPRKVSEKQAAATASKYAGGAKTAAG
                     TLLAIRREGEWRAQWVIPVSSGTDSYPVYVDAETGKVDERASPVQGLPTAPN"
     gene            complement(6389..7396)
                     /locus_tag="SFLA_RS32015"
                     /old_locus_tag="Sfla_6449"
                     /db_xref="GeneID:11353627"
     CDS             complement(6389..7396)
                     /locus_tag="SFLA_RS32015"
                     /old_locus_tag="Sfla_6449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140616.1"
                     /db_xref="GI:503906622"
                     /db_xref="GeneID:11353627"
                     /translation="MAVFGCAGCGAVLTRAVSEVALPIHLADTHWETLHPPLLEAGSY
                     AVDPAPFGPPWRQWDEVGAREAAERGRFAPFGALSNGPSDTVLLAPGDMRGTRLILER
                     AGGYCMGIDGRDGPNLACLGCDLPVGTRIDDCGCWQVVRLLPQTVVRLPGPPERPIME
                     WAELLATGTLWHRLSEYRDIPAGVAIAQVVVAAGGAPVDVAPGLVAELLGRALGALLP
                     AGEGAKRLDLAGPGFGEPTADLVLVPVHPQTGDMWQPRAGAVPVPMDAALWAELAFPP
                     HRTRLPVVGGLPAGVERDDPLPPHPWYPFQPSREAFRYTLARMPAAREPWLRAIYDRG
                     C"
     gene            complement(7560..8054)
                     /locus_tag="SFLA_RS32020"
                     /old_locus_tag="Sfla_6450"
                     /db_xref="GeneID:11353628"
     CDS             complement(7560..8054)
                     /locus_tag="SFLA_RS32020"
                     /old_locus_tag="Sfla_6450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE endonuclease"
                     /protein_id="WP_041825995.1"
                     /db_xref="GI:754215683"
                     /db_xref="GeneID:11353628"
                     /translation="MGQTPVVRVRGRGSGRVSMAGMVCFRRGDRSRLIYSFRVHRGRK
                     GEPKGFTWQDYRDLILRAHNQLKGPIVLVWDNLRTHLMPQMKDFIAANEDWLIVFHFP
                     PYAPDLNPQEGIWSLMKQAIGNLAAANLEQLATAVKRSLKKTQYRPHLIDGCLIGTGL
                     TLTS"
     gene            8364..8708
                     /locus_tag="SFLA_RS32025"
                     /old_locus_tag="Sfla_6452"
                     /db_xref="GeneID:11353629"
     CDS             8364..8708
                     /locus_tag="SFLA_RS32025"
                     /old_locus_tag="Sfla_6452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140618.1"
                     /db_xref="GI:503906624"
                     /db_xref="GeneID:11353629"
                     /translation="MRSEVGAAAAFWCGEPTGVGREHHVEWTVEEDVALGGNTRPATS
                     FSPGVDEEEGGRIVFRGRLGLTGDGGAMLEVAGTHILFDLADPAPSAAVDGTWVEISV
                     ERNSVSLWPYLL"
     gene            complement(8683..9501)
                     /locus_tag="SFLA_RS32030"
                     /old_locus_tag="Sfla_6453"
                     /db_xref="GeneID:11353630"
     CDS             complement(8683..9501)
                     /locus_tag="SFLA_RS32030"
                     /old_locus_tag="Sfla_6453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140619.1"
                     /db_xref="GI:503906625"
                     /db_xref="GeneID:11353630"
                     /translation="MPRRQRPYPSDLSDARWELLEPTLTAWRVERRGKGLDIGRPPEH
                     DLRRIMDAILYVDRTGIPWRYLPRDFAPWETVYGYFAAWQKDGVFDQLNGLLRRLVRK
                     AGGRDAEPSACILGAQSIKTSANVPAAGQGIDAGKKIAGRKRHIGVDTVGLLLAVLVT
                     AASVSDNVGGIRLLSNIAEGHPRVTKAWADSGYRTKAIDHGARLGIDVEVIRRDPAQK
                     GFKVIPRRWVVERTFGWLMHHRRLARDYETNPHRSEVMINIAMIDLITAGRATG"
     gene            complement(<9810..10535)
                     /locus_tag="SFLA_RS32035"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391516"
     gene            complement(10604..11008)
                     /locus_tag="SFLA_RS32040"
                     /old_locus_tag="Sfla_6455"
                     /db_xref="GeneID:11353632"
     CDS             complement(10604..11008)
                     /locus_tag="SFLA_RS32040"
                     /old_locus_tag="Sfla_6455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140620.1"
                     /db_xref="GI:503906626"
                     /db_xref="GeneID:11353632"
                     /translation="MERVGSARELVLGYVHALNAVDEVMRAAIPSLERLADVLGLVRS
                     RRIISRSGHIGAYSYTVHGAGCRFVSDNGTEIDVDFATDGSEIFDLWRLRWYGLSLPE
                     PLDVMDQDLRAAVQSLQPLLTEVQPGWFSVAS"
     gene            11144..11404
                     /locus_tag="SFLA_RS32045"
                     /db_xref="GeneID:23391517"
     CDS             11144..11404
                     /locus_tag="SFLA_RS32045"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825953.1"
                     /db_xref="GI:754215630"
                     /db_xref="GeneID:23391517"
                     /translation="MAGESSEAAAGDVDGCLVGGHVITKFVRPGRGRVLLDVKVDQQF
                     GDVHAASPMDRFLETLVDQHFLQAHPASLGGLVEQQGLGEVA"
     gene            11485..11769
                     /locus_tag="SFLA_RS32050"
                     /old_locus_tag="Sfla_6457"
                     /db_xref="GeneID:11353634"
     CDS             11485..11769
                     /locus_tag="SFLA_RS32050"
                     /old_locus_tag="Sfla_6457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019056511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140622.1"
                     /db_xref="GI:503906628"
                     /db_xref="GeneID:11353634"
                     /translation="MIVYPLWHVGHQNEAGDDGSTVHVDESGVFCDESDGDDVKLLGI
                     YSTLERVEERVRQARLLPGFRDEPECFYFDPCELDEDDWTEGFVRVPPGE"
     gene            11961..13142
                     /locus_tag="SFLA_RS32055"
                     /old_locus_tag="Sfla_6458"
                     /db_xref="GeneID:11353635"
     CDS             11961..13142
                     /locus_tag="SFLA_RS32055"
                     /old_locus_tag="Sfla_6458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825954.1"
                     /db_xref="GI:754215632"
                     /db_xref="GeneID:11353635"
                     /translation="MPADVSSLIPPALDQLGPRPGATPSEIPDLLECLAQVPDPRNPR
                     GVRHPLAAVLALTACAVLAGARSLLAVSEWVAEAPEELLERLGIRVDPLFPKRSWPAE
                     TTIRRVLARIDANALDRAVGTWLACRQQDAGGLRALAVDGKSLRGAARAKGRRVHLLA
                     ACDHVGGLVLAQMDVGEKTNEITRFRPLLDTLPDLSGTVVTSDALHTQTDHATYLRGR
                     DTHYIVIVKRNTKKLSTQLKSLPWQQIPLQDRTRTTGHGRCEIRRLKVCTVNNLLFPG
                     ARQAVQIVRRRVNRTTGKVSLKTIYAVTSLAAEQAPPARVAQLIRGHWTVEALHHVRD
                     VTFAEDASQLRSGNAPQAMATYRNLAIGALRLAGVRNIAAGLRRTARDQTRTLTHLGL
                     T"
     gene            complement(<13180..13697)
                     /locus_tag="SFLA_RS32060"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391518"
     gene            complement(13878..14234)
                     /locus_tag="SFLA_RS32065"
                     /db_xref="GeneID:23391519"
     CDS             complement(13878..14234)
                     /locus_tag="SFLA_RS32065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019888745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030125816.1"
                     /db_xref="GI:662755003"
                     /db_xref="GeneID:23391519"
                     /translation="MTYEVTPAGELLVQADYTFVYALVKTSGAKQINPNGFEVARVVV
                     HRQLDILVRDGKLHLQTHATAIANDDCTAPADGFIHPLFYDDLKKTKKWASVDPYAEK
                     HADASAPGACVRPTRT"
     gene            15078..15398
                     /locus_tag="SFLA_RS32070"
                     /old_locus_tag="Sfla_6461"
                     /db_xref="GeneID:11353638"
     CDS             15078..15398
                     /locus_tag="SFLA_RS32070"
                     /old_locus_tag="Sfla_6461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_030125817.1"
                     /db_xref="GI:662755005"
                     /db_xref="GeneID:11353638"
                     /translation="MSIVESMGKKKPRRPRRSFTPEFKAEIVGLCRRGDRSVGQVAKD
                     FELTETAVRDWVKQAGVDAGERNGLTSAEREELAALRRENRRLREDVDVLKRATAFFA
                     KETR"
     gene            15395..16267
                     /locus_tag="SFLA_RS32075"
                     /old_locus_tag="Sfla_6462"
                     /db_xref="GeneID:11353639"
     CDS             15395..16267
                     /locus_tag="SFLA_RS32075"
                     /old_locus_tag="Sfla_6462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140626.1"
                     /db_xref="GI:503906632"
                     /db_xref="GeneID:11353639"
                     /translation="MTVHPFIEAEKRAGHSVKRACELMKVSRTAFYARRSGLPGSRAV
                     RDSELTEQITEVHARSRGTYGAPRVHAVLTREGAGCGRRRVARLMQAAGLQGRHRRRR
                     QVTTVPDPRAAFRPDLIVRDFQPGRTGLDARWCGDITYIPTDEGWLYLATVIDIASRR
                     VVGWATADHLRTDLVAEALTAACRQRRPTRPVIFHSDHGCQYTSQQFASLAAGFGVRL
                     SVGRTGQCWDNALAESFFSTIKRELLGTSAWPSRATARTAIFDFIEGWYNLHRLHSSL
                     GYLSPAEYETALAT"
     gene            complement(<16311..16979)
                     /locus_tag="SFLA_RS32080"
                     /old_locus_tag="Sfla_6463"
                     /db_xref="GeneID:11353640"
     CDS             complement(<16311..16979)
                     /locus_tag="SFLA_RS32080"
                     /old_locus_tag="Sfla_6463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140627.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_041825997.1"
                     /db_xref="GI:754215685"
                     /db_xref="GeneID:11353640"
                     /translation="MAESTDVVVVGAGVIGSSIALELVRSGLRVVVVDKFGAAGNGST
                     SASSAVVRFTYPTIAGVNAAWESRHCWQAWRDHLQAPSSEPLAAFNRCGVTLLDVDFA
                     PCGMFTRHFDKVGVPYEKWDARELSERLPAVDTGRYFPPRPVDDDEFFADASARLGAL
                     HTPDGGFIEDPQLAAHNLATAAQRHGAVFRWKTLVTAVMRRGGRVRGVRLKDGTELSA
                     GVVVN"
     gene            complement(17370..17966)
                     /locus_tag="SFLA_RS32085"
                     /old_locus_tag="Sfla_6464"
                     /db_xref="GeneID:11353641"
     CDS             complement(17370..17966)
                     /locus_tag="SFLA_RS32085"
                     /old_locus_tag="Sfla_6464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_031101347.1"
                     /db_xref="GI:664587431"
                     /db_xref="GeneID:11353641"
                     /translation="MILSTSERKGSARERLLARLLDAFGEALPPPEMSLREVAARIET
                     SHALLRYHFGSLPGVLAAMLTAQRSRDNEALLEAAQQGTFDDFVVAIWRTYTRPEQLS
                     RARGFFYVVGLAAYGPEDFREFVESIGDLTVMLSSLAEREGLDTKEAQDAATVTIAAI
                     RGLLLQEVLTPGTRSEDAVTLILGIRKSRSVPRLRPER"
     gene            18059..19284
                     /locus_tag="SFLA_RS32090"
                     /note="peptidase M38; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391520"
     gene            19281..20135
                     /locus_tag="SFLA_RS32095"
                     /old_locus_tag="Sfla_6466"
                     /db_xref="GeneID:11353643"
     CDS             19281..20135
                     /locus_tag="SFLA_RS32095"
                     /old_locus_tag="Sfla_6466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008405075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014140629.1"
                     /db_xref="GI:503906635"
                     /db_xref="GeneID:11353643"
                     /translation="MSTMWQGCLPHTDYFEMRSSGGHDYGIWVTTPPNYDPATAQAPV
                     VYVLDGNWAVGMTAPLIVTQLDPMQAIHPYVQVSVGYAGEEAEQWERLRNRDLVPPGE
                     PIAKEYVDAVEMGVETGTMTREQADSYLSELSDSRGDRFLDFLTDDLHPRIERDYGTA
                     RSGHGLFGYSYGGLFSLYAWLTKSTFFESIGAGSPGIVSADSQVFALLRAMGDTLPDT
                     KLHVTFNDREILGDLAVYQNLAKNAATFLHHLTSRSGSVTSALMHETHVTGLQASFLS
                     YLRSCRAQ"
     gene            <20811..21053
                     /locus_tag="SFLA_RS32100"
                     /db_xref="GeneID:23391521"
     CDS             <20811..21053
                     /locus_tag="SFLA_RS32100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580316.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA:3-ketoacid-CoA transferase"
                     /protein_id="WP_041825999.1"
                     /db_xref="GI:754215687"
                     /db_xref="GeneID:23391521"
                     /translation="DLVHGARRVVVLMEHIARDGSFKIVEERSLALTGKRAVQRIITN
                     LCVLDVTTEGLRLVELAPNVSVGDVRARTQPEICCG"
     gene            21244..21585
                     /locus_tag="SFLA_RS32105"
                     /old_locus_tag="Sfla_6468"
                     /db_xref="GeneID:11353645"
     CDS             21244..21585
                     /locus_tag="SFLA_RS32105"
                     /old_locus_tag="Sfla_6468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009712553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_041825961.1"
                     /db_xref="GI:754215641"
                     /db_xref="GeneID:11353645"
                     /translation="MTRRNPPLTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIA
                     VGTLYGALERMERAGLVAAGHEEIVDGRARRYYWLTEDGTETLGREALRMQQAAAVVI
                     GRARDTGAAPA"
     gene            21582..22538
                     /locus_tag="SFLA_RS32110"
                     /old_locus_tag="Sfla_6469"
                     /db_xref="GeneID:11353646"
     CDS             21582..22538
                     /locus_tag="SFLA_RS32110"
                     /old_locus_tag="Sfla_6469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010981466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140632.1"
                     /db_xref="GI:503906638"
                     /db_xref="GeneID:11353646"
                     /translation="MNRLLLSAYPRSYRSRQGNELLACLTEAYPGRSWPPPREVAALV
                     HSGVQARARATVDDTTRPWWLDGVHLAALALAALALVPYLQDVWHWALRIDPGQHAIA
                     FHFSGWYPWAGGPTRIRLLPYGLLPLGCLIALLRGRAWIALPAAAAMIWAGATSHGRT
                     LFGSEGKAGLSYYGLGAPITARDLALSGALCAACTVLALCRPSRLRRRSYRWLAPVVL
                     AMFVAGGLHIISVSPAFQRGLFVLEVTALLGAWVATAATGDHRWLIPVAAVAIVRTQA
                     IVVQPDAFMQSLPDVVVLILLVAPLPALAITAQRRQARALAE"
     gene            22631..23542
                     /locus_tag="SFLA_RS32115"
                     /old_locus_tag="Sfla_6470"
                     /db_xref="GeneID:11353647"
     CDS             22631..23542
                     /locus_tag="SFLA_RS32115"
                     /old_locus_tag="Sfla_6470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_014140633.1"
                     /db_xref="GI:503906639"
                     /db_xref="GeneID:11353647"
                     /translation="MTQHDSPILPAHHPRASRQAPEAPDNHSPSRSTRSWMPALLYTL
                     GFLTVYLLAICTPWGQRAENALFGLGRANPEDVWIYPLSGAAYGSTPLPPLELSAKPT
                     LMVGLAVIVLLTLVRRCWWQGCAALGVVVLTTGGKEVLRSILPRPDLVGAPENLLDQG
                     FPSGHTAIPAALTLAAVLLVSPRIRPYAATAGVLWLACIAAYSATNGGHRPSEVLGAA
                     LLACACYSLATWLLPPAAAPGAMWSPRALPVFTLTLALAIALVSGARNDTLTRSLVSA
                     ATGFVCAAMVWYAAVGRPARRTRPTLG"
     gene            23673..23951
                     /locus_tag="SFLA_RS32120"
                     /db_xref="GeneID:23391522"
     CDS             23673..23951
                     /locus_tag="SFLA_RS32120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020393378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825963.1"
                     /db_xref="GI:754215643"
                     /db_xref="GeneID:23391522"
                     /translation="MESFDGASSVIAYGKGREIASNRRDEQEMFVLCLRILQSALVYV
                     NTLMLQDVLGEPEWADLLTPADRRGLTPPFWSHVRPYGEVKTSTWTPV"
     gene            24209..24538
                     /locus_tag="SFLA_RS32125"
                     /old_locus_tag="Sfla_6472"
                     /db_xref="GeneID:11353649"
     CDS             24209..24538
                     /locus_tag="SFLA_RS32125"
                     /old_locus_tag="Sfla_6472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140634.1"
                     /db_xref="GI:503906640"
                     /db_xref="GeneID:11353649"
                     /translation="MGAAYYRAESESGHHVEDPSEDALFTLIDDLNGSDNTFVVVQPD
                     EDDPVWFTSVAVLDEGGYEVVRRDTIRREHDVVTETNIDRIARDLTIWMAARDFPGRP
                     TQHASNF"
     gene            complement(24607..25377)
                     /locus_tag="SFLA_RS32130"
                     /old_locus_tag="Sfla_6473"
                     /db_xref="GeneID:11353650"
     CDS             complement(24607..25377)
                     /locus_tag="SFLA_RS32130"
                     /old_locus_tag="Sfla_6473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006124126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140635.1"
                     /db_xref="GI:503906641"
                     /db_xref="GeneID:11353650"
                     /translation="MGGVLRAEPLWVETFTGLRMGRFEKLVKVVRERGGNGPGGGRPW
                     CLPLADRVLLVAVYYRTNLTMRQLAPPFGISPATVCRVIHRLRPLLALEPAPRPVADV
                     ERLWIVDGTLVPVRDRRVAASSRNYRFSANVQVIIDADSRLVIASARPVPGNKADAHA
                     WRESGLPAIAAGTTVIADGAYLGTGLIVPHRRRAGRPLLRGQEEDNAEHRRVRARVEH
                     TFARMKNWKILRDCRQKGDGLHHAVQAVATMHNLAMTG"
     gene            complement(<25670..>25924)
                     /locus_tag="SFLA_RS32135"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391523"
     gene            complement(26016..26585)
                     /locus_tag="SFLA_RS32140"
                     /old_locus_tag="Sfla_6475"
                     /db_xref="GeneID:11353652"
     CDS             complement(26016..26585)
                     /locus_tag="SFLA_RS32140"
                     /old_locus_tag="Sfla_6475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006126549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014140636.1"
                     /db_xref="GI:503906642"
                     /db_xref="GeneID:11353652"
                     /translation="MQESVGVRQAQAQLTRSGVLNAAAAVFVERGIQAPVRDIAERAG
                     VGVGTVYRNFPTRADLVTAVYRHQIDACTALAPRLLKESSSPFTALALWTDEFVDFLV
                     TKHGLGAALRSGDPGLENLHTLMLDTLVPACASLLDACAATEELRPGITAYTLLRAIG
                     NLCITGPDYDQADAKVMVAFLLTGCRIKR"
     gene            26688..27599
                     /locus_tag="SFLA_RS32145"
                     /old_locus_tag="Sfla_6476"
                     /db_xref="GeneID:11353653"
     CDS             26688..27599
                     /locus_tag="SFLA_RS32145"
                     /old_locus_tag="Sfla_6476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Chlorophyllase-like protein"
                     /protein_id="WP_014140637.1"
                     /db_xref="GI:503906643"
                     /db_xref="GeneID:11353653"
                     /translation="MSSSHLLNHQIVSVRPISVPSPGRGIDLQVRVTAPRSGQNLPVI
                     VFSHGNAWSLDGYEPLVGRWSAAGFIVVQPTHLDSRRNAIAWDDPRFATIWRVRITDL
                     HAVLDHLDDVLAQAGLEARADRERIAVVGHSWGAQTAGALLGARVLDAEGVAGEDFSH
                     SAVSAGALIGATGTGDTLTPFAVENLPFMKPDFSTMTAPALVIAGGKDDSQLSTRGPE
                     WFTDAYHLSPAPKSLLSLTEAEHTMGGIAGEKVAETTDEDPARVALTADAISAYLRAA
                     LNLDAAEWAALNSTAEGRGDTWSLVSK"
     gene            29387..30565
                     /locus_tag="SFLA_RS32150"
                     /old_locus_tag="Sfla_6478"
                     /db_xref="GeneID:11353655"
     CDS             29387..30565
                     /locus_tag="SFLA_RS32150"
                     /old_locus_tag="Sfla_6478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_014140638.1"
                     /db_xref="GI:503906644"
                     /db_xref="GeneID:11353655"
                     /translation="MSTEQNLISTPITAAFLRGHLDVEKTAHGLLPHRLPAWARRQIP
                     DDLLAVAEAQPSGIRLAFRTSATTIHLDTLPTKRAYRGFPPPPDGIYDLLVGGRLTAQ
                     ANVAGGNLRTITDMQTQAAEFTPGPVGAAHFTDLPAGEKDVEIWLPHAEITEVIALRT
                     DGPVEPAPHTGRRVWLHHGSSISHGSNAVFPSTIWPALAASAGDVDLVNLGFGGSALV
                     DPFTARAIRDTPADLISLKLGINVVNSDAMRLRAFVPAIHGFLDTIREGHPTTPLLLV
                     SPVLCPTQENTPGPLMPDLSSGTLKFKATGDPAETDAGRLTLVIVRKVLADIVKQRSA
                     EDPNLHYLDGLDLYGESDHDEFPLPDAIHPSPEGHRRIGENFAKLVFANNGPFAGRIG
                     "
     gene            complement(30803..31258)
                     /locus_tag="SFLA_RS32155"
                     /old_locus_tag="Sfla_6479"
                     /db_xref="GeneID:11353656"
     CDS             complement(30803..31258)
                     /locus_tag="SFLA_RS32155"
                     /old_locus_tag="Sfla_6479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003952637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140639.1"
                     /db_xref="GI:503906645"
                     /db_xref="GeneID:11353656"
                     /translation="MTSAWDDPADLTLTLQAKTSQAIVVTGVTIRRLSAAPAPSAGSI
                     VNKECGGAMYQRVFDVDLMAQEINLQPVSEGAAKAVDFPLKVSDSDPEQLSLRLLPGD
                     HDVRFSVEVNWISEGEAHGETVADGQPVLRVTGPGRLPVYAYGETFTKP"
     gene            31321..31638
                     /locus_tag="SFLA_RS32160"
                     /old_locus_tag="Sfla_6480"
                     /db_xref="GeneID:11353657"
     CDS             31321..31638
                     /locus_tag="SFLA_RS32160"
                     /old_locus_tag="Sfla_6480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140640.1"
                     /db_xref="GI:503906646"
                     /db_xref="GeneID:11353657"
                     /translation="MAAPRKYPDELRERATRLAIEARKDPVGRAGAIKRIADQLDVHP
                     EALRGWVKRAETDEGLVPGTTSAEAARIAELEREVKELRRANAILKSASAFFAAELDR
                     PLR"
     misc_feature    31599..31727
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            31635..32543
                     /locus_tag="SFLA_RS32165"
                     /old_locus_tag="Sfla_6481"
                     /db_xref="GeneID:11353658"
     CDS             31635..32543
                     /locus_tag="SFLA_RS32165"
                     /old_locus_tag="Sfla_6481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014140641.1"
                     /db_xref="GI:503906647"
                     /db_xref="GeneID:11353658"
                     /translation="MKVAYIDQHKDLFGVQPICDVLAETDAPIAPSTYYAARTRPASA
                     RSLRDEHLTEEIHRIHTGNYGVYGARKIHAALVREDITVARCTVERLMRATGLRGVIR
                     ARSPRATRPAPETDRPADLVERQFTATAPNQLWVADITYIKTFSGWVYAAFVIDVFSR
                     MIVGWQVATSLYTELALEALEMAIWRRRHAGGDLAGLVHHSDRGVQYRAIRYTERLED
                     AAAVASVGSRGDSYDNALAEAFNSLFKAELIRNRGPWTGINDVEIAVAEYVDWFNQRR
                     LHGELGHVPPAEFEALYATTDATPAP"
     gene            complement(32551..32769)
                     /locus_tag="SFLA_RS32170"
                     /db_xref="GeneID:23391524"
     CDS             complement(32551..32769)
                     /locus_tag="SFLA_RS32170"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825966.1"
                     /db_xref="GI:754215646"
                     /db_xref="GeneID:23391524"
                     /translation="MFAVTAAIVTAMFTGGWTWLQGQWSDPPGLTVHAALGSCPVYMN
                     KTLDELRQDSGSDKLQKGVKPRVLWTVG"
     gene            complement(33165..33830)
                     /locus_tag="SFLA_RS32175"
                     /old_locus_tag="Sfla_6483"
                     /db_xref="GeneID:11353660"
     CDS             complement(33165..33830)
                     /locus_tag="SFLA_RS32175"
                     /old_locus_tag="Sfla_6483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140643.1"
                     /db_xref="GI:503906649"
                     /db_xref="GeneID:11353660"
                     /translation="MITNVARGFASAALTVMPLLAATPVPAADITTLAEGVRALPLAA
                     ESRTGYERSAFKHWVDADKDSCNTRMEVLIAESRIAPTVEAGCKVTAGEWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLDAERSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTADQPEAAALTDLAETCGNQPLAYELATE
                     DGN"
     gene            34243..34974
                     /locus_tag="SFLA_RS32180"
                     /old_locus_tag="Sfla_6484"
                     /db_xref="GeneID:11353661"
     CDS             34243..34974
                     /locus_tag="SFLA_RS32180"
                     /old_locus_tag="Sfla_6484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140644.1"
                     /db_xref="GI:503906650"
                     /db_xref="GeneID:11353661"
                     /translation="MRRSRVAALAAVVLSATLISCNPQLADDKPNDSTPTSGASAASQ
                     AAGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPEQGDRCKLTGGVWMSYYDEVEVTDAKKLDIDHMVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     AEKTALLDLAKDCTDTVVEFEEAAE"
     gene            35471..35762
                     /locus_tag="SFLA_RS32185"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391525"
     gene            complement(35893..36921)
                     /locus_tag="SFLA_RS32190"
                     /old_locus_tag="Sfla_6487"
                     /db_xref="GeneID:11353664"
     CDS             complement(35893..36921)
                     /locus_tag="SFLA_RS32190"
                     /old_locus_tag="Sfla_6487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140645.1"
                     /db_xref="GI:503906651"
                     /db_xref="GeneID:11353664"
                     /translation="MIRHLAAALLALAVGTTTPAAATPALVPAADREIVFTADGTTVY
                     GTLRVPEHRAGHRLRAALLLPGSGPTDRDGNQPSMSAPDTLARLADTLEGDGIATLRF
                     DKYGTGRTGLGAYKDRPEELDYPAFVRQAQAAYRALRDQPETDPRALLVVGHSEGAMT
                     GLLLGGTVHPRPAGLALLQPQAIRMLDLVTLQLKAQVAEAARQGQLTPEDQRTINAAI
                     DAAVTSLREQRPVDTTDLPPAIAQLFEAFQGPNARFVTSDDAVHPPDTAAALAPGTRV
                     LLTCGTNDTQVPCITTNALTTALRQAHAGRPGRVKLPGVDHLLHSAEHPDALAPLVLD
                     ALRRFTRR"
     gene            complement(36935..37285)
                     /locus_tag="SFLA_RS32195"
                     /old_locus_tag="Sfla_6488"
                     /db_xref="GeneID:11353665"
     CDS             complement(36935..37285)
                     /locus_tag="SFLA_RS32195"
                     /old_locus_tag="Sfla_6488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140646.1"
                     /db_xref="GI:503906652"
                     /db_xref="GeneID:11353665"
                     /translation="MALIRIADDNLVVVMEGLDKFWAFKSRLTIPLANVRGATVDPGI
                     ATDFKGIRAPGSHLPGVIIAGTFHHDGDKVFWDVKDASKAIVVELADEEYTRLVLQVD
                     DPRAAVALVENALV"
     gene            complement(37299..37799)
                     /locus_tag="SFLA_RS32200"
                     /old_locus_tag="Sfla_6489"
                     /db_xref="GeneID:11353666"
     CDS             complement(37299..37799)
                     /locus_tag="SFLA_RS32200"
                     /old_locus_tag="Sfla_6489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014140647.1"
                     /db_xref="GI:503906653"
                     /db_xref="GeneID:11353666"
                     /translation="MGRPRAFDEDEAVRAAVGLFGGRAYDGVSVDDLVAHLGVHRNSL
                     YKTFGSKRGLYLVALRRHIADDVRPLLDALAEATDAATALRLVTSADLGLLLLAAIER
                     SPVDEEVAFEVTAALDSVDRAIADALGVPAALATALTAAALGILLRGNPDKVATALAQ
                     HLGPLT"
     gene            complement(38503..39042)
                     /locus_tag="SFLA_RS32205"
                     /old_locus_tag="Sfla_6491"
                     /db_xref="GeneID:11353668"
     CDS             complement(38503..39042)
                     /locus_tag="SFLA_RS32205"
                     /old_locus_tag="Sfla_6491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_041825968.1"
                     /db_xref="GI:754215649"
                     /db_xref="GeneID:11353668"
                     /translation="MESSVTRVIDLQHYADGSLPEGFRQMLIDVHADAYADAMGDEFH
                     QRFPWFVDHWSQTKGFTCVVAYDGDEPTGFAYGAPQRPGREWWRSTTFEPAGGDTTTY
                     AVSEVMVRPRWRKQGVSDRLHEALLTERDEDLAVLLVDVTHPKVQALYETWGYEKAGE
                     QQPFADSPVYAVMVKRLRS"
     gene            complement(39027..40286)
                     /locus_tag="SFLA_RS32210"
                     /old_locus_tag="Sfla_6492"
                     /db_xref="GeneID:11353669"
     CDS             complement(39027..40286)
                     /locus_tag="SFLA_RS32210"
                     /old_locus_tag="Sfla_6492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140649.1"
                     /db_xref="GI:503906655"
                     /db_xref="GeneID:11353669"
                     /translation="MGANLVLHGRMQQLGFTQEELANRLNGALLEITGRPGEISARTV
                     RNLLNGSSRRPIGRTCAALERVFGCPVADLGLSAPSSMHRPREVPVRRRDFIASTTGA
                     AAAAVPAPIGKQRRSVGMTDVSRAAARVNLLVETDDRRGGHTSLATAALEGRAEVLGL
                     QQRNAGERVRRALYALAAEYTTIAAWSCIDLHDLDAAQRYLHESATFAGLSQDAATGM
                     RVWINMAMLAYQRQNWPEQLAAAQAASASPAARRDPLFGSMGRARLALAHSSLGDPRA
                     AKRALGAAEDILQRAVEADRPRWTAFYGPAELSHLAAVVLNRNGESAGAEAMAHRALA
                     RIPTDFRRNRALATCQLATAQLRQGDPDQATRTASSVFTIMDGAPLPGRMRTLIGDFH
                     RDLLRLAPSTTYARDWADRMRAEWSRA"
     gene            40640..41440
                     /locus_tag="SFLA_RS32215"
                     /old_locus_tag="Sfla_6493"
                     /db_xref="GeneID:11353670"
     CDS             40640..41440
                     /locus_tag="SFLA_RS32215"
                     /old_locus_tag="Sfla_6493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140650.1"
                     /db_xref="GI:503906656"
                     /db_xref="GeneID:11353670"
                     /translation="MTVLTTDHPAWTETESGGRVRAVRTASGLWVLSWDRDGLNMRCV
                     DGTEDAKPTLVSTNPDCLPSSVPGGLRSGLDRLGVSQRLANPWLWDAITTAILRQVVR
                     AGQARKLYREWCGAYGTRVDSPFGELATAPSAGDVLALADEQFDDIGAKFHRGVLRAA
                     AEHYERHSADWLGMKAPELASALTAVPRIGPWTAAAAATDFTGDFSVYPHDDLAVRTW
                     ATQIAPHYPWPDKKDKAFGPLWTGWAGPDRTALHTLTLSTLTWGSHAR"
     gene            41453..42994
                     /locus_tag="SFLA_RS32220"
                     /old_locus_tag="Sfla_6494"
                     /db_xref="GeneID:11353671"
     CDS             41453..42994
                     /locus_tag="SFLA_RS32220"
                     /old_locus_tag="Sfla_6494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014140651.1"
                     /db_xref="GI:503906657"
                     /db_xref="GeneID:11353671"
                     /translation="MQQLPRLSGADPTRALDALFVNAPLRDYGRRPRTNDYTLPVLGM
                     AYIATYAQRAGFNVGVLDAEAHGLGILETAELVNAARPRWAAMNLLAPTYEMSARIAA
                     RIDPDIALMVGGHHAKAMPDRILADPRMANLRALVLGEGELRVAALLEDEQRRRELPG
                     VLWRDRLLGTRATGIPSGRPNPQLLGPDINSLPYVNRAFLPQDPYRAAPTEADRRLAL
                     SRGTDPLRTAARTGHLEANIVGSRGCPYNCTFCGAAVSANPDLTIRVRSPENIIGELD
                     QLHDEYGVTAFRFVDDLFLGAGRVIAEQMTAFARHRIGERYVWDATGRINVLDRLGDR
                     DLDRLVQNGLREVALGIESGSDRVLRAMDKRIDAAMTERVAQRLVRHGIGVKGYFILG
                     FPGETHDDIAATVRHIRNLWAIADSSPGEVRASVFEFRPYPGTPVWTTLTDAGHDPEG
                     LLAYGDVDLTDDGADESMRQRDEFNFSVGVQFGDVPLAEVRSTLATLTREQHQRNQSV
                     QGAAA"
     gene            42991..43644
                     /locus_tag="SFLA_RS32225"
                     /old_locus_tag="Sfla_6495"
                     /db_xref="GeneID:11353672"
     CDS             42991..43644
                     /locus_tag="SFLA_RS32225"
                     /old_locus_tag="Sfla_6495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="WP_014140652.1"
                     /db_xref="GI:503906658"
                     /db_xref="GeneID:11353672"
                     /translation="MKPKRGMFITIDGPSGVGKSTTIRALHQELTARGIPVHRTAEPT
                     TSDLGRFIRAHFSHIRGHALACLVAADRYEHVAQEIRPRLSAGDTVISDRYLASTLVM
                     QQLDGVPLKFLLDLNANVLMPDLAVILTAAPALIADRISARGPRNRFHLDPTAPGREV
                     LLYKAAAQTLMTTHVKVLVVNTGGATPSEVAATITDAIPCSSIASAASPQSTPPQEP"
     gene            43641..44087
                     /locus_tag="SFLA_RS32230"
                     /old_locus_tag="Sfla_6496"
                     /db_xref="GeneID:11353673"
     CDS             43641..44087
                     /locus_tag="SFLA_RS32230"
                     /old_locus_tag="Sfla_6496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_014140653.1"
                     /db_xref="GI:503906659"
                     /db_xref="GeneID:11353673"
                     /translation="MTPQPLAEPVIDTHVILRAGDKLLFSQRGGPYGYGRWHMPSGKL
                     DRGEALRAGAARELLEETGVTVDPAHLRMVHVVHHRQSAEVDRIGFFFEATRWSGEPV
                     NREPEKCLGLEWFSVHELPDDIIEYPQKGLLAYLEGDGALTEHGWE"
     gene            complement(44215..44547)
                     /locus_tag="SFLA_RS32235"
                     /old_locus_tag="Sfla_6497"
                     /db_xref="GeneID:11353674"
     CDS             complement(44215..44547)
                     /locus_tag="SFLA_RS32235"
                     /old_locus_tag="Sfla_6497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015580388.1"
                     /db_xref="GI:505393286"
                     /db_xref="GeneID:11353674"
                     /translation="MSEKSSRLDKLRFLLRVQEQQLDVTRRWIADEERRQAERIQGER
                     ARPPQPDWVMELGIGVGAKPVEIHVGHCYAIGRRRKAITREQALAALAEGVDACTHCR
                     PDTDLGLL"
     repeat_region   44671..45058
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=44732..44753
                     /rpt_unit_seq="tccccgcgggcgcggggagcac"
     gene            complement(45281..45745)
                     /locus_tag="SFLA_RS32240"
                     /old_locus_tag="Sfla_6498"
                     /db_xref="GeneID:11353675"
     CDS             complement(45281..45745)
                     /locus_tag="SFLA_RS32240"
                     /old_locus_tag="Sfla_6498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140655.1"
                     /db_xref="GI:503906661"
                     /db_xref="GeneID:11353675"
                     /translation="MRLGDGGHRIASRADFAGWIVEQSLSELAEPFTFVVGMDLALRL
                     APRRSEHVACAGGDMVLSAGEISFMSEAGRWAVSEVSNQSTGYCPDVTSWAEVAPALD
                     AAELRRPSGFTHEVVFRRCPDCQEHNIVREGDFVCVFCGSDLPPAWNVDPTK"
     gene            complement(45994..46470)
                     /locus_tag="SFLA_RS32245"
                     /old_locus_tag="Sfla_6500"
                     /db_xref="GeneID:11353677"
     CDS             complement(45994..46470)
                     /locus_tag="SFLA_RS32245"
                     /old_locus_tag="Sfla_6500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140657.1"
                     /db_xref="GI:503906663"
                     /db_xref="GeneID:11353677"
                     /translation="MRTADDWSELAALLRRLMPVAHLATTRPLGRHYDVVITEAGPVG
                     DELLRLMDVLPGGCGPVIADAGRPVLRWVVPPGTGSWWHSRYGTCLSAPRSIPFPPLC
                     NEKPEGLYWLRPFRADRRVQPEDLAAALDAVRPSRDTHRELAAFRDLPGAAAEAQG"
     gene            complement(46467..46892)
                     /locus_tag="SFLA_RS32250"
                     /old_locus_tag="Sfla_6501"
                     /db_xref="GeneID:11353678"
     CDS             complement(46467..46892)
                     /locus_tag="SFLA_RS32250"
                     /old_locus_tag="Sfla_6501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region ATPase domain protein"
                     /protein_id="WP_014140658.1"
                     /db_xref="GI:503906664"
                     /db_xref="GeneID:11353678"
                     /translation="MTVTFTITPLGGRPAPREQDARHVADLRRLVRGRLTSWGLSHLA
                     DDAELIVSELLTNSLIHSGGTQVSLDVRIEDDRLRIEVGDGARRRPCAPAHPCDEAEN
                     GRGLEIVHFLVQARGGAWGLGPDGTHTWCTLAIGTGKGR"
     gene            47149..48498
                     /locus_tag="SFLA_RS32255"
                     /old_locus_tag="Sfla_6502"
                     /db_xref="GeneID:11353679"
     CDS             47149..48498
                     /locus_tag="SFLA_RS32255"
                     /old_locus_tag="Sfla_6502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="WP_014140659.1"
                     /db_xref="GI:503906665"
                     /db_xref="GeneID:11353679"
                     /translation="MASRNRTPNPALADLLDQAKLTRTQLAQRVNRLGPQAGLELTYD
                     RTAVAHWIAGTLPKPEVRPLIVEALSVRLGRPVTHAEAGLAPSAAGAGDNGTDTVEEL
                     LDLGRADMDPSRRGVLAYTLFSAALAVPAFAATAHAADEPVADGKATTRIGASQVASV
                     RSMTDRIADILDEFGAGHARPLAAAFLVNTVAPWLRAQASERVHADMLAAASDLTYLT
                     GWMAMYDKAHGLGQTYYVKALQLAREAQDHVTFCRTLRGMSLQASSLGHGPKSLELAD
                     AAAEAAPMAGPRLVAFLRGQQAHAASMVKDRPQSHARLRQAETALAKADNHRDAIGGY
                     DRTAYLFHVSHVLYEERDLPGSIRALKQSIKVQPVQERQGRVHAYGLLAQRQLEHGHL
                     DAACDSWTRFLDAYEHVSSARGDDHFATMRRRLAPHSKVRAVREMAPRVREVAALKA"
     gene            49001..>50311
                     /locus_tag="SFLA_RS32260"
                     /old_locus_tag="Sfla_6504"
                     /db_xref="GeneID:11353681"
     CDS             49001..>50311
                     /locus_tag="SFLA_RS32260"
                     /old_locus_tag="Sfla_6504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003963841.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826002.1"
                     /db_xref="GI:754215691"
                     /db_xref="GeneID:11353681"
                     /translation="MNIDDLTWQSRGLGGYPPVLVDLLVEQGHVELLVRAASRGAWSC
                     AKAAARELGKMAEFERAQGVLEPFVEVGWEPARWAAADLMLQAGRIQQALDWVRPEDA
                     DLASEHVCHDFAELLVKAGQVDDAIAVLTPRLDRGWLLSALVELTEGQSRDERVLDLL
                     APKAERARSARGEERWNLDASNAQDLQGQVLERAGRVDEAVRVLRADIAAGRFLVQNT
                     LTAYAELCQRNGRMDELRELGIGEHAHVGLPYYARALEDRGQADEAETVLRRFMAADE
                     WGRFRWPLIELLWRQGRIAEAVEVGRPTFDHHDACLLDGVIHLLSEAGRFDDALAILD
                     ERDAEYIDEHASWFHTNRIGLLGEAGRYEEALAYAKTLPTNVYELTSSTAWILEQSGR
                     VDEALGLLRAGADVEAWEVAALLIQHGRAEEAMDNMPSIAELRAA"
     gene            complement(50525..50806)
                     /locus_tag="SFLA_RS32265"
                     /old_locus_tag="Sfla_6505"
                     /db_xref="GeneID:11353682"
     CDS             complement(50525..50806)
                     /locus_tag="SFLA_RS32265"
                     /old_locus_tag="Sfla_6505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140661.1"
                     /db_xref="GI:503906667"
                     /db_xref="GeneID:11353682"
                     /translation="MRVRIALSVYTAITVAGLGLSVVSPAIAASASTSQRVTAVQAAE
                     SLDVHREKFMTLNGCQTAGQQGIDRGHWDRYQCAEGSAWPWVWNLWTNR"
     gene            51074..51925
                     /locus_tag="SFLA_RS32270"
                     /old_locus_tag="Sfla_6506"
                     /db_xref="GeneID:11353683"
     CDS             51074..51925
                     /locus_tag="SFLA_RS32270"
                     /old_locus_tag="Sfla_6506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="WP_014140662.1"
                     /db_xref="GI:503906668"
                     /db_xref="GeneID:11353683"
                     /translation="MTGQQPDPRAAARELGAALRSLQQQSGRPLRSLEAAVRVSDSSL
                     SRYFRGETVPPWPVVRDLCRALQADPVPFRVLWEKTENAAPVEHDDAANASPALRTAV
                     GGADLSHMSGAAWWQRWRGLPGRRRRGTGGLGVIAVVGAAGAVGAVSLLVLLLPSQTT
                     PGAATGTKDAKGDPSRSSRLGVVVHNVERACQRPRTTLCALSLAHSPYRPYNTANSAA
                     RVWHHDLLQATCFVANGVTVTDENLKHTSIWIRITHHEGQLWLPGIRLRPDHLTQVTT
                     VLPTCSQ"
     repeat_region   52170..52875
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=52231..52259
                     /rpt_unit_seq="gggaccatccccgcgggcgcggggagcac"
     gene            complement(52989..53417)
                     /locus_tag="SFLA_RS32275"
                     /old_locus_tag="Sfla_6507"
                     /db_xref="GeneID:11353684"
     CDS             complement(52989..53417)
                     /locus_tag="SFLA_RS32275"
                     /old_locus_tag="Sfla_6507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037659958.1"
                     /db_xref="GI:739808032"
                     /db_xref="GeneID:11353684"
                     /translation="MEPAERQERLRELAVWVDWLRTTFELHNSIPTCWYRHSPVVEHL
                     TALYAGWIRTYAGEQVPGRELAEVDWINALHALTPRLQLAACAAGQHEEPPPMPRERP
                     EAADDFETFLDTSRTTTEPARHPAEAELGRRRAENALTGR"
     gene            complement(53500..55170)
                     /locus_tag="SFLA_RS32280"
                     /old_locus_tag="Sfla_6508"
                     /db_xref="GeneID:11353685"
     CDS             complement(53500..55170)
                     /locus_tag="SFLA_RS32280"
                     /old_locus_tag="Sfla_6508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_037659979.1"
                     /db_xref="GI:739808053"
                     /db_xref="GeneID:11353685"
                     /translation="MDDNTLLAAYGIGAAAAVGGAVLLAAPAAAVLSGRGWAVRTDSI
                     PATVLKSLAQGPGAAFTPAPPNWLFYGLTVVFVLAVLILVVKAVSHFGSSGRTGGAQW
                     GGAEVERKLRAPEDPAERANRITAGRGMRTRKLVAAQPNISATVFGVPGSSKTTGLVL
                     PNAAEWQGPLVVTTTKAADLDIIHARRRCLGPVWVIAPAGIPGRPTHRWSPVDYCTDA
                     KAADRMASWMAEASSSGDSKRAAPWVDQAKSVLKGVLLAAQLSGGGVGAMRRWLGLGK
                     DAVDHVRAVLLQHGYQEVAEDYASPWLRLHEDGIGSIQFTLNVLARVYADEEVRETCA
                     GTDFTVEELLERNGTVCLIASEADAERFAPLLTSIIASIIHGAEVRYNSTGKPLDPSL
                     GVMVDEAGNMLRYPRLPNILTTGRGMGIDVLTVWHDLSQLRDRLGPQKANTVLSASGL
                     RMLLPGCGDLETLRYFSGLYGRTEVMKTSHGRSRGEYSTNTSSTETDLAPVHSLQQLP
                     DFTAIAQYSNQPPIKVRMRLTFRDKDLRKLLAGPGHDSGVPGKSASHG"
     gene            complement(55381..55971)
                     /locus_tag="SFLA_RS32285"
                     /old_locus_tag="Sfla_6509"
                     /db_xref="GeneID:11353686"
     CDS             complement(55381..55971)
                     /locus_tag="SFLA_RS32285"
                     /old_locus_tag="Sfla_6509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140665.1"
                     /db_xref="GI:503906671"
                     /db_xref="GeneID:11353686"
                     /translation="MTTSCCTSSGSAEAPPTWVESMGGPLIAVPASVLDGWGGCTMSG
                     MLISYGDVADDYDRACEIDGLAGVIGVGGRNAQGLVLADEPAMTCYLPQHRAFVRWGA
                     ADSEAELMVAAEAVLSDPTVKWGTYGVWETDGPAVLMDAATKGAELNIEDLNGGGMPE
                     QAPVRIPAGRWTVRAVHASVDEETCVGLVQLLPSSV"
     gene            complement(56118..57665)
                     /locus_tag="SFLA_RS32290"
                     /old_locus_tag="Sfla_6510"
                     /db_xref="GeneID:11353687"
     CDS             complement(56118..57665)
                     /locus_tag="SFLA_RS32290"
                     /old_locus_tag="Sfla_6510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014140666.1"
                     /db_xref="GI:503906672"
                     /db_xref="GeneID:11353687"
                     /translation="MGLLARRRATDTALDASGLGEATGIDVAHVPAPAGPTPAEQRDS
                     RRLEDAETVMRVAPRKGWPQPFAGRCASLPRTEVVRADTGNAAGAYPFLHAGSLPPVG
                     AYIGHNTLTTQAFSAHPAVWVREGLCTNPNVMITGIPGSGKSAHIKALCFRLMAFGHR
                     TLIAGDVKGEYAGLCRHLGVEPVRLGPGLPGRLNPLDAGPLGTGLDGIKDPAELRGRL
                     QEIHRRRLTLLKALLELQLRRTLESREEEALDVAVREVTGELYGQSRLAVPTLPLVYD
                     KLRDPTDVMAQELRVRDGEVQLAREQMVSIRSALGTMVNGHLGGLFDEQTSIGLDWDA
                     PIQSVDISALEQYGDETIAMVLSCVSSWAQAAIDRPGRRPWIVVRDELWRQMRSGGAA
                     MVRKIDADLRLSRATGTIQILATHRLSDFESVGAASSEAVAIAKDLISSCETRIQLAQ
                     DTRPLQITREAIGLSDAECDLIGSWGAGQRGRALWKVGRGGGHAVQLVLSHIEQKLFE
                     TDERMAV"
     gene            complement(57665..59188)
                     /locus_tag="SFLA_RS32295"
                     /old_locus_tag="Sfla_6511"
                     /db_xref="GeneID:11353688"
     CDS             complement(57665..59188)
                     /locus_tag="SFLA_RS32295"
                     /old_locus_tag="Sfla_6511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014140667.1"
                     /db_xref="GI:503906673"
                     /db_xref="GeneID:11353688"
                     /translation="MTQPVTYSGWQSEKSGFMGRLSGPGFALVAIGCTLLLVPLNLAS
                     WAAAALCVPLAVMLLVLAFGRVSGLSADEWILLAVRHQIAVARNQNVFVSGPFAPRST
                     RTDRQPMDLPGTLARLRILEAPDGLGGLLGVAHDPVAGTYTAVSRVSFPGLALVDTDK
                     QAARVSSWAALLRTFCTEDSPIVRLSVHQRCLPDDGAALRSWTAHHITPDAPPAAVSA
                     LSDLMEGAGPAATNRETYLSVTLSAGRARLAIKGAGGGQVGAAAVLVREIHALGGALS
                     TASLQVMEWLSPRKLAQSIRTAYDPDAQAAIATANAAAQKPGWEGVEEGVNPALAGPA
                     AADAGWGTYRHDGAWTVTYQVRTWPQAQVYATFLQPLLRPRRNARRSMSLVYEPLGPR
                     RARQELAREKSKRSSARYLRAKTGRDESEDERREADLARTQDAARAAGQGVVRMTAVL
                     SVTVTDLDELETACAELQADAAASALELRRMWGAQDVGFTAGALPLGQGLPDRRMGF"
     gene            complement(59185..60888)
                     /locus_tag="SFLA_RS32300"
                     /old_locus_tag="Sfla_6512"
                     /db_xref="GeneID:11353689"
     CDS             complement(59185..60888)
                     /locus_tag="SFLA_RS32300"
                     /old_locus_tag="Sfla_6512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037659977.1"
                     /db_xref="GI:739808051"
                     /db_xref="GeneID:11353689"
                     /translation="MAGIDTQGHWCVLDFGATDGDCGPAEAGDLPGTIGVCESADGNA
                     ARNCSETDRRQYENLRLDKWRKAYDQDQGNFDELNGYVTACVERGGLFQQCLQGGQNT
                     YPPDAKSPVSWAAGKISELASDALQEAARYIGKAVVWLLEEYAKIFNSSSTIDLSRTG
                     IDSATGVMTTLSLVIATFLLLLQFGKVAVSQRGEPAATAVIGLAKWGVVSSVYVLATQ
                     TALSWSDAVSTWIINYTFEGGGSGEADATEAMQHQLGTLFGGLITGGGGAATVGTALV
                     TGEGVAAAAVGVIIVVGIVCILAIAALWLEVLLRQAGIMILVATMPVVLAGQLSDSTQ
                     EWWPKARNALIALILMKPMIVLCFAIGFGAMAEGQGVQNMFVGLVIFILACFAWPVLA
                     KFMTFSTVGGGSAIASGLMSSVGSSAASAGGGYRPEMGGAGAVGGGSAYTRALEQDTA
                     QTAASGSHAAPVPGSGAGGSAAGGAGRSFGSKVFGTVALPLQLLAAGKDTLESGMAST
                     AGHAGLDHGAAGGRHVVIAQRSAAAASAHPPGARPEGAAAQSPAPVQPPPPALPPRDD
                     P"
     gene            complement(61055..61540)
                     /locus_tag="SFLA_RS32305"
                     /db_xref="GeneID:23391526"
     CDS             complement(61055..61540)
                     /locus_tag="SFLA_RS32305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037659975.1"
                     /db_xref="GI:739808049"
                     /db_xref="GeneID:23391526"
                     /translation="MSAVVHFWEEYAWMDDEKARQQLDVVTSPDATGYVDRQISEVRK
                     LREGAGLPVSGGTPAGITFTTMVDAVRMRSLTDDDLPRGDVVHIWLSFDRYATTPDRA
                     TDDNPVKGDTVDFIVKWQDGAWRITDEPAYVAQRTFPVAYDPDSPFAWRDQWIQVRHE
                     D"
     gene            complement(61851..62144)
                     /locus_tag="SFLA_RS32310"
                     /old_locus_tag="Sfla_6514"
                     /db_xref="GeneID:11353691"
     CDS             complement(61851..62144)
                     /locus_tag="SFLA_RS32310"
                     /old_locus_tag="Sfla_6514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037659972.1"
                     /db_xref="GI:739808046"
                     /db_xref="GeneID:11353691"
                     /translation="MQTLAADTPPIVPKPAPALPAAVNTQVQTVLNWTAGFGLAAAVI
                     GGLTGWLLVAVGHNTERAQLAARGKQSVLWSLCGAGGIGLTSSMVLAVYNMSI"
     gene            complement(62214..62555)
                     /locus_tag="SFLA_RS32315"
                     /db_xref="GeneID:23391527"
     CDS             complement(62214..62555)
                     /locus_tag="SFLA_RS32315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018100945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826004.1"
                     /db_xref="GI:754215694"
                     /db_xref="GeneID:23391527"
                     /translation="MQALQQAVMALHADGMPLRRTVVALVAQTDGRLPAVVRAGATML
                     SARTAAVVHLPHDPHIRSHGLRTVFRLRTRTRQAAGLLCREVLAAARASWGTPLPDAP
                     RPAPSAVVAPS"
     gene            63377..64450
                     /locus_tag="SFLA_RS32320"
                     /old_locus_tag="Sfla_6516"
                     /db_xref="GeneID:11353693"
     CDS             63377..64450
                     /locus_tag="SFLA_RS32320"
                     /old_locus_tag="Sfla_6516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_037659969.1"
                     /db_xref="GI:739808043"
                     /db_xref="GeneID:11353693"
                     /translation="MAVGGAVMTPVALGVGVVLLIAAFGEDDGEFGGGLGPTAGSLRV
                     GRGGVPSAYAPMILKAAADCEAGLQPAVLGAQLKQESNFDPQARSPGVGAQGIAQFMP
                     GTWPTWATDGNGNGTRSVWEPADAIAGQGRFMCSLMRKGRAHPKYDGSPTELALAGYN
                     AGWGRVDEYRGVPPAEFARGQTFHYVRNIMALAKQFTAPASSGEVRLPAGYTLPSGTP
                     REVRTAVAWALRQRGGWYRLGGDCTDAHGGDPAHWCDCSSLMQRAYGAAGVSIPRVTY
                     DQVNSGTRVSVDRPRPGDLVFNPGSDGSDARPGHVGMYIGDDMVIEAPRTGVRTRVVP
                     YSSWRDSTSAVTRVTEVRRVVPW"
     gene            64444..65037
                     /locus_tag="SFLA_RS32325"
                     /old_locus_tag="Sfla_6517"
                     /db_xref="GeneID:11353694"
     CDS             64444..65037
                     /locus_tag="SFLA_RS32325"
                     /old_locus_tag="Sfla_6517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140673.1"
                     /db_xref="GI:503906679"
                     /db_xref="GeneID:11353694"
                     /translation="MVTYETEGRPTPMPQNTAHEELYRPWGTVTPAFWDLRQQAEPER
                     TVVHVPQVLRGRLTAIAARAAGGRFPDAAWMAHQLDTEVTDEYGPEHLNTVHVREVRA
                     HLAYLAGDHAASLGWYLHTARLRATIQGPGHPDTEEATRRVYSLWRTVPDADAPALGV
                     ELLGTVTDIHGPEAAVARRTRRRLQALAASGDVRSIT"
     gene            65213..65593
                     /locus_tag="SFLA_RS32330"
                     /old_locus_tag="Sfla_6518"
                     /db_xref="GeneID:11353695"
     CDS             65213..65593
                     /locus_tag="SFLA_RS32330"
                     /old_locus_tag="Sfla_6518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140674.1"
                     /db_xref="GI:503906680"
                     /db_xref="GeneID:11353695"
                     /translation="MNALDDNLASRDPSTVLAGAWDALDLGARVADAITWEETSDELL
                     ALTAAQECSAARALLPLPGTGRPVPLEASEIQAGPGGLAPYAGLLERTYRALAGLAEQ
                     DVQLSEAAEHAAAAARSLAAVRGQ"
     gene            65593..67155
                     /locus_tag="SFLA_RS32335"
                     /old_locus_tag="Sfla_6519"
                     /db_xref="GeneID:11353696"
     CDS             65593..67155
                     /locus_tag="SFLA_RS32335"
                     /old_locus_tag="Sfla_6519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140675.1"
                     /db_xref="GI:503906681"
                     /db_xref="GeneID:11353696"
                     /translation="MATLDELFDAAGARLRTAAGTPSSDRSASARDLDLFLSALTEPL
                     DLRDGLGTEDVPRSPVTNDLVYHLRRASDALRSAQRLLPSPGGGPAEGNLPEASAAVH
                     AVRDVIESHRGPDRVPLSAYAYALTTGPAHHYLTRRCAELAWGATQVASALARDSLDP
                     SAAAAFGDVHRFLSEASVFGREGTRDADAAIGALSLTLPVAPVQARSTDRTRDVPANL
                     AEDCDRLSRAAFETLHHRSDHRMSGSDLQQLARWTAIQRLLAGRVLLRAAEELPDEAA
                     AALRDSAGALRGSAQAWQKSATAWHRIVDIADPRSHPKLPPPSYEIVRRGEVVRLPQV
                     VPHPATVIAHTAAVRVGQLLYGPEWRPETATRPEPRAGSEVLADARGTGALASALYRL
                     PAAGWQLALAAPQAVSLARGGLVTDVFEQQAPGRENHRFRPVNPYQLEALSHPYKAVL
                     PAEQASAASLLEVAGQAGVSVPRALLDAAAHRTLAAGQGWGQARKAVRSGQSGFQAQQ
                     PQVRARQRPRSL"
     gene            67498..68571
                     /locus_tag="SFLA_RS32340"
                     /old_locus_tag="Sfla_6521"
                     /db_xref="GeneID:11353698"
     CDS             67498..68571
                     /locus_tag="SFLA_RS32340"
                     /old_locus_tag="Sfla_6521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014140676.1"
                     /db_xref="GI:503906682"
                     /db_xref="GeneID:11353698"
                     /translation="MGTVLLDEKWPVLGRHEQAAGWLQVWSDLGRAPRTIDAYARGLA
                     EYLEMCERENVDPLTANRAHIAVYVRELTSRPSRRGANVVSIDSGSGLANATIQQRLV
                     PVRLFYDFLMEDGQRDSNPVGRGRYTPGRRHRGGHERGLVPRLTKMPWIPAEQQWLDI
                     LAVAAAEPVRNRVMLALAYDAALRREELCSLRTDDLDPAHRTLRVRAETTKNRLERVV
                     PYSAPTGVLLSGYLAHRATVSRARGPLFLSESRRNHAQPLSLWTWSKVVRRIALAADV
                     PRFSTHTTRHLCLTDLARMGWELHAIATFAGHRHTDSTLTYIHLSGRDLADKLSRGME
                     QIHGWRVQMLARLGEQATGTVAL"
     gene            68997..>70886
                     /locus_tag="SFLA_RS32345"
                     /db_xref="GeneID:23391528"
     CDS             68997..>70886
                     /locus_tag="SFLA_RS32345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140677.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041826006.1"
                     /db_xref="GI:754215696"
                     /db_xref="GeneID:23391528"
                     /translation="MAAFAYLLGDFTDFHRIGGFIRRSLAWRVFGQEPVEETIAQVAA
                     TLQGWGYHPSNGAFGQFRTVLVQIMLINRSPLLQDMTTDALQRARESPALPSGARRGN
                     LHGVHRAIAALGHAGPPPKPIHAVMPDLEGVPEPWAAMVERWHDTSTLTPKVRGGFRS
                     IVAKAGRWLAAEHPEIVEPGQWTRETCAAWVAALDRMTVGEHVQRRAGLDKRGGKPLS
                     PRTKAGYLTATRTFFRDCQEWEWIPRRFDPVRALATPRSVAALIGPNPRVIADDIWAK
                     LLWAGLNVDPEDFPTNTYGLCYPIELIRAVTLTWLFGGLRSDEISRLRTGCIRWQHDG
                     FPIPGDSDEVLARDAVCLLDVPTHKTGTSFTKPIDPLLGKAIEAWQDARPQQPKMLDR
                     KTGEQVDFLFAHRAKRLANTYINTAVIPSLCRKAGVPTADVRGNITSHRARSTIASQL
                     YNAKEPMTLFELQAWLGHRSPESTQHYAKITPNTLARAYNDAGYFERNVRTIEVLVDR
                     DAVTSGAAASGEPWQYYDLGHGFCTYTFFEQCPHRMACARCDFYTPKATSKGQLLEAK
                     DNLQRMLASVPLSDEERAAVDDGQAALDQLLERLVDVPTPAGATPREIGAPATATLLP
                     IVAVNQ"
     gene            complement(70912..71634)
                     /locus_tag="SFLA_RS32350"
                     /old_locus_tag="Sfla_6523"
                     /db_xref="GeneID:11353700"
     CDS             complement(70912..71634)
                     /locus_tag="SFLA_RS32350"
                     /old_locus_tag="Sfla_6523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_014140678.1"
                     /db_xref="GI:503906684"
                     /db_xref="GeneID:11353700"
                     /translation="MSIDPLLARARGLWEELASVPVSFASTGGVRVVVSPESRMCPSG
                     WVGVVVLGNSAIVTAPSQDTAKTVRDALAKLPVGALAGAHSVRGVLPVARVLGPAALA
                     YVSDNGFRPVADRRLTVQLVPGEHPDLRELENLAGADDSDEAGLNEITSPAFVIRERG
                     QIVAAAGYRSWPSRTAHVSVLTAPAWQGRGLARATGSGAVAHALTAGLLPQWRARVPA
                     SRRVALALGFRELGAQLSVELA"
     gene            71790..>72101
                     /locus_tag="SFLA_RS32355"
                     /db_xref="GeneID:23391529"
     CDS             71790..>72101
                     /locus_tag="SFLA_RS32355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014173837.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041826008.1"
                     /db_xref="GI:754215698"
                     /db_xref="GeneID:23391529"
                     /translation="MCDDLADADLRREINDGLQVVENWNSANHGLFYGKDGDLTGSAK
                     ESQEVSMLALHLLQSALVHVTPLLLQDILAKEKWQMKLTDADRRALSPLFWTHVNPYG
                     RF"
     gene            complement(72293..72682)
                     /locus_tag="SFLA_RS32360"
                     /old_locus_tag="Sfla_6525"
                     /db_xref="GeneID:11353702"
     CDS             complement(72293..72682)
                     /locus_tag="SFLA_RS32360"
                     /old_locus_tag="Sfla_6525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140679.1"
                     /db_xref="GI:503906685"
                     /db_xref="GeneID:11353702"
                     /translation="MSSPQVITPADKLAEAKEQLNFPRIVAICGSTRFMAEMAEADVR
                     ETKAGRIVVKPGCDLKSPHELWSDPVAAEALKIQLDELHRSKILLADEVLVVGDYIGD
                     STTSEIAYARSLGRPVRFTHPEVDPDA"
     gene            complement(73039..73338)
                     /locus_tag="SFLA_RS32365"
                     /old_locus_tag="Sfla_6526"
                     /db_xref="GeneID:11353703"
     CDS             complement(73039..73338)
                     /locus_tag="SFLA_RS32365"
                     /old_locus_tag="Sfla_6526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017562604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140680.1"
                     /db_xref="GI:503906686"
                     /db_xref="GeneID:11353703"
                     /translation="MVGAIRGQARSAGEAFGLASHVRGGRWEHWGELPFGYDVALLEA
                     CSQAAPSTAARLHHEFSRDLDASAGRAGDWSRSGGACRLAAGVITGGQLCVTAVI"
     gene            74387..>74959
                     /locus_tag="SFLA_RS32370"
                     /old_locus_tag="Sfla_6527"
                     /db_xref="GeneID:11353704"
     CDS             74387..>74959
                     /locus_tag="SFLA_RS32370"
                     /old_locus_tag="Sfla_6527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580421.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_014140681.1"
                     /db_xref="GI:503906687"
                     /db_xref="GeneID:11353704"
                     /translation="MTQPTTPPPALLAWASRELGARPAVKDVSHPRESSRVWRLDLPG
                     AVRFYLKISPKAVMYERETLALRSAAPALGAGAAPQLRASSAEDLALLLTAVPGRPLK
                     HLKLSPVEEARAHRHGGALLARLHAASDLSGTRRADAEQALQTAADNAEGHLAAAGDR
                     LTAPEQKLVRQLAEELRALPPLAPAYIHGDA"
     gene            complement(75063..75830)
                     /locus_tag="SFLA_RS32375"
                     /old_locus_tag="Sfla_6528"
                     /db_xref="GeneID:11353705"
     CDS             complement(75063..75830)
                     /locus_tag="SFLA_RS32375"
                     /old_locus_tag="Sfla_6528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014140682.1"
                     /db_xref="GI:503906688"
                     /db_xref="GeneID:11353705"
                     /translation="MNPTYDFTGQVAFVTGASSGMGLATARAFAASGAAVALADINED
                     AVNAAAKQLADDGHQALALVCDVTDEHQVAAAVDRTVEAFGRLDMAYNNAGIMPAPTD
                     AADESADQFDRVQNINLRGIWAAMKHELRHMRTQGSGAIVNCSSLGGLVGNPGRAAYH
                     ASKHGVIGLTKSAALEYGSRGVRINAVCPGTISTPMVDAMIEGGELDRSQAEGGQAID
                     RLGTADEIAQAVLWLCSDGASYVTGIALPVDGGYVAQ"
     gene            complement(75889..76656)
                     /locus_tag="SFLA_RS32380"
                     /old_locus_tag="Sfla_6529"
                     /db_xref="GeneID:11353706"
     CDS             complement(75889..76656)
                     /locus_tag="SFLA_RS32380"
                     /old_locus_tag="Sfla_6529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014140683.1"
                     /db_xref="GI:503906689"
                     /db_xref="GeneID:11353706"
                     /translation="MTVTYDFHGKSAFVTGAASGIGRTTALAFARAGAQVALVDRSAE
                     GLRETARLLEADGGKALALTCDVTSEEDVQAAVDQTVERFGSLDAAFNNAGVEQPVQS
                     AADTAKDDWDRILGVSLTGAFLCTRAQVRQMLRQAGGGAIVNVSSGAGVKGFKGQAAY
                     AAAKHGVIGFTRSAALDHAAAGIRINALCPGIIDTEMIRRFGDSRPGGRAGLIADEPV
                     GRLGKPEEIASAVLWLCSDDAAFTTGTALVVDGGQTV"
     gene            complement(<76797..77954)
                     /locus_tag="SFLA_RS32385"
                     /old_locus_tag="Sfla_6530"
                     /db_xref="GeneID:11353707"
     CDS             complement(<76797..77954)
                     /locus_tag="SFLA_RS32385"
                     /old_locus_tag="Sfla_6530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140684.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_037659966.1"
                     /db_xref="GI:739808040"
                     /db_xref="GeneID:11353707"
                     /translation="MSSATGSAPGKLPFVVWVLATGTFLMGTTEFVIAGLLPEMAADL
                     TVSVSHAGLLITAFAVGMIIGGPTMAMATLRLPQRHTLIGALAVFALGHAVAALSTSF
                     TVVLTARVVTALATGAFWAVGFVIATTTAGPASATRAVGVMMGGLTLANVVGVPIGSF
                     VGQYTGWRGPFWALAVLAALAAAFVGRFIPRTDQEAQVSVRAEVRALKQGRLWLALGA
                     AVLIMGGVLATYTYITPLLTDRAGIPAGAVPLVLIAFGIGALGGTAIGGRLGDRRPMV
                     TTITASAATSLILLALIPASSSPVAAVVLVFGMALAGFTVNPVVTSLAVRFAGDAPTL
                     TSALTTSGYNTGIAAGSLAAGRALDSSLGLTGPALVGAVFAALTLLPLIALA"
     gene            complement(77996..78532)
                     /locus_tag="SFLA_RS32390"
                     /old_locus_tag="Sfla_6531"
                     /db_xref="GeneID:11353708"
     CDS             complement(77996..78532)
                     /locus_tag="SFLA_RS32390"
                     /old_locus_tag="Sfla_6531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140685.1"
                     /db_xref="GI:503906691"
                     /db_xref="GeneID:11353708"
                     /translation="MTAFSLRRSLTATAATGVLLLAATACSDDSSAEQTTASASSSAL
                     ATTPASASASPTWPDRSTPMDIRVTIDGQEVEATLNGSPAARDLASLLPLTLDLEDFH
                     GTERITDPPRKLTTENAPEPQAPKTGDLTYYAPWGNLAIFYKDGPSASEDLLVLGHID
                     ADADQLSGAGRITIEAAS"
     gene            complement(78529..79212)
                     /locus_tag="SFLA_RS32395"
                     /old_locus_tag="Sfla_6532"
                     /db_xref="GeneID:11353709"
     CDS             complement(78529..79212)
                     /locus_tag="SFLA_RS32395"
                     /old_locus_tag="Sfla_6532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014140686.1"
                     /db_xref="GI:503906692"
                     /db_xref="GeneID:11353709"
                     /translation="MTTFALVGAGPGLGLAAARRFGQAGHRVALLSRSAQHQDNLAAE
                     LARDNIHARGFTADVLDPASLTAALQEAADTLGPVEILQFSPVPRGDFMKPVLDTTAA
                     DLDDPLAFSVKGPLTCVNAVLPGMRELGRGTLLFVNGGSAVRPKASVAGTSIAFAAES
                     AYAAMLHTALADENIHAAQLIVPGAISPDSATSSPEKLAELLYGLHTGRKGFRHYAEP
                     MPDPQDGTP"
     gene            complement(79287..79697)
                     /locus_tag="SFLA_RS32400"
                     /old_locus_tag="Sfla_6533"
                     /db_xref="GeneID:11353710"
     CDS             complement(79287..79697)
                     /locus_tag="SFLA_RS32400"
                     /old_locus_tag="Sfla_6533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_014140687.1"
                     /db_xref="GI:503906693"
                     /db_xref="GeneID:11353710"
                     /translation="MQITRSSIDTIKGPADWFTGDVYIDAVAAAPAPSRVTANLVHFM
                     PGARTYWHRHPLGQTVFVTEGVGLCQRRGGPVEVIRPGDRVLFEADEEHWHGAAPNRL
                     MVHLAVNEGDDDHAVVHWLNPVTDEEYTATPATG"
     gene            complement(79732..80748)
                     /locus_tag="SFLA_RS32405"
                     /old_locus_tag="Sfla_6534"
                     /db_xref="GeneID:11353711"
     CDS             complement(79732..80748)
                     /locus_tag="SFLA_RS32405"
                     /old_locus_tag="Sfla_6534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019981991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_014140688.1"
                     /db_xref="GI:503906694"
                     /db_xref="GeneID:11353711"
                     /translation="MRGAVIYAPGDIRFEAVDDAKILKPTDAVIRTAVTCVCGSDLWP
                     YRGAEPTEHAHPMGHEYVGFVEEVGSEVTSVKPGQFVVGSFATSDNTCANCRNGFQSN
                     CLNREFMSTCQAEYVRIPNAQGTLVATEDVPGEDLWPGLLAVSDVMGTGWWAADAAEV
                     RPGSTAVVVGDGAVGLCGVIAAKELGAERIIAMSRHASRQKLAREFGATDIVTERGEE
                     GVARIKELTGGIGADSVLECVGTAQAMSQALHSARPGGNVGFVGVPHEVAVDGQELFF
                     SHVGLRGGPAPVRRYLPDLIDRVLSGRIDPGKVFDLTLPLDQVAEGYKAMDERRAIKT
                     LLTP"
     gene            81013..81909
                     /locus_tag="SFLA_RS32410"
                     /old_locus_tag="Sfla_6535"
                     /db_xref="GeneID:11353712"
     CDS             81013..81909
                     /locus_tag="SFLA_RS32410"
                     /old_locus_tag="Sfla_6535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014140689.1"
                     /db_xref="GI:503906695"
                     /db_xref="GeneID:11353712"
                     /translation="MDNREEVREFLTSRRAKITPEQAGLPAGPRRRVPGLRRSEVAAL
                     ADMSVEYYAKLERGNLAGVSPSVLEALARALQLDDAERAHLLNLAQAADGSDVLNRPR
                     RRRTKDQWRPHRSLQWTLDAITAGPAFVRNGRMDILAANPLARAFYGDVYATPGNQAN
                     LARFNFLDPASRRFYPDWDLFADVAVAILRTEAGRNPHDKDLHDLVGELSTRSEEFRT
                     RWGAHNVRHHGTGTKRFHHSAVGELTLAFEGLEMAAEPGLTLTIYTAEPGSPSEEGLR
                     LLASWAATQNSDSPSTTENAGR"
     gene            complement(82043..82480)
                     /locus_tag="SFLA_RS32415"
                     /old_locus_tag="Sfla_6536"
                     /db_xref="GeneID:11353713"
     CDS             complement(82043..82480)
                     /locus_tag="SFLA_RS32415"
                     /old_locus_tag="Sfla_6536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140690.1"
                     /db_xref="GI:503906696"
                     /db_xref="GeneID:11353713"
                     /translation="MTRKSRDREAERQHIRAAAERLLAGTPLRSPVGKLTGTELIAEC
                     GLRRDVVYGDHKELVDEFRARAKAQNFTPQVVQSMADENIVLREALAKIKAELAAERE
                     RVRALVRAATELSLELEQAREELAAAQQVTWLPGPRETRRVPD"
     gene            complement(<82534..84510)
                     /locus_tag="SFLA_RS32420"
                     /old_locus_tag="Sfla_6537"
                     /db_xref="GeneID:11353714"
     CDS             complement(<82534..84510)
                     /locus_tag="SFLA_RS32420"
                     /old_locus_tag="Sfla_6537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017562571.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826010.1"
                     /db_xref="GI:754215701"
                     /db_xref="GeneID:11353714"
                     /translation="MSKVGDRVWSLAEAQPDQHTQSIMLHWSTYPNLLEYDFRLFILA
                     TLDSPYPPALGRFTGIDQASVSTVSNWFKRLRVFATWLRHRGIDRLYEVSDRDLDLYL
                     DHVRSIQASTGTRRQLLSAVRAVWAYAQYLPPECRMSVAEPWQGRSPGELAEDIQTGR
                     GNKTARIAVDTMIPLLDWALRIVEDIGPDVRDAWREFRQLYTGTHPGQARFAGLPRTE
                     RLNLFLRDAHRTGAALPGDPENPGAIDYKYLACLLGLPVLSNSLGLGPRSIAEASGIP
                     VAGDFFIGSVTGQVDGRPWRDKPITASELPELVWVVTAACFVIVSYLSGMRPGEVSNL
                     RRGCRAEDPDSGELLVLGHRGKGHNRTAAESHRPASRPWAVVRPVHQAIDLLETLHAT
                     DLLFPTRLPGSSGRKSRRMGTLTWGSSKTIRELQRLQDWVNSTFTPTEGGVAIPPDPI
                     KHLHASRFRRTLAYFIVRRPRGLIAAALQYGHLKTKVTLNYAATGDDSWLDDVAVERL
                     EMVLEQSEDDWTRLDEDNEHVSGPAAAEYRRRTAGAATFLGRTVRAQASVKRLLEQSD
                     TDIHHGEAMTCVHRAETAECRKEKLLLGLPADDGPDESLCHSTCANLAYTDRDIADHR
                     MRLLVLETEARDPMTPRPRRDRAAAKAAQICAVIE"
     gene            complement(84618..86513)
                     /locus_tag="SFLA_RS32425"
                     /old_locus_tag="Sfla_6538"
                     /db_xref="GeneID:11353715"
     CDS             complement(84618..86513)
                     /locus_tag="SFLA_RS32425"
                     /old_locus_tag="Sfla_6538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009712660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030639074.1"
                     /db_xref="GI:664101401"
                     /db_xref="GeneID:11353715"
                     /translation="MSAGGRGGRQAGMPPSDWRPPERLLEASGGTAVRVIEESGARSR
                     VFDFANIRDPKGKRVLIDEGLQRWFASAFAERTSPRSGVKRVRGAESLYSVLSWLARY
                     FSVQSPTVREPGDVTEAHVLELWTHTEGRNAASQCTHLHRLRQLWRDDKKLSKEVRDA
                     LYKERMPEVTEISDVPEYDDDAMQRIMVALRHDIRVARDRIRAGQHLLARYRAGQIRS
                     GHPDHELGMLLDVFERTGDLPRTPGGTMVSVVWKLGGSQEITRRLCLSSRELTAFGLL
                     LTALTAENFGTVAAWPAAHYRPDGGVEGVPQIALIEASKPRRGPEREHMVTPVEDVPE
                     ELAVLLVADDPEPRLFRSPLRVYQLLLDLTQLARRHGGHSSAFAGFRTQTSGAKRWTR
                     GADAKNIARWSVQHGFPTKEPTKDGVEPVEARRLRQTGIERKRRPVAHSRSTMNDHYL
                     ARSQDVATQSRVVVADALRSQVAAARKRRSIAVLPAALVARAASDLEGAARDAELDPT
                     VLRRLVSGEQDTVLAGCTDHLNSPGAPPGEPCAESFLACLGCENARALPHQLPLQIAA
                     LDQMSILKVHTDVATWNARHAVHHERLQDLVGQYHQSEQDLARRRLTGRQSEMINDLM
                     AGRMDLR"
     gene            complement(<86585..88078)
                     /locus_tag="SFLA_RS32430"
                     /old_locus_tag="Sfla_6539"
                     /db_xref="GeneID:11353716"
     CDS             complement(<86585..88078)
                     /locus_tag="SFLA_RS32430"
                     /old_locus_tag="Sfla_6539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140693.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_037659964.1"
                     /db_xref="GI:739808038"
                     /db_xref="GeneID:11353716"
                     /translation="MRDRWSVEFYDFLKPPPSLGEVMLGGFGDLHDRAARNGAQHGTP
                     VLFTVSGFADPGVNLFFRVSPMKGRGARTWKRYAYTLVVWLNFLQVFGKGWREATARD
                     VEAFKDWRLTDVRNDDRIKAASFDTDRAALNTFYTWAFGKYGVQNPVSGIAPASNSGS
                     RPEQGIGPGGERRDGLRPAGSRGRKVKWMLRAPFEQWRDIGLRGYGFDGLRRTGWSGP
                     NEDRDAVFVDGLYGTGLRLQEWGSVLDVEMPRSAGGRLPRAWLAAACVKGAKEGRWYR
                     MPRAVLREIEGYTDPLEGSRTQAIRRAQRRGAYEKIPYRRVVSGYNARSRLLYLESGG
                     SLSVDVLGPDERRLLFRRTTTGLEPLALWLSPNGMPKKFEGWEDTFTAANERIQRVWV
                     QAGGEGLVPLWCRPHMCRHSFALKWYSLLSTVWQPQLDGFTEQELLDIREMFGGVWYA
                     LSLMLGHADPSTTRETYLEPFTALQVDYLMELLDSEETQAVEALIRTV"
     gene            88197..88493
                     /locus_tag="SFLA_RS32435"
                     /db_xref="GeneID:23391530"
     CDS             88197..88493
                     /locus_tag="SFLA_RS32435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020131483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825971.1"
                     /db_xref="GI:754215654"
                     /db_xref="GeneID:23391530"
                     /translation="MIDLERSESGPAVRDLVRLSDAWADRPDLRDAFLAGYGRSLLPA
                     EQARFVIDAALDSVSGISYGLAHGDPELVERGQRTLARLRAEHAARVTPAGEAT"
     gene            88490..89521
                     /locus_tag="SFLA_RS32440"
                     /old_locus_tag="Sfla_6541"
                     /db_xref="GeneID:11353718"
     CDS             88490..89521
                     /locus_tag="SFLA_RS32440"
                     /old_locus_tag="Sfla_6541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_014140694.1"
                     /db_xref="GI:503906700"
                     /db_xref="GeneID:11353718"
                     /translation="MNPDTKTAAASNGFGGSASVRAATAGDAEAICRMRSAYVLSAPL
                     ADEWLRHGAADLAPRLTSTGDARAFVIDAPDGTLAACALGLVSPVLPAPSYPRGLSAR
                     VQLVATHPHHRRRGYARAVVSALLDRLVDEDVTLFELHTSPEAAPLYREFGFSGSAAL
                     MRMTRRSTSAPPSTATGSRSSPVPPEQHAQSLPPSVAFVCLYVTDEDDRPLGLHSVYS
                     PSHPWHMIGGALDLGETPWAAAVRECREETGLTIAGPPRLLASVYGPPRDRRPYSTVQ
                     FVFDGGRLGEDQIARIVLAPDEHDEARFLPLEQWQELMPASDFARLRSVSEARRTGVA
                     AYLDTWGTT"
     gene            complement(90185..91702)
                     /locus_tag="SFLA_RS32445"
                     /old_locus_tag="Sfla_6543"
                     /db_xref="GeneID:11353720"
     CDS             complement(90185..91702)
                     /locus_tag="SFLA_RS32445"
                     /old_locus_tag="Sfla_6543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140695.1"
                     /db_xref="GI:503906701"
                     /db_xref="GeneID:11353720"
                     /translation="MNHVLCGLAANVSLPAELVDRLIAVADAEIAADLAHRAGLSHAQ
                     AVVLASRVEESAVSLAYAGLLTAADVDPATQPDVALALLAERSGRPEWGRLLAEDPVV
                     ERREKLAACSGLPLDVVEMLATDSDVQVVAALALGTTPETATRLAAHPHAEVRRAVAA
                     NEATPPAVLAALLTGEGQPPAQWCLVCDREEAPFMHDPQCSRLDCDLLSGASCDGSHE
                     STRHDMQQMAIRNPATPTEAVVDFVGHPSLLLRWALAGRPDLPSEVCAQLAVDSNPGV
                     RADLAENPAIDEALIRVLATDRDHEVRRRLAHNPLVPLDVLTHLAGATKIGATLLPRI
                     ASASPDEVEKLAESPNPAARMLVAQRRNLPPATRDALAADSDAKVLKSIAPHPGLSEG
                     QLRTMLDRHGVRVVAKVASNPDAAPALLEDLARHAPSVQKAFREIARHRNASAPALLA
                     CLADAQARRIAASHAALPPPLIEELLTDADWQVVEAAAANPSLPLAVMSELTSRL"
     gene            complement(91759..92019)
                     /locus_tag="SFLA_RS32450"
                     /old_locus_tag="Sfla_6544"
                     /db_xref="GeneID:11353721"
     CDS             complement(91759..92019)
                     /locus_tag="SFLA_RS32450"
                     /old_locus_tag="Sfla_6544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018845186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037659954.1"
                     /db_xref="GI:739808028"
                     /db_xref="GeneID:11353721"
                     /translation="MSYDLAVWAGDRPLDNHQAGSTYDELYERYLESDEVVVPPVPDI
                     RAYVEALSESSSEAAANVVPLQPKGDEQTGTSERRSGPPLYR"
     gene            92279..92623
                     /locus_tag="SFLA_RS32455"
                     /old_locus_tag="Sfla_6545"
                     /db_xref="GeneID:11353722"
     CDS             92279..92623
                     /locus_tag="SFLA_RS32455"
                     /old_locus_tag="Sfla_6545"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140697.1"
                     /db_xref="GI:503906703"
                     /db_xref="GeneID:11353722"
                     /translation="MYRALRLLAVGVTALAMAVSLDVPAHAAASACTHHLSGPRVCIS
                     VTGSSGSANPGRVHTARTNQPRCSTTATVHITEPGGQTYTLTDRRHGGRLVASFAPGI
                     QTDGKLCARYQG"
     gene            complement(92953..93165)
                     /locus_tag="SFLA_RS32460"
                     /old_locus_tag="Sfla_6546"
                     /db_xref="GeneID:11353723"
     CDS             complement(92953..93165)
                     /locus_tag="SFLA_RS32460"
                     /old_locus_tag="Sfla_6546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140698.1"
                     /db_xref="GI:503906704"
                     /db_xref="GeneID:11353723"
                     /translation="MSVRDLPPARELTEYQRRGWSCVWCHAVLDATRAVDLGQQRVKP
                     DEGAAYSWFPRACADKAGCAERETAK"
     gene            complement(93274..94458)
                     /locus_tag="SFLA_RS32465"
                     /old_locus_tag="Sfla_6547"
                     /db_xref="GeneID:11353724"
     CDS             complement(93274..94458)
                     /locus_tag="SFLA_RS32465"
                     /old_locus_tag="Sfla_6547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014140699.1"
                     /db_xref="GI:503906705"
                     /db_xref="GeneID:11353724"
                     /translation="MPRLDDDATGTRIKEQRRLARLTQRELADRLPYSYSLLNQVECG
                     AKPANLDFVAAVARALHVDVTVLTGQPYVTELQQDRLAELVRPIREALDLYDLGIDDS
                     IPDRPHAQLVAGADHLCAQVRATHLRNAARVLPATIAELTTAAWRTQSTELWQALAST
                     YRTAHDIAVKLGYYDLSSVALDRMDWAAQRASDPCLAAIRQYMRAMGHFREGGNAIGL
                     RLIAAGHGVVGATEQTREALAVTGQLHLGASVIAARAGDQTAVDAHIAEAEHCAEQVG
                     DASEIHWLSFGPTNVDLHRMSAAVEMRHYGDALEQAGQVFLPGSLATSRRAHFLIDRA
                     RSEMETGRTEAALGSIVEARQAAPEQTRYHPGARETIKGLVHASRRAPHSLGGMAAWI
                     GL"
     gene            94724..95113
                     /locus_tag="SFLA_RS32470"
                     /db_xref="GeneID:23391531"
     CDS             94724..95113
                     /locus_tag="SFLA_RS32470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="WP_037659962.1"
                     /db_xref="GI:739808036"
                     /db_xref="GeneID:23391531"
                     /translation="MEELTRHPVRSEYKMPCEPDAWPSADVILFAPATFNSVNHWALG
                     LTDRFVIGVVAEAVGKRIPVVAMPCLNAAYVQHRAFGRSVAELREMGVTVLYGEGGFV
                     PNRPGDKVPFPWHLALAAVESIVSRRP"
     gene            95434..95880
                     /locus_tag="SFLA_RS32475"
                     /old_locus_tag="Sfla_6549"
                     /db_xref="GeneID:11353726"
     CDS             95434..95880
                     /locus_tag="SFLA_RS32475"
                     /old_locus_tag="Sfla_6549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140701.1"
                     /db_xref="GI:503906707"
                     /db_xref="GeneID:11353726"
                     /translation="MHALFDQPEVRRVSRGEYPLWDEALAVLNQDLAVTLPEQGPLQL
                     LAQPSYEAGEPEYVYVALANGEWHGSHLYPKTAEDSAHALAIVADAAQESVAERLWQA
                     WPLCVEHNLGMHTRDVEGLLSWWCAGRRSGGRPGHICAAVGALDTF"
     gene            96343..97272
                     /locus_tag="SFLA_RS32480"
                     /old_locus_tag="Sfla_6550"
                     /db_xref="GeneID:11353727"
     CDS             96343..97272
                     /locus_tag="SFLA_RS32480"
                     /old_locus_tag="Sfla_6550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosylglycohydrolase"
                     /protein_id="WP_014140702.1"
                     /db_xref="GI:503906708"
                     /db_xref="GeneID:11353727"
                     /translation="MKRIQRVTGAVVGAAVGDALGGPFEFGPPGAFSARFSAPGAGGE
                     MSGGGGWDPGEATDDTQMAVLVAESLLEQGGLDLPDIFGRFQRWAASEPKDIGLQTED
                     VLTNGMPWDLAAAIHFQVNQRAAGNGSLMRASTSAVHFAAAGQEATMDAARRIAALTH
                     GDRAAWEGTAIFHELIRVTFEDTDPVAALPDILAHVHPDHRSRYATVLAPDWHPDQAT
                     EFNGAVWPCLGSAVWALRTTTSFEDAIRAAIDLGGDTDTVAAVAGGLAGAYYGLDAIP
                     ARWAQPVHVPLPGFDGRVLHLADLLLLAHRLGG"
     gene            complement(98314..98715)
                     /locus_tag="SFLA_RS32485"
                     /db_xref="GeneID:23391532"
     CDS             complement(98314..98715)
                     /locus_tag="SFLA_RS32485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018958383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825974.1"
                     /db_xref="GI:754215657"
                     /db_xref="GeneID:23391532"
                     /translation="MVRRHELSDEEWDVLSGLLPRTETGRPRWDDRVVLNGIVWKLRT
                     GSAWRDVPERYGSWRTLYTRFRRWALDGTFTRMLEAVQAQKDAAGDVDWLVSVDSTIT
                     RAHQHAAGARKKGQALQKRHTLTPSDDPVAD"
     gene            complement(<98831..>99031)
                     /locus_tag="SFLA_RS32490"
                     /db_xref="GeneID:23391533"
     CDS             complement(<98831..>99031)
                     /locus_tag="SFLA_RS32490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008742114.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_037660142.1"
                     /db_xref="GI:739808216"
                     /db_xref="GeneID:23391533"
                     /translation="NASQEYGPVVLALLGSVPDLAESLLHAFEAAADDLAAADYADGC
                     PIGPVALEVASSNDVWRIATEVF"
     gene            complement(99145..>100084)
                     /locus_tag="SFLA_RS32495"
                     /note="aldehyde dehydrogenase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391534"
     gene            complement(100085..101068)
                     /locus_tag="SFLA_RS32500"
                     /old_locus_tag="Sfla_6554"
                     /db_xref="GeneID:11353731"
     CDS             complement(100085..101068)
                     /locus_tag="SFLA_RS32500"
                     /old_locus_tag="Sfla_6554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140703.1"
                     /db_xref="GI:503906709"
                     /db_xref="GeneID:11353731"
                     /translation="MSHRNARLTVHGRRLLIQRVRSGRPVAHMAEEMGISRATAHKWV
                     RRWQAEGDPGLFDRSSRPRTTPHRTAPETEAAVCDLRQTRKLGPARIGPILGLPASTV
                     HRILTRHGLNRLAWLDRPTGEPIRRYERSRPGELVHVDIKKLGNIPDGGGWRAVGRTA
                     GNQNRQNTTDLRKSCKPVIGYSYIHSAVDDHSRLAYSEVLADERQHTAIGFWQRAHAF
                     FMGHGVTVERVMTDNGSCYKSRLFTQALTTHGIAHKRIRPYRPQTNGKVERFNRTLLD
                     EWAYLRPYTSNDERTEALADFLHTYNHHRCHTALGGLPPVSRVNNASGQYT"
     gene            101922..102806
                     /locus_tag="SFLA_RS32505"
                     /old_locus_tag="Sfla_6555"
                     /db_xref="GeneID:11353732"
     CDS             101922..102806
                     /locus_tag="SFLA_RS32505"
                     /old_locus_tag="Sfla_6555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyurea phosphotransferase"
                     /protein_id="WP_041826012.1"
                     /db_xref="GI:754215703"
                     /db_xref="GeneID:11353732"
                     /translation="MAASYVAAFGEEGRAWIAGLPSLAANMLERWDLERDGIARAGEA
                     SVVLPVLRRGTPAVLRLQMPRQEITAAVIGLRTWNGKGMVRLLDHDPMSSSMLLERLD
                     ATRTLASINDDDMAMSTLADLLARLVAVPAPRGLRSLGDIASEMADQAPQAIMKLVDP
                     ADRQHLRNWASAVAELADEPGDRMLHWDLHYDNVLAAQREPWIAIDPEPLAGDPGFDL
                     WPALDSRWDDVVAKGDTLRIVRRRFDLLTDVLGLDRARATGWTQGRLLQNTLWDIDDG
                     GTRIAPSSIAIADSLRNR"
     gene            103055..103369
                     /locus_tag="SFLA_RS32510"
                     /old_locus_tag="Sfla_6556"
                     /db_xref="GeneID:11353733"
     CDS             103055..103369
                     /locus_tag="SFLA_RS32510"
                     /old_locus_tag="Sfla_6556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140705.1"
                     /db_xref="GI:503906711"
                     /db_xref="GeneID:11353733"
                     /translation="MIQKKLDALAQMMDEYRAMPFPKGFRGLDVEDQDMVMLDADTAG
                     YVYRVLDGPLPEPSRGGLIRLLGVFEKVLPAISNEYASKYYTQARDVAALAAEIEAMR
                     DK"
     gene            103426..104574
                     /locus_tag="SFLA_RS32515"
                     /old_locus_tag="Sfla_6557"
                     /db_xref="GeneID:11353734"
     CDS             103426..104574
                     /locus_tag="SFLA_RS32515"
                     /old_locus_tag="Sfla_6557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140706.1"
                     /db_xref="GI:503906712"
                     /db_xref="GeneID:11353734"
                     /translation="MSDPTAGGAVAKPVRVRRLTDQEGQRLQQIVRRGSTSSVRYRRA
                     MMLLASAGGNRVPVIAQLVQADEDTVRDVIHRFNEIGLACLDPQWAGGRPRLLSPDDE
                     DFVIQTATTRPVKLGQPFTRWSLRKLAAYLRKVHGRTIRVGREALRRLLARRGVTFQR
                     TKTWKESPDPDREAKLDRIEEILDRFPDRVFAFDEFGPLGIRPTAGSGWAGQEHPNRL
                     PATYHRTHGVRYFHGCYSAGDDRLWGVNRRRKGAVNTLAGLKSIRAARPDGAPIYVIM
                     DNLSAHKGSDIRRWAGKNKVELCFTPTYASWANPIEAHFGPLRQFTIANSNHPNHTVQ
                     TRALHAYLRWRNANARHRDVLAAERKERARIRSEKGIRWGGRPLAAAA"
     gene            105030..105473
                     /locus_tag="SFLA_RS32520"
                     /old_locus_tag="Sfla_6559"
                     /db_xref="GeneID:11353736"
     CDS             105030..105473
                     /locus_tag="SFLA_RS32520"
                     /old_locus_tag="Sfla_6559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003950152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140708.1"
                     /db_xref="GI:503906714"
                     /db_xref="GeneID:11353736"
                     /translation="MDRGKPGSKMHVLSDANGLPLLVGLSAANVHDSLALKPMITGHQ
                     TRHDPHRGRYFKPQRLHADKAYDVPHLRKWLWGKHIGVRIARKGIESSERLGRRRWVI
                     ERTMSWLTGYRRLNHRYERQPRNYLAFLGLAAALCCYKRLARLTT"
     gene            complement(105578..106591)
                     /locus_tag="SFLA_RS32525"
                     /old_locus_tag="Sfla_6560"
                     /db_xref="GeneID:11353737"
     CDS             complement(105578..106591)
                     /locus_tag="SFLA_RS32525"
                     /old_locus_tag="Sfla_6560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140709.1"
                     /db_xref="GI:503906715"
                     /db_xref="GeneID:11353737"
                     /translation="MGDWRTDPTFSMCRALDDGADLASFVGGPFDIRAVVAAIQPEKI
                     DEAVLDDVPWENFPHGEKVHDAVRLLCNGGGSARFAMGVLVGICANDSRASAALAVPF
                     LIRIATDPHHPHHTDALRGLAAPARARHFGVASRDELLLHRSGPQHGVLDGYDDYGAE
                     VTGYPAGWSVAAARTAITAAIPMLLPLLYDSDVTTRIDASYALATAADPYRRVRSAFA
                     ARFDKERDPVALAGLVLATAESNRAHPHRPDTAWIRALWQDRAQAPEVRLAAAIGWLC
                     LTNEPVPHPLHTTIDALVTEERARAMDTLPWMNAAGCGKPGLLRCVRRMLHPEEPEPC
                     DDP"
     gene            complement(107377..107592)
                     /locus_tag="SFLA_RS32530"
                     /db_xref="GeneID:23391535"
     CDS             complement(107377..107592)
                     /locus_tag="SFLA_RS32530"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030639027.1"
                     /db_xref="GI:664101347"
                     /db_xref="GeneID:23391535"
                     /translation="MWEVVEQSGRRDGASVRGSDPVQGVRKAPPGSPSASQFTLQAPH
                     QGPGNGTGQSARDGCFDTQESPLVTAA"
     gene            107611..110361
                     /locus_tag="SFLA_RS32535"
                     /old_locus_tag="Sfla_6562"
                     /db_xref="GeneID:11353739"
     CDS             107611..110361
                     /locus_tag="SFLA_RS32535"
                     /old_locus_tag="Sfla_6562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018841153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825976.1"
                     /db_xref="GI:754215660"
                     /db_xref="GeneID:11353739"
                     /translation="MLSCIETPEFRALAQQLMAVEILDGDLRAATKIKFALRDFFRGR
                     FPNADVAALNNYSELLFAHLHRRCEGLVRELRAALKDESQAIDWAHATLARATADSIE
                     SYLAVLARPHRLTPEDREEWTQRYRKAFSLHEEIPLPDLGNRRRIHYSEIFVEPRLIH
                     GQAGGRISFDDFIDSIDRTVLLGDPGAGKSTSSAISASLLFQRGRLIPFYVVMREVDF
                     AASGFPLVRVVEEQLSHRYQIKAPEGLIEELLFEGSALLVFDGLDEVQSASLRRRSSE
                     IIETASRLYPLSRVLATSRIVGYSSARLNPVTFHEYRIQPFDDGLVLENGQVRAYVSK
                     WFSVGSRLPEPPGQVTDAFMRESASIPDLRCNPLLLAYICVLYRGHRFIPRSRAQLYK
                     KCAELLLADWDNFQGLPVDSETDLDTVRHTLAALAYRSITDPQWLAGMPEADVKAVAA
                     AAMSDESVPAHEEARRLAEDLVDLCRGRAWIFTELGTELDGSGIFGFTHQSLQEYFAA
                     LHLARNSGTPELLADRLLPELTGGRWEILAQICMNLADEKWAGGSSRVVTRLLERGQT
                     AEGDGLRTLVEFMARRLDVVKINVATMQLLMRLAIESYISTGSGELREFLSPSGPYPE
                     AAWAAFQAVAESQLTLEAGKGTRHGLAVAWLVANVHYLPASSHDRQTVSVHAGPVRTH
                     LDSVEGLREIALNALHHSPAGWALSLYTGAADIRTLASPQARRAAGPPDAAHSNVLSV
                     MLDTAGTPNSLGPISPAVWIFDILGGTGADQTRYGRARVALADLAAMLGDPMDTLVNL
                     DIPRLDDQFLEYWNTYGAARCDRAVRELYEQSGGADRGGSPALTGLIYLCMGLMELFE
                     EAFTAQVRYPLSLALLAKARREDWRVLAALLPRLTYPARRFVQNWAKGRHIWNMDRTE
                     VS"
     gene            complement(110426..110803)
                     /locus_tag="SFLA_RS32540"
                     /old_locus_tag="Sfla_6563"
                     /db_xref="GeneID:11353740"
     CDS             complement(110426..110803)
                     /locus_tag="SFLA_RS32540"
                     /old_locus_tag="Sfla_6563"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140711.1"
                     /db_xref="GI:503906717"
                     /db_xref="GeneID:11353740"
                     /translation="MEQVWWDDPGARGTPFFDLAVAYLACRRGDLDRAGQWKEMNWDR
                     YETGSARIDVLAVDACLARRRGGSRDLAWVLARLADARGAPLLSEGLDLLAAELARPL
                     LESRAPEPGEALRRLLAPYLRAA"
     gene            complement(111704..112369)
                     /locus_tag="SFLA_RS32545"
                     /old_locus_tag="Sfla_6565"
                     /db_xref="GeneID:11353742"
     CDS             complement(111704..112369)
                     /locus_tag="SFLA_RS32545"
                     /old_locus_tag="Sfla_6565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140712.1"
                     /db_xref="GI:503906718"
                     /db_xref="GeneID:11353742"
                     /translation="MITNVARGFASAALTVMPLLAATPVQAAEITTLAEGVRALPLAA
                     ESRTGYERSAFKHWVDADKDSCNTRMEVLIAESRIAPTVEAGCKVTAGEWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLDAERSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTADQPEAAALTDLAETCGNQPLAYELATE
                     DGN"
     gene            112782..113513
                     /locus_tag="SFLA_RS32550"
                     /old_locus_tag="Sfla_6566"
                     /db_xref="GeneID:11353743"
     CDS             112782..113513
                     /locus_tag="SFLA_RS32550"
                     /old_locus_tag="Sfla_6566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140713.1"
                     /db_xref="GI:503906719"
                     /db_xref="GeneID:11353743"
                     /translation="MHRSRIATLAAVVLSATLISCNPQLADDKPNGSTPTSTASAASP
                     APGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPKQGDRCKLTGGVWMSYYDEVEVTDAKKLDIDHVVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     AEKTALLDLAKDCTDTVVEFEEAAE"
     gene            113678..114868
                     /locus_tag="SFLA_RS32555"
                     /old_locus_tag="Sfla_6567"
                     /db_xref="GeneID:11353744"
     CDS             113678..114868
                     /locus_tag="SFLA_RS32555"
                     /old_locus_tag="Sfla_6567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140714.1"
                     /db_xref="GI:503906720"
                     /db_xref="GeneID:11353744"
                     /translation="MKAKRGPLGDERRDRGPETPPTRGVLVTGSLVRVSSAAAAGCGA
                     LFVLLPVLALIGRLGFPDDPPDFVPVFGGPLIAASLGIAVFLIVLGYSLTFQQLALAD
                     MYAAEGDSPSLRNAVEVRGPVSRTPFFPAVATSIVIGSLLLATAGVLLAASAWPAVAT
                     ILLILGILSAPAVLALIAVGRRWRRTAGERLPAQALGEQGHARLLLGDADTKRRQQAK
                     ARDRAEATDLDRASIPVRAALVIAVFAVMSPSLSPTAPLWKQVQLAGAGLGVLCLLLD
                     SCLAMLRSRRLRRTLVRVRSGGADVTAIDRAHAITATAAQASEVHAVSTVWALLGAGV
                     LGTLIPRNTDIAPVLIVAGTWVLGFIALVAVSMRSDAAAPKLREEYGYRLPTQTSGND
                     NTWH"
     gene            complement(<115431..116014)
                     /locus_tag="SFLA_RS32560"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391536"
     gene            116699..117943
                     /locus_tag="SFLA_RS32565"
                     /old_locus_tag="Sfla_6572"
                     /db_xref="GeneID:11353749"
     CDS             116699..117943
                     /locus_tag="SFLA_RS32565"
                     /old_locus_tag="Sfla_6572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010064700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_014140716.1"
                     /db_xref="GI:503906722"
                     /db_xref="GeneID:11353749"
                     /translation="MTSSASGDREKVVSKLPPALQQDLKIRAAQHGIDIQHAVEAGIA
                     AWSRLGANLPAADTGRAKPFATFLPPGQWDEFRENCASRGVSLIQGLTQSVLFWLDTN
                     PAPGVVRPEHPKRIIICNQKGGVGKTALAAGVGEAFAEDSDQLHPVRISKHFAAAILE
                     PDNEPASYLDYEDLPGLGLRVLLVDFDPQCHLTNQLGHSPLPIEGDSLTKHMAGEAKG
                     NLKDLIVPIDDPRFGDRLHLLPACTDAFLLDVKLSSVRAREAALERVLGTIEGDYDVI
                     IIDCPPSLGLSMDAAAYYGRRRDGEAPGNSGILIIVQAEDSSADAYGLLTNQIEDLRA
                     DMHLELDYLGIVVNHYDARRGYIATSSLQSWIDIKDPRVVGVIGDLKEQKEAVRLKRP
                     LLAYAPRCDQAVGMRALTREIS"
     gene            117940..119061
                     /locus_tag="SFLA_RS32570"
                     /old_locus_tag="Sfla_6573"
                     /db_xref="GeneID:11353750"
     CDS             117940..119061
                     /locus_tag="SFLA_RS32570"
                     /old_locus_tag="Sfla_6573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_014140717.1"
                     /db_xref="GI:503906723"
                     /db_xref="GeneID:11353750"
                     /translation="MSKADTLRASASFGQARGGISARRAAIEAAATAPTDGAPPPLQL
                     PVDVISLNPDNPREILGDLTDLGASLRDHKQKTAISIMSRFAYLEGNPGRADDLEEGT
                     KYVVIDGNSRLAAAREAGLAQIKVMLDDELGSNPDEILESAFVANVHRQDLDPLDEAK
                     VLQRLLAIHKTQDALAARLHRSQGWVSQRLALLGLTPELKEKLQAGEESAALLRRVGK
                     KKPEEQEEHLRRLKEKGKKTPQRSAAPQPAATPAPTPPAQDHYAVMNPAPDGDQGVDG
                     PGADNTAGRPSNTRPAPRVSDHASPSSKPRQQGETLMDAAFDQLNDEQRSAFILRYFQ
                     RSTGIEAVTADMRGKLPAEARSSLASILQQVAAALRRDE"
     gene            120486..121643
                     /locus_tag="SFLA_RS32575"
                     /old_locus_tag="Sfla_6575"
                     /db_xref="GeneID:11353752"
     CDS             120486..121643
                     /locus_tag="SFLA_RS32575"
                     /old_locus_tag="Sfla_6575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_014140718.1"
                     /db_xref="GI:503906724"
                     /db_xref="GeneID:11353752"
                     /translation="MTVPYSPDDREKVVAKLPAILRQELKVRAAELGVDIKDAVTEGV
                     QAWRADDVERVPVDTTGGSSFSTYLPTGLYGEFKNDCKQRGIPFNQGIAQAIRLWLDT
                     HHSPRRTAARPAWARRLIFGNQKGGVGKTATSSGVAQALAEAGNRVLLIDFDPQGHLT
                     KQLGYELFDIESPSLAKHMLGEAKGELRELLVPIENGAFSGRLFMLPACKDAFLLDAK
                     LATSRFVRIKETALEKALEPLEKEFDYIVVDCPPSLGYTMDTALYYCRTREGETSGLS
                     GIFIPVLAEDSSADAYDMLYDQIQDLSVDMEVEISMLGFIVNMYDSRKGYIATSSLHS
                     WKEIGDPPVVGVMPELKEQRESVRLKQPLLSYAPDCEQSEVMRAIARKVMS"
     gene            121640..122890
                     /locus_tag="SFLA_RS32580"
                     /old_locus_tag="Sfla_6576"
                     /db_xref="GeneID:11353753"
     CDS             121640..122890
                     /locus_tag="SFLA_RS32580"
                     /old_locus_tag="Sfla_6576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140719.1"
                     /db_xref="GI:503906725"
                     /db_xref="GeneID:11353753"
                     /translation="MSVADRLGTGSSFGGVPRGRSARGRAKAIVQGDVPSYELRRLPL
                     EDVAPTPLNPRRNFGSDEDLTRFGEELRIAQLAACVAVSRSAYLRLWPEHEAQIGDSA
                     YVLVNGERRFRSAVHVALEALDFVVRDDLAASREEFVDHLLKENLEREDFDVVERARG
                     VLELVRVCSEESEKGARTRAAKRLGRDRSWITNQLALLELPTELQAMLSSGSLPERDG
                     RLLARRLKEEPGLDGAGLLAHLKETREQEVRVREEEKLLLQRARQTAGTGPLLSTDNA
                     EPMDHSPARGSALSADNTPRETDTAQRASAQTRTPAPTRPAPAEEPVLSADNADVRES
                     QSPAKATSVPAPVLSSDNTTSTATPTARTGRQEDETAVSADQRSLLLVRQLGASVEEQ
                     ARTLASGLPPEQLTQLIEELHSYV"
     gene            123123..123464
                     /locus_tag="SFLA_RS32585"
                     /old_locus_tag="Sfla_6577"
                     /db_xref="GeneID:11353754"
     CDS             123123..123464
                     /locus_tag="SFLA_RS32585"
                     /old_locus_tag="Sfla_6577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, PadR-like family"
                     /protein_id="WP_014140720.1"
                     /db_xref="GI:503906726"
                     /db_xref="GeneID:11353754"
                     /translation="MTRQNPPLTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIA
                     VGTLYGALERMERAGLVSAGHEEIVDGRARRYYRLTKDGAEALGREALRMQQAAAVVI
                     GRWRDAGVAPA"
     gene            123461..124420
                     /locus_tag="SFLA_RS32590"
                     /old_locus_tag="Sfla_6578"
                     /db_xref="GeneID:11353755"
     CDS             123461..124420
                     /locus_tag="SFLA_RS32590"
                     /old_locus_tag="Sfla_6578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140721.1"
                     /db_xref="GI:503906727"
                     /db_xref="GeneID:11353755"
                     /translation="MNRLLLAAYPEPYRSRQGQEVLACLTEAYPGRSWPPPQEVAALV
                     RAGVQARARAVVDDTARTWWLDGIHLTALVLAALALVPYLQDVWHWALHIDPGRNAIA
                     FPFSGWYPWAQGAGGRTRLLPYGLLPLVCLIALLRGRAWVALPAAAVMIYAGATFNST
                     TLFGDEGKSGLSYYGLGAPIDARDLVLSGTLCAACAVLALCRPSRLRRRSYRWLAPVV
                     LAMFIAGSLHIISVSPAFQRGLFVLEAVALLSAWVATAATGDHRWLIPVAGVAIVRTQ
                     AIVVRPDAFMQSFPDLVVLILLIAPLPALAFTAQRRQGQALAE"
     gene            124514..125428
                     /locus_tag="SFLA_RS32595"
                     /old_locus_tag="Sfla_6579"
                     /db_xref="GeneID:11353756"
     CDS             124514..125428
                     /locus_tag="SFLA_RS32595"
                     /old_locus_tag="Sfla_6579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_014140722.1"
                     /db_xref="GI:503906728"
                     /db_xref="GeneID:11353756"
                     /translation="MTQHDSPILPAHRPGASRQAPDCLGPSRTPRPWIPALLYTLGFL
                     TVYLLAICTPWGQRAENTLFDLGGGNPEDVWLYPLSGAEYGSTPLPPLELSAKPTLMV
                     GLAVIVVLTLVRRCWRLGCAALGVVILTTGGKEVLKSTILPRPDLVGAPESLLDQGFP
                     SGHTAIPAALTLAAVLVVSPRIRPYIATAGVLWLACIAAYSATKGGHRPSEVLGATLL
                     ACACYGLATWLRPPATVPGATRSLRALPAITLTLALAVALVSGARNDTLTRSLVSAAT
                     GFICAALVWYAAVGRPAPTARRTRLALD"
     gene            complement(126141..127634)
                     /locus_tag="SFLA_RS32600"
                     /old_locus_tag="Sfla_6581"
                     /db_xref="GeneID:11353758"
     CDS             complement(126141..127634)
                     /locus_tag="SFLA_RS32600"
                     /old_locus_tag="Sfla_6581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein S1"
                     /protein_id="WP_041825980.1"
                     /db_xref="GI:754215664"
                     /db_xref="GeneID:11353758"
                     /translation="MLPHVYQVTKYDPADRDEHGHYAGAQEVTSDRGEYEAAYLQAVA
                     AFAADAGVDRLSVREPGVPSFVHFGSREAADDYGLGALFLHGLHGFHDGAEVQFATAL
                     ELVRIMLRDSGAWCRLEADGIFEVHVGWDQYLYICTSRPSTDAVARTRALGLFPERLS
                     ASPYAVETEPSGIQRPADDEFWSALLWAVGSGRAGMLEETYIEGATRYHRLSRETLGI
                     VRARLTPRARLAVWPALSPDVGAVLGSLPREGLVEGVWQDTDGRLHSAVADEADYVEL
                     TTRMKGAAAAALLSIDADERVPLFTAVLPDTDGVVRARWRTEPTPEDRKWAFLKTLQP
                     GQVVTGTVTETASFGVTFVDVDGYEGFINIPELSWRSVAHPADVVSVGQRIHAGVLGV
                     DGVRAQMALSLRAVQDDPMQQLTGQVGTTLPGRVTKIVPFGVFVRIEEIENGFAGLVH
                     NSELLGRQEKEPQGGIEVGSTLRVKILDVDLGSRRITLSQRQADPEV"
     gene            complement(128112..129122)
                     /locus_tag="SFLA_RS32605"
                     /old_locus_tag="Sfla_6582"
                     /db_xref="GeneID:11353759"
     CDS             complement(128112..129122)
                     /locus_tag="SFLA_RS32605"
                     /old_locus_tag="Sfla_6582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014140724.1"
                     /db_xref="GI:503906730"
                     /db_xref="GeneID:11353759"
                     /translation="MLAAVLVATGCESSGSGSRTDARSTPSASAAPAVIRLPPKAWPA
                     DVVLSQDGTLWVAESSLAAIAQIAPSGKVTQHPLPRDGGFAPRPSDLVPSPDGGIWYA
                     AGDQLGHLSRSGKFTWWGDGGEVGNGPGAGPDVPGFPDALTLGPDDTVWYEHSAVGDK
                     VFSRVDLKQGPTQITRLDTQFSVVAMTEGPDGAVWFTQSEEYDAKQREGIGRLTSDGK
                     YRKWPLPANSSPGALVAGPDRALWFTDSAGISRIDTDGDLTRYPVRDATYLGDIVVGA
                     DKSLWFTADHRIGRLTTEGRMTLWPVPDAEDLGALVPLEDGSFWLADRKADVLRRFTP
                     PQ"
     gene            complement(129136..132555)
                     /locus_tag="SFLA_RS32610"
                     /old_locus_tag="Sfla_6583"
                     /db_xref="GeneID:11353760"
     CDS             complement(129136..132555)
                     /locus_tag="SFLA_RS32610"
                     /old_locus_tag="Sfla_6583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140725.1"
                     /db_xref="GI:503906731"
                     /db_xref="GeneID:11353760"
                     /translation="MTETGNTHRTALHSVLRESTPQGAVHELLGERRLWWESCSEAAR
                     VDAAWLAGPAEALADWIDANAPDRESVALTPARHAYLLARALASPPDQDEALVSVRTL
                     WAGSGLLSANAAPGPVQPSGRGLAAVPEAAAARLEAVLERIPHLAGETAPAPDSMLVA
                     TLLLMAGCETGRRVQLPVVFGETERSGEAGATGVLELCEFPAGPPGLYPDPRYMSGLR
                     SSYGQFASALGRAWAVAGRGPGARCVLWRLVFTDRSPTRVEGPSLGVAFALGLRELLR
                     YPQRRRPSAAWLRGVFHGLRPRTAVTGALGHGERLDGVSGMEDKLLAARRKGLRLVAP
                     VANRPDAAHAPEPADVMFAETLRQADRYARRFRTGRLATVVALVLAVVASGVVVQYRE
                     ATARERMVEAHRLAEVSGDLLSTDVALAGLFAERAYRQHADPQTRKALFRSVTESPHL
                     AGSVRAAGTVSVVAASQSGERALTGTRSGDVEVWGLEDGRFTGHHRRVGRLPGSVETV
                     ASDADGRVVAASDDRTVSVWTAGQSSPVPSLPEEQTPAAVAVSPSGRFIAVATESGRF
                     QVPGTLSVLDRDSGRTQQLKLADLSLAPSALAFDGDEELVVSEFGYGGWNRVSVPRLK
                     RTAGSTIGFGVHNSASALAPDGSHISYSNKASSLAVWPSRGKPEGDAPKLVADTEPGL
                     PSALAVSRGGTHVALAIGSTLRVSRTHGPDEKGSGSLTLPGAGPVPANAVTFLGSGGD
                     RLLSASSEFLSLWDLRQHTRIAWESNIDIPGCGLSCAPPQVAVSPDGQDAAFIDGSGD
                     KLAMVRLGPPGTKPRGYEGTMQIPGFSTLVWRPDSRRLIVLAPDGSAQRVERGKKWRA
                     ASSWPPVPNPLRLSDPPALARYLPDGRTLVEVHMSGTVWFRDAASGKPLRKVDGPRSM
                     APTADGNRHPSFNQVALDERGSYAAILEQQTADNPSGKIVLHVISTASGRIRTIPADG
                     ARGITYSGDHLLIQHDSGSIKVRSASGARQLDTAEGVDDPAVGPVTDGRLLAGTTVKD
                     QAVRLLDLASQTGIGTLPLPEHNFENSTGLALIPDGTGLVTATEADYSETDSPSADGP
                     TTEELGTLIQWRLDPRDWISTVCATAGRELRPRDWEQHMDSPTPSSLRCGK"
     gene            complement(132552..132953)
                     /locus_tag="SFLA_RS32615"
                     /old_locus_tag="Sfla_6584"
                     /db_xref="GeneID:11353761"
     CDS             complement(132552..132953)
                     /locus_tag="SFLA_RS32615"
                     /old_locus_tag="Sfla_6584"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140726.1"
                     /db_xref="GI:503906732"
                     /db_xref="GeneID:11353761"
                     /translation="MVSPDGRTVFVLRRVGGRTGEYGLELVSRGVADQLELATVQYTR
                     PDGEQRTILVPVSPSPVGPTASFVRLDGFAAGSTWQATGPTPIPEDPAWPSETVADSI
                     RAAHNEATREAWRQVRERTGQGIRETIDGAL"
     repeat_region   133924..134626
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=134049..134077
                     /rpt_unit_seq="ggggccatccccgcgtgcgcggggagcag"
     gene            134861..137782
                     /locus_tag="SFLA_RS32620"
                     /old_locus_tag="Sfla_6586"
                     /db_xref="GeneID:11353763"
     CDS             134861..137782
                     /locus_tag="SFLA_RS32620"
                     /old_locus_tag="Sfla_6586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas3"
                     /protein_id="WP_014140728.1"
                     /db_xref="GI:503906734"
                     /db_xref="GeneID:11353763"
                     /translation="MTVEGGSHTGMRARLRGPVLKVWAKHDRDSDGWLPLWRHMEDSA
                     AVAGRLWDEWLPLSVQRLIADELPDGTADARRLVVWLAGVHDIGKATPAFACQVDLLA
                     EAMRADGLEMRSQRAMGADRKLAPHGLAGQVLLGEWLENRHGWAVSQTGQFTVAVGGH
                     HGVPPEYGQITALDRHPQLLRTPGKSGPLWQRVQQELLEACAAEFGVQDRLGAWRSVK
                     LPQPVQVVLTALVIVSDWIASNPDLFPYFPQDASRSNEDRITAAWQGLNLPGAWRAAD
                     PPADVQELFASRFALPPGARVRPVQEAAVELARTMEEPGLLVIEAPMGEGKTEAALGA
                     AEVLAARSGAGGVFFALPTMATGNAMFPRLLNWLERLPSPDGARHSVLLAHSKSALND
                     DFTDLMERGPIAALNLDAAEDQELRPTSRGRSASAELVAHAWLRGRKKAMLSSFVAGT
                     IDQLLFAGLKSRHLALRHLAIAGKVVVIDEAHAYDTYMSSYLDRVLSWLGAYRVPVVV
                     LSATLPATRRRELVEAYAGRRKGDSRDFDAVAQAGDYPLLTAVPPGGTPVLRRPPASG
                     RGVDVEIERIDDNLDHLADRLEDELEDGGCVLVVRNTVRRVLDAAKVLRERFGDAHVT
                     VAHSCFIDVDRAAKDASLLQRFGPPEKAEGRPTKHVVVASQVAEQSLDVDFDLLVTDL
                     CPADLLLQRMGRLHRHLRGGEKQTERPERLRAARCLVSGVNWTNGVPEPVRGSVAVYG
                     AYALLRSAAALLPHLDAGPRRPVRLPADISPLVQHAYGEGSPVPTDWAQDVETARGAY
                     DELRADQAERAATFRLGAVARPGRPLFDWVTAGVGDADDTSRGKAQVRDSRESLEVVV
                     VQKKADGTLATVPWLVPDRQNRQLADLALPTDQVPTPLAARTAASCGLRLPMQFSYAE
                     TMDRAIAELEELHLRAWQVKGSHWLAGQLVLALDEDCQTQLAGFTLRYSKSDGLEVTR
                     A"
     gene            137775..139469
                     /locus_tag="SFLA_RS32625"
                     /old_locus_tag="Sfla_6587"
                     /db_xref="GeneID:11353764"
     CDS             137775..139469
                     /locus_tag="SFLA_RS32625"
                     /old_locus_tag="Sfla_6587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cse1"
                     /protein_id="WP_014140729.1"
                     /db_xref="GI:503906735"
                     /db_xref="GeneID:11353764"
                     /translation="MPDNSQSDREDALSFDLTTQPWIPVLRINGQQDELSLHQVFEQA
                     SELRRIVGDLPTQEFALVRLLLAIAHDALDGPADIDDWADLWSDEQCFAPVGPYLDAH
                     TDRFDLLDTTAPFFQTAGLRTTKDEVFSLNRIVADVPNGEPFFSARMPDVDRLTFAEA
                     ARWVIHAHAYDTSGIKTGVEGDKRVKGGKVYPLGVGWAGNLGGVYVERPTLRETLLLN
                     LVAADTTGVRIDEQDAPAWRRDPCGPGGAERASTGVRDLYTWQTRRLRLHFDEHGVHG
                     VVLGYGDPLSPRNMHDREPMSAWRRSLAQEKKLRESPVYLPRDHDPERAAWRGIASLI
                     ADTLPGLQGSEPPSSLRPAVLEWVARLVSQGELEQGFLVRARVIGPKYGTQQSVIDEI
                     VDDSVSMGVVLLHQQDRRYAEQAIAAVEDADRAVYAIGDLATNLARAAGAETNGPRAT
                     ARDHAYGLLEAPYRSWLRDLAKSDDPYEQRLAWQRQVYRIATKFGDQLMAAAGDGAWQ
                     GRIVETKKGTEWLNSALADKWFRIALNRELGSPDSSGTAPATDERSDSETTVKALT"
     gene            139466..140164
                     /locus_tag="SFLA_RS32630"
                     /old_locus_tag="Sfla_6588"
                     /db_xref="GeneID:11353765"
     CDS             139466..140164
                     /locus_tag="SFLA_RS32630"
                     /old_locus_tag="Sfla_6588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein"
                     /protein_id="WP_014140730.1"
                     /db_xref="GI:503906736"
                     /db_xref="GeneID:11353765"
                     /translation="MTTVAASLPPRKQVARLAAQILAPLQQGYLADRSPDVAALARLR
                     RGAGREAGQLPDLWSLIDTGPLHVPPDDARPLDESDLVRAEDALHVALTLWALHQQSR
                     PTGMHQADRKDSRRGLGTAVRRMMKPGEIDEPLRKRLVRAGTAPDLTSLAQRLRDIVV
                     LLRRADIPLDYALLAGQLYTWQRPGGADVVRREWGSSFHAWHDKDAEKPGDAATAPAG
                     DKTTDSTDIDKDAS"
     gene            140161..141354
                     /locus_tag="SFLA_RS32635"
                     /old_locus_tag="Sfla_6589"
                     /db_xref="GeneID:11353766"
     CDS             140161..141354
                     /locus_tag="SFLA_RS32635"
                     /old_locus_tag="Sfla_6589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cse4"
                     /protein_id="WP_014140731.1"
                     /db_xref="GI:503906737"
                     /db_xref="GeneID:11353766"
                     /translation="MNRIFLDVHALQTVPPSNLNRDDTGAPKTAVYGGVPRARVSSQA
                     WKRAARTYFSNEHLLDASELGVRTKKIVEAVAARITALDPSIEGEAALLIADETVKAT
                     GLKTEVPKRKATAAKDGEPEPAPEAKYLVFLSTRQLDGLARLAVEGASDITAHLKDKE
                     TKAKAKEIADTHHSVDIALFGRMVADSADFNVDAAVQVAHAISVHRVENESDYYTAVD
                     DKNTDEETGAGMIGTVDFNSSTLYRYAALGVHQLAANLGEGLREDEPLTTPVRRAVEA
                     FVHGFTASLPTGKINTFGHHTLPDAVVVKLRTTRPVSFVSAFEEPVRGDQGGYVREAS
                     ERLAEYIPDIERAYGDEGSTLTWVLRVGPNTAKLAGIGTEAQNIGELVAAVGQAVAER
                     LEKPA"
     gene            141351..142076
                     /locus_tag="SFLA_RS32640"
                     /old_locus_tag="Sfla_6590"
                     /db_xref="GeneID:11353767"
     CDS             141351..142076
                     /locus_tag="SFLA_RS32640"
                     /old_locus_tag="Sfla_6590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas5"
                     /protein_id="WP_014140732.1"
                     /db_xref="GI:503906738"
                     /db_xref="GeneID:11353767"
                     /translation="MSVLSLRLAGPLQSWGASGRFTRRTTESAPTKSAVIGLLAAAAG
                     IERGDDTRLEPLAALRFGVRIDQPGSRVRDFQTAHHSVSGKSMPLSERFYLADAVFVA
                     AVEGDTTLLSDLHAALRNPVYPPFLGRRSCPPAQPVDLGLHDGAASLMDVLGEVPWQA
                     SSWYRRQHGSRTDIELTVLREACGSEAEFADTLRDQPISYAAEHRRHALRSIVSNTVR
                     VPGPSAGRLPRHDPFDALQEENV"
     gene            142076..142852
                     /locus_tag="SFLA_RS32645"
                     /old_locus_tag="Sfla_6591"
                     /db_xref="GeneID:11353768"
     CDS             142076..142852
                     /locus_tag="SFLA_RS32645"
                     /old_locus_tag="Sfla_6591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cse3"
                     /protein_id="WP_014140733.1"
                     /db_xref="GI:503906739"
                     /db_xref="GeneID:11353768"
                     /translation="MFLTRFRVNTARLGARRLLSSPQVLHASVMSSFPSLLPSDAPPP
                     DGPRVLWRLDHTARAEVMLYVVSPDRPDMTHLVEQAGWPAAAISSAPGWESRPYGPFL
                     DRLTPGEQWAFRLTANPVHHIRRKADEPTKRTAHITPVHQMGWLLQRQEQCGFRVLEK
                     PADRRLLPSGTTHTGLPHHGDRYELTVHDKRALSFDKSRGSAKAATRKGAVSLVTVTF
                     DGRLEVTDPEKLRRTLRQGIGKAKAYGCGLLTLAPLGTAG"
     gene            142857..143834
                     /locus_tag="SFLA_RS32650"
                     /old_locus_tag="Sfla_6592"
                     /db_xref="GeneID:11353769"
     CDS             142857..143834
                     /locus_tag="SFLA_RS32650"
                     /old_locus_tag="Sfla_6592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cse1"
                     /protein_id="WP_014140734.1"
                     /db_xref="GI:503906740"
                     /db_xref="GeneID:11353769"
                     /translation="MTTVSRRAALTPRQLTRTGERLSFVYLERCVVHRDANAITAEDA
                     EGTTHIPSATIGTLLLGPGTRITHQAMSILGETGAAVCWVGERGVRYYAGGRALTRSS
                     ALAEAQAVQWANVRSRLGVARAMYRLRFPDEDPAGLTRHELLGCEGRRVKDCYRAQSA
                     RTGVPWHGRRYTPGDFSSGDAVNQAITAAAQCMYGIAHAVVASLGCSPALGFVHSGHE
                     LSFVLDVADLYKTEIGIPLAFDVAAEDEEDVGSRTRRALRDRINETSLLDRCVNDIKR
                     LLLGEERKENTATNDAPDVVTLQSDGGREVAAGRNYGGGEDFDVLETTW"
     gene            143831..144181
                     /locus_tag="SFLA_RS32655"
                     /old_locus_tag="Sfla_6593"
                     /db_xref="GeneID:11353770"
     CDS             143831..144181
                     /locus_tag="SFLA_RS32655"
                     /old_locus_tag="Sfla_6593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas2"
                     /protein_id="WP_014140735.1"
                     /db_xref="GI:503906741"
                     /db_xref="GeneID:11353770"
                     /translation="MTVIVLTNCPAGLRGFLTRWLLEISAGVFIGNPSARIRDLLWAE
                     VQEYADQGRALLAHTANNEQGFTFLTHDHAWHPVDHEGLTLIRRPNANSPSTEQSPKK
                     GWSNAAKRRRFGRR"
     repeat_region   144274..145340
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=144274..144302
                     /rpt_unit_seq="gtgctccccgcgcgtgcggggatggtccc"
     gene            145365..146150
                     /locus_tag="SFLA_RS32660"
                     /old_locus_tag="Sfla_6594"
                     /db_xref="GeneID:11353771"
     CDS             145365..146150
                     /locus_tag="SFLA_RS32660"
                     /old_locus_tag="Sfla_6594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140736.1"
                     /db_xref="GI:503906742"
                     /db_xref="GeneID:11353771"
                     /translation="MPSVLERIDRARHTISFVSHFAEPDSFALTALAQWLDTSPGGMA
                     TTAEDGKGMESGTEGTTPSNPVQQLAAHIRDQLGAGPFSQADGWTHMGAVISDASFQA
                     RSRYKATILPRILALQTAWPDAATVKGFQARLATDDLATAMNFHHARKVAKAHNVTDL
                     LAAHGVDTRDDLRAWLDIQPNRAALRAVKDVGPKTVDYLGNLVGGSQIAVDVHLRAFA
                     AEAGVTDLRYEQLRTTYEHAAALLGHEPGGMEHAVWRLKAGVS"
     gene            147649..148665
                     /locus_tag="SFLA_RS32665"
                     /old_locus_tag="Sfla_6596"
                     /db_xref="GeneID:11353773"
     CDS             147649..148665
                     /locus_tag="SFLA_RS32665"
                     /old_locus_tag="Sfla_6596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_041826014.1"
                     /db_xref="GI:754215706"
                     /db_xref="GeneID:11353773"
                     /translation="MARWLAGRHWPVHPLAPGRKTPAANCEQCRVRSHEPSSCPCQAR
                     GLWCHGFHSATTDLARVEDWWSREPRAGVGVSCGPAHLVVLDVDAHAAPVPDRNRLLP
                     GIPIPEQVDLAGLASGFDTLALLAAYRKEANPAEDETTLRVRTPSGGLHIWYVNTEPA
                     VRYRSSTGSSPRTALAWQVDVRAHGGYIVAPTTRTSAGAYTPLGAVRDPAPLPAWLAA
                     ELRRTGHVIQTAPVPGPRPARVPRRPRTGAVQALLQPLIEAVRECATSAEGTSFTEKL
                     NRAAYTAGGLAGAGYLNQSEARQELTEAAHYARPHQTRRSETIIDAALSAGASRPFHP
                     KGLA"
     gene            148662..150209
                     /locus_tag="SFLA_RS32670"
                     /old_locus_tag="Sfla_6597"
                     /db_xref="GeneID:11353774"
     CDS             148662..150209
                     /locus_tag="SFLA_RS32670"
                     /old_locus_tag="Sfla_6597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_014140739.1"
                     /db_xref="GI:503906745"
                     /db_xref="GeneID:11353774"
                     /translation="MSSAESSRFDAAAAAQQMLDFEAAAPAWVPPQQVQAPAMTDTPV
                     LLPPMLTDRGNAKLFAQLYSDQFRHVEGLGWYCWDQFRWKRVGGEKAALWAAGDMAEQ
                     MSPTDPRGVFSDREIAQHRRRTMSTSGMKALLHQAKAAPVLSLDPDVLDGDAYSLCTP
                     AGVVDLRNGRLHKPNPLRDLHSRATNVAPQATPTPRWHAFLDDTFGADTKGQEMIDFL
                     HLLLGYSITGDVGAQVLPFLWGKGANGKSVLLDVMIQVMGDYADAAPPGFLMDKGNFA
                     EHSTELTELHGRRIFVCSELKPNDKFDEARVKLLTGGDKIKARRMRQDYFSFTPTHKL
                     WLLGNHQPEVGTGGHAFWRRIRLIPFERVVAADRKIDNLAGELVEEEGPGILHWLIQG
                     AMRYLTSRDPLTGPSSVRLATAAYETTEDHIGRFLSEACARQGPETGDLRVEQGLLYA
                     TYTAWCSSEGIRADTARAFAGRIRQEVGLASPAEMLKSSGKKYYPAMALLPDDLVRPD
                     GTAGRRG"
     gene            150346..150726
                     /locus_tag="SFLA_RS32675"
                     /old_locus_tag="Sfla_6598"
                     /db_xref="GeneID:11353775"
     CDS             150346..150726
                     /locus_tag="SFLA_RS32675"
                     /old_locus_tag="Sfla_6598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010636356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140740.1"
                     /db_xref="GI:503906746"
                     /db_xref="GeneID:11353775"
                     /translation="MSSLLQESQLTHEANVVWLEDLDELDYVRQALDKSARRSGKPRY
                     ARDGRMVGYAELDRDAEASPDSGLFQRRTFFLLPHDRPNDPEGLYKEGAPGEAVDPRT
                     IDARRVGEKTPRSQGKHRSEIVPS"
     gene            151024..>151245
                     /locus_tag="SFLA_RS32680"
                     /db_xref="GeneID:23391537"
     CDS             151024..>151245
                     /locus_tag="SFLA_RS32680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019071834.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal subunit interface protein"
                     /protein_id="WP_041826016.1"
                     /db_xref="GI:754215708"
                     /db_xref="GeneID:23391537"
                     /translation="MDEVLDEGPFFHGTKAELLTGDHLIAGFRSNYRPEIVMNHIYFT
                     ALRDGAGLAAELAVGDGAPRVYVVEPTGTF"
     gene            <151242..151709
                     /locus_tag="SFLA_RS32685"
                     /db_xref="GeneID:23391538"
     CDS             <151242..151709
                     /locus_tag="SFLA_RS32685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010061666.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_041826018.1"
                     /db_xref="GI:754215711"
                     /db_xref="GeneID:23391538"
                     /translation="VRDLTDGRGTDAVIDAVGTEAHGAPMAKAAQWGVGVLPGAVAEK
                     LMDRAGIDRLSALYAAIDIVRRGGTVSVVGVYGGALDPMPLLTMFDKQIQLRMGQANV
                     KHWVNDLLPLLTDEDPLGVDSFATHHMNLEEGPKAYQMFQNKEDGMIKTLLKP"
     gene            complement(152716..152919)
                     /locus_tag="SFLA_RS32690"
                     /old_locus_tag="Sfla_6602"
                     /db_xref="GeneID:11353779"
     CDS             complement(152716..152919)
                     /locus_tag="SFLA_RS32690"
                     /old_locus_tag="Sfla_6602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003978103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140742.1"
                     /db_xref="GI:503906748"
                     /db_xref="GeneID:11353779"
                     /translation="MSTHHPKHETTHDNEPRETAGDELLREAEGAATSVEDDAEGDSS
                     DGEAADALSPSKDAQEDVRHRDS"
     gene            complement(152993..153319)
                     /locus_tag="SFLA_RS32695"
                     /old_locus_tag="Sfla_6603"
                     /db_xref="GeneID:11353780"
     CDS             complement(152993..153319)
                     /locus_tag="SFLA_RS32695"
                     /old_locus_tag="Sfla_6603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_014140743.1"
                     /db_xref="GI:503906749"
                     /db_xref="GeneID:11353780"
                     /translation="MPQGSSRKRERQYEHIKEGAEKRGTSEGRAKEIAARTVNKERAR
                     SGESKTASKTSTQDKKSASQRGGERSHTGPQGPTKDQLYAEAKKRNIDGRSSMNKQQL
                     AKALGR"
     gene            complement(153487..153903)
                     /locus_tag="SFLA_RS32700"
                     /old_locus_tag="Sfla_6604"
                     /db_xref="GeneID:11353781"
     CDS             complement(153487..153903)
                     /locus_tag="SFLA_RS32700"
                     /old_locus_tag="Sfla_6604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140744.1"
                     /db_xref="GI:503906750"
                     /db_xref="GeneID:11353781"
                     /translation="MHVLSDANGLTLLVGVSAANVHDSLALKPTVEGHQTRHDPHRGR
                     NFKPQRLHADKAYDVPHLRRWLWGKHIGVRIARKGIDSSERLGRRRWVIERTMSWLTG
                     YRRLNHRYERKPGNYLAFLGLAAAPCCYKRFLKLTM"
     gene            153966..155201
                     /locus_tag="SFLA_RS32705"
                     /old_locus_tag="Sfla_6605"
                     /db_xref="GeneID:11353782"
     CDS             153966..155201
                     /locus_tag="SFLA_RS32705"
                     /old_locus_tag="Sfla_6605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_030639240.1"
                     /db_xref="GI:664101652"
                     /db_xref="GeneID:11353782"
                     /translation="MMFEIRKDRAKALGGRRRLVREREEYFLLVDQGYGNTEACRLVG
                     INERTGREWRNGRTAKDRFRAPARPASAPVVPSRFLTQADRLHVADRLREKATVRAIA
                     AELGRSPSTISREIRRNGIPLRGDTSRWAYRPYAAQARSDARRPRPKPGRIGQNSRLR
                     DYIQERLTRRWSPEQIAAQLPRDFPDDLEMRVTHETIYQALYVQGRGELRRELVHALR
                     TGRTRRKPHRHAARRQPRFATPMVMISERPAEVADRAIPGHWEGDLIVGPGHRSAIGT
                     LVERSTRYLMLLHLPNGAHKAEHFHQVLARTIQTLPSQFKRSLTWDQGTEMAGHGAFT
                     MATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGSDLSSHSLEHLAAVAAELNGRPR
                     KTLGWETPAERLAKLLAAS"
     gene            155228..155671
                     /locus_tag="SFLA_RS32710"
                     /old_locus_tag="Sfla_6606"
                     /db_xref="GeneID:11353783"
     CDS             155228..155671
                     /locus_tag="SFLA_RS32710"
                     /old_locus_tag="Sfla_6606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825981.1"
                     /db_xref="GI:754215667"
                     /db_xref="GeneID:11353783"
                     /translation="MRRGKPGSKMHVLSDANGLPLLVGISAANTHDSLALKPMVEGHQ
                     TRHAPHRGRNFKPQRLHADKAYDVPHLRRWLWGKHIGVRIARKGVESSERLGRRRWVI
                     ERTMSWLSGYRRLNHRYERQPRNYLACLGLTAALCCYKRLLRLAT"
     gene            <155716..>155844
                     /locus_tag="SFLA_RS32715"
                     /db_xref="GeneID:23391539"
     CDS             <155716..>155844
                     /locus_tag="SFLA_RS32715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016571124.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin Doc"
                     /protein_id="WP_037660087.1"
                     /db_xref="GI:739808161"
                     /db_xref="GeneID:23391539"
                     /translation="LQLLPYRNSLFACQVAAAYMHTCSEGTDPPYGAMVDLVRGIQA"
     gene            complement(156229..156588)
                     /locus_tag="SFLA_RS32720"
                     /db_xref="GeneID:23391540"
     CDS             complement(156229..156588)
                     /locus_tag="SFLA_RS32720"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030639179.1"
                     /db_xref="GI:664101533"
                     /db_xref="GeneID:23391540"
                     /translation="MVEQGEGLLDDIAELAQALDVRRSFAGDDGQDPPVTQLVAVGVG
                     VVALVAEQGVGSPAGPAGAARDGWAAVDQGEGLGDVVDVGRGGDDLERCVAAVADQVV
                     FAACLPPVDLSSTFFTP"
     gene            complement(156840..157502)
                     /locus_tag="SFLA_RS32725"
                     /old_locus_tag="Sfla_6609"
                     /db_xref="GeneID:11353786"
     CDS             complement(156840..157502)
                     /locus_tag="SFLA_RS32725"
                     /old_locus_tag="Sfla_6609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140748.1"
                     /db_xref="GI:503906754"
                     /db_xref="GeneID:11353786"
                     /translation="MDTDADAGSLDWARAWMCATFTRGLAPEEVFARYGADPDQARLL
                     GCEAASDLPSGESGGGMVSLLRAGSIGGWAFCVEEDGGIGFGEESLAELSRGTETYSV
                     ATTEGIDVFQYWRDGECVEYFEPGMEHSRSEPLGPWWDRVEEALAAHKGEGAGMAPVV
                     ALVLNHLGITLDDAALAGPWPSLTLADDDAPAARLGHTYAGEGPVPPGTVLDFGPSSG
                     LS"
     gene            complement(<158690..158905)
                     /locus_tag="SFLA_RS32730"
                     /old_locus_tag="Sfla_6611"
                     /db_xref="GeneID:11353788"
     CDS             complement(<158690..158905)
                     /locus_tag="SFLA_RS32730"
                     /old_locus_tag="Sfla_6611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004978506.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030639178.1"
                     /db_xref="GI:664101532"
                     /db_xref="GeneID:11353788"
                     /translation="MSPSGWRRLAKAHGVRRRVVIVGGHVIRRPFLLLALAGLVFLIT
                     WFGRDLPLLYGMAPLGAVLIGGSMGRYR"
     gene            159256..159864
                     /locus_tag="SFLA_RS32735"
                     /old_locus_tag="Sfla_6612"
                     /db_xref="GeneID:11353789"
     CDS             159256..159864
                     /locus_tag="SFLA_RS32735"
                     /old_locus_tag="Sfla_6612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ankyrin"
                     /protein_id="WP_041825984.1"
                     /db_xref="GI:754215670"
                     /db_xref="GeneID:11353789"
                     /translation="MDIADQLARAARDGDAAAATQLLGAGAQVDGLGMVRRTALDLAV
                     HAGHAETVRVLLAAGADLRQRAGEYGELTPLCLAAVLGHAAVVEILLAAGAPTGAQGE
                     MGYVPLVLAATATEQGHPQTVDVLLRHGVDINGVMKDKTSLEWAADFGQLQMVHQLLA
                     RGAIPTVKALSSARAGRERSPEIADKYTLIVDALHAAGIDED"
     gene            complement(160000..160296)
                     /locus_tag="SFLA_RS32740"
                     /old_locus_tag="Sfla_6614"
                     /db_xref="GeneID:11353791"
     CDS             complement(160000..160296)
                     /locus_tag="SFLA_RS32740"
                     /old_locus_tag="Sfla_6614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140752.1"
                     /db_xref="GI:503906758"
                     /db_xref="GeneID:11353791"
                     /translation="MKVVHDGVNRVPIERSLVVDPVLKHALRHLRFVKSRQLSNADFV
                     EFADWRERIAEALDALAGVLVFKEDRSRARAEATAAREEAAEVRRRGEIGASER"
     gene            complement(160444..160716)
                     /locus_tag="SFLA_RS32745"
                     /old_locus_tag="Sfla_6615"
                     /db_xref="GeneID:11353792"
     CDS             complement(160444..160716)
                     /locus_tag="SFLA_RS32745"
                     /old_locus_tag="Sfla_6615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140753.1"
                     /db_xref="GI:503906759"
                     /db_xref="GeneID:11353792"
                     /translation="MSEPTQPRIHGSDHDSADPYTTLPGHEYVELTGGPIDGQLLNVT
                     GLTADERTAGAYLITPHSTHGPGGRASYGPTFTRPDGPWVWEGNVP"
     gene            complement(160829..161248)
                     /locus_tag="SFLA_RS32750"
                     /old_locus_tag="Sfla_6616"
                     /db_xref="GeneID:11353793"
     CDS             complement(160829..161248)
                     /locus_tag="SFLA_RS32750"
                     /old_locus_tag="Sfla_6616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014140754.1"
                     /db_xref="GI:503906760"
                     /db_xref="GeneID:11353793"
                     /translation="MPYDRTVTVNAPFDQVQRDVRNALADQGFGILTEIDVQATLKAK
                     LDHDMEPYLILGACNPPLAHRALETDHTIGLLLPCNVVVRSDVDRVIVQAVDPSTMVT
                     LTGLDAMAPVAEEATRRLDAALASVEAAGRESQDQVA"
     gene            161410..162767
                     /locus_tag="SFLA_RS32755"
                     /note="beta-lactamase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391541"
     gene            162810..163175
                     /locus_tag="SFLA_RS32760"
                     /old_locus_tag="Sfla_6618"
                     /db_xref="GeneID:11353795"
     CDS             162810..163175
                     /locus_tag="SFLA_RS32760"
                     /old_locus_tag="Sfla_6618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_014140755.1"
                     /db_xref="GI:503906761"
                     /db_xref="GeneID:11353795"
                     /translation="MFLFNRKASRLSVDQARTRTGGEQPEAVLLDVREKPEWKDGHAP
                     DAVSAPLSGLVGGAPLPAPAQGQALVVICRSGHRSQRAAKLLAERGADAVDVEGGMNA
                     WAAAGYPVVDERGNSGSIS"
     gene            163172..163915
                     /locus_tag="SFLA_RS32765"
                     /old_locus_tag="Sfla_6619"
                     /db_xref="GeneID:11353796"
     CDS             163172..163915
                     /locus_tag="SFLA_RS32765"
                     /old_locus_tag="Sfla_6619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140756.1"
                     /db_xref="GI:503906762"
                     /db_xref="GeneID:11353796"
                     /translation="MSVLILALIAGAVIGLALGALGGGGSVLAVPALIYLLGFSPASA
                     TTASLIIVTATSATALYAHARDGNVAWKVGTLFAAAGIVPAFLAGAAAGYLPAAVLTG
                     AFSVVAALAALRMLRPAMSEPPERVRPVKAVGTGVGLGAVTGFLGVGGGFLAVPALVG
                     VLGLRMKQAVGTSLLVITVNSLAALTARTGTGGDLRWEVIAPFTGAAILGAWDGKRLA
                     SKITGQALQRVFAFVLLAVAALMLIDVIL"
     gene            complement(163940..164227)
                     /locus_tag="SFLA_RS32770"
                     /old_locus_tag="Sfla_6620"
                     /db_xref="GeneID:11353797"
     CDS             complement(163940..164227)
                     /locus_tag="SFLA_RS32770"
                     /old_locus_tag="Sfla_6620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007451576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140757.1"
                     /db_xref="GI:503906763"
                     /db_xref="GeneID:11353797"
                     /translation="MELDLAGAELKAVLNRLRRAQGQIAGVIRMIEEGRDCEEVVTQL
                     AAASRALDRAGFAIIATGLQQCLTDTENGMRSGEDPDEMRGRLEKLFLSLA"
     gene            164307..164882
                     /locus_tag="SFLA_RS32775"
                     /old_locus_tag="Sfla_6621"
                     /db_xref="GeneID:11353798"
     CDS             164307..164882
                     /locus_tag="SFLA_RS32775"
                     /old_locus_tag="Sfla_6621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014140758.1"
                     /db_xref="GI:503906764"
                     /db_xref="GeneID:11353798"
                     /translation="MPTPTTLATSEARTRLHELTVIDVRTPGEYAGGHLPGALNIPLD
                     QIQRALPDIRHAAERGDVLVVCASGARSENACRILADNHIATATLSGGTGAWAADGHD
                     LHRPQGATRAAWGMERQVRLTAGTVVLIGLLLGLLIHPAFQILSAAIAAGLAFSALTD
                     TCGMAAMLAKLPHNRPHAADLDNTLAELRNR"
     gene            complement(<164998..165818)
                     /locus_tag="SFLA_RS32780"
                     /note="thiol-disulfide oxidoreductase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391542"
     gene            complement(165815..166583)
                     /locus_tag="SFLA_RS32785"
                     /note="DSBA oxidoreductase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391543"
     gene            complement(166621..167115)
                     /locus_tag="SFLA_RS32790"
                     /old_locus_tag="Sfla_6624"
                     /db_xref="GeneID:11353801"
     CDS             complement(166621..167115)
                     /locus_tag="SFLA_RS32790"
                     /old_locus_tag="Sfla_6624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014140759.1"
                     /db_xref="GI:503906765"
                     /db_xref="GeneID:11353801"
                     /translation="MSSSPRSWSRAGATLRTWRARQWAVVGLGALATALVVGVPTAVV
                     PSPLFSRSVPVQWWNYPALFATAALAGITLGTYVHQPYQREQSGVRDGSRLGVVGSVL
                     TFFAVGCPVCNKLVLVLLGASGAISYWAPLQPLLAVLSLGLLAEAALRRLSFQSVCPV
                     PASA"
     gene            167859..168233
                     /locus_tag="SFLA_RS32795"
                     /old_locus_tag="Sfla_6625"
                     /db_xref="GeneID:11353802"
     CDS             167859..168233
                     /locus_tag="SFLA_RS32795"
                     /old_locus_tag="Sfla_6625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140760.1"
                     /db_xref="GI:503906766"
                     /db_xref="GeneID:11353802"
                     /translation="MRKIMCVAVSVMVWGCLGQAPASASGTAEDGPVGIGVMGEGLKV
                     REVRALLDGWQDGARARVSLWQGGAYVRTVRGWKATSARETRGHRFEYAAWKINKSFP
                     HRSQLCVEFTGHDRMPCVTIKR"
     gene            complement(168324..168623)
                     /locus_tag="SFLA_RS32800"
                     /old_locus_tag="Sfla_6626"
                     /db_xref="GeneID:11353803"
     CDS             complement(168324..168623)
                     /locus_tag="SFLA_RS32800"
                     /old_locus_tag="Sfla_6626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140761.1"
                     /db_xref="GI:503906767"
                     /db_xref="GeneID:11353803"
                     /translation="MSFIQTGKIELRSDNAIETTGGNTSTFTRVTFPTPFPSGTEVVV
                     FPLTQTFNGPETPGIRIHEVTTTGFLIRMNEVYAGSAKSDGKHTTETIGWLASTV"
     gene            complement(168883..169197)
                     /locus_tag="SFLA_RS32805"
                     /old_locus_tag="Sfla_6627"
                     /db_xref="GeneID:11353804"
     CDS             complement(168883..169197)
                     /locus_tag="SFLA_RS32805"
                     /old_locus_tag="Sfla_6627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140762.1"
                     /db_xref="GI:503906768"
                     /db_xref="GeneID:11353804"
                     /translation="MTNHCCEAMSRHVNVRCDQHDDPFACPDALIKFSAKFQEYGLII
                     HDGGTSSSTIDFCPWCGRRLPESQRDRWFDELESRGIDPWEDEVPAEFQDDRWLAALP
                     RD"
     gene            169314..169688
                     /locus_tag="SFLA_RS32810"
                     /db_xref="GeneID:23391544"
     CDS             169314..169688
                     /locus_tag="SFLA_RS32810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015654881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825986.1"
                     /db_xref="GI:754215672"
                     /db_xref="GeneID:23391544"
                     /translation="MPRGRKPGRPPRWSRRQLIDGIRFRTRTGVPWRDVPERYGPWAR
                     SYDLFRRWQRDGTWQRIFSELQAQADAKDLITWDLNIDSTVCRAHQHAAGARKRGTYK
                     PSRPAGSPSSRTTTALGARAAV"
     gene            169730..170137
                     /locus_tag="SFLA_RS32815"
                     /db_xref="GeneID:23391545"
     CDS             169730..170137
                     /locus_tag="SFLA_RS32815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009293563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825988.1"
                     /db_xref="GI:754215674"
                     /db_xref="GeneID:23391545"
                     /translation="MAIVITAGQRGDSPQFEPVLKKVRVARPDAGRPRTRPERVRADK
                     AYASRKNRAYLRRRGIRCTIPDKADQAAHRKKRGSHGGRPPKFDAEDYKARHAVECGI
                     NRLKRHRAVATRYDKLAVRYEATVLVAAINEWL"
     gene            complement(170372..172969)
                     /locus_tag="SFLA_RS32820"
                     /old_locus_tag="Sfla_6629"
                     /db_xref="GeneID:11353806"
     CDS             complement(170372..172969)
                     /locus_tag="SFLA_RS32820"
                     /old_locus_tag="Sfla_6629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_014140763.1"
                     /db_xref="GI:503906769"
                     /db_xref="GeneID:11353806"
                     /translation="MQGISLRPHQVEAVDSIIEGLALPLDGSVPASGQRGQVHMSTGS
                     GKTITAAVAALRLVPRGVVGVLVPTLDLLTQTVEAWRAVGHTAPAVAVCSLGADPLLE
                     ALDVRCTTNPTQLALWTGGEGPLLVFATYASLSPQGLDDDQGDEETGAAPGALERALR
                     GTYGQTMRPFDLLVVDEAHRTSGDLGKAWAAVHDQERVPAARRLYMTATPRLWEASPG
                     SAGADETGGRLVASMDDETLYGPVLFEFGLMESVERGVLARFEIDVLEIRDPQAPGPD
                     ASVEERRGRRLAALQEALLKHADTTGVRSFMTFHSRTLDAMSFARALPETAAELHATD
                     PVTYPGRVGAEWLSGEHPAAHRRAVLGRFADGVDADGWVTEVSVLSSCRVLGEGVDIR
                     GKRGVGAVVFADTRSSPVDIVQVIGRGLRQDPGEGKVSRIVVPVFLEPGEDPSDMMAS
                     PGYRSLVAVLQGLRAHDERVIERMTLGTTTARGKATSVVALDPVREEGNDGDGQEHDA
                     DEDQEEQTDTAPAGTEDSTEDDADEEQHAGSNVPLLRFSLPRDPGTIALFLRTRVLHP
                     DSEIWLTGYNALRHWTREHGSAEVPLDASVELGQERITYALGAWVSEQRRAFRLGTLK
                     AWRADLLNELGMVWSVADAGFWRNLTAARAYHAVHGTLAAPKDAVVEGVAVGQWLANL
                     RKAGGLGKDEVRAGERRAALEAIDPEWHPGWSVEWQRHYATARALLGKEGGLTEVLPG
                     VLVHGCDVGTWVLRQRDAATWETLLPEQRERLEALGLVPLPAVPAKKTTAGGAGAFER
                     GVLALEQYRARTGTVTVPRAHIETVTIDGQEHGVKLGVFLTNSKTRRAKLPAEKLAAL
                     AALGLDWAT"
     gene            173156..174751
                     /locus_tag="SFLA_RS32825"
                     /old_locus_tag="Sfla_6630"
                     /db_xref="GeneID:11353807"
     CDS             173156..174751
                     /locus_tag="SFLA_RS32825"
                     /old_locus_tag="Sfla_6630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014140764.1"
                     /db_xref="GI:503906770"
                     /db_xref="GeneID:11353807"
                     /translation="MTEKLSVEALLEEARLNASIPPPAERLRLREAAKLSRAQVAETC
                     DVGRSTVANWETGHSEPAPPARLPYLRLLKGLAEIYPPDSTPAPAPGPTADPAPQPAP
                     APASVPAAFTAAPETLRGPDGRAIEGDPGPCIRCGIETTYQSTDGRPLHSGAMCQPAD
                     PATPAAPASAPAVSPATTAPASVSPTPVPVPSRPERRARSAARAQADTTALITRAVQD
                     EAERAGGDEEAALKALIKRAIPDVMHLFNETRATGRYDYTAYPALPDVLKKPSKKDPD
                     QIWEARPKFHHPGYSLKVPGDVKVTALDVNAAYLSALKCWLPIGKLEHSTGSDGVDPK
                     RSGVHLITPGEWAHPHLPDPIGDRDEPGALWVTNATLRLLQRLSGPKYGLTDAPVVHE
                     SWTSGATENFLDALRKLLSAARDEAIENNDTLTLEYVKAMYSKFISTMGESIHNREMV
                     RPDWMHIIHSQAYANLWGKAYKAHQAGLAVVAMMGTDELHVTGDWRKVFPEGRGVSQM
                     KVKHGEGKATGEYTVGTVGSVGR"
     gene            174751..175326
                     /locus_tag="SFLA_RS32830"
                     /old_locus_tag="Sfla_6631"
                     /db_xref="GeneID:11353808"
     CDS             174751..175326
                     /locus_tag="SFLA_RS32830"
                     /old_locus_tag="Sfla_6631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140765.1"
                     /db_xref="GI:503906771"
                     /db_xref="GeneID:11353808"
                     /translation="MAGRWMDLGALNARGLPGADALGVAIERMVTGIASSVESERGLA
                     ARLNYLTKTDAGYEAMDRAGIHVSPRTLMAWLAEERIPNKANRSRLDAAYWDLRRRNV
                     AADLKKRLNNHGRGTRIEINPVDQTRVEGRHQRDLSSRSINVRGVWDRAVDAWMNDDY
                     DELDAVWDDIIEDLGSEYDAYSNVSSIGWAA"
     gene            175484..175834
                     /locus_tag="SFLA_RS32835"
                     /old_locus_tag="Sfla_6632"
                     /db_xref="GeneID:11353809"
     CDS             175484..175834
                     /locus_tag="SFLA_RS32835"
                     /old_locus_tag="Sfla_6632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140766.1"
                     /db_xref="GI:503906772"
                     /db_xref="GeneID:11353809"
                     /translation="MPAFDFPQDLLDAQAALDAVQAEHDLFARTLPWSAEPLPGWKSD
                     KKLHSDYVPEKDDSPGYTPEQAERLSGYRARILELTTQIITHPYWATLSGPDRVEART
                     ALKHAHDTPAGPDA"
     gene            175837..176181
                     /locus_tag="SFLA_RS32840"
                     /old_locus_tag="Sfla_6633"
                     /db_xref="GeneID:11353810"
     CDS             175837..176181
                     /locus_tag="SFLA_RS32840"
                     /old_locus_tag="Sfla_6633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018520745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140767.1"
                     /db_xref="GI:503906773"
                     /db_xref="GeneID:11353810"
                     /translation="MPDDTPTPGAISDLEKNRALLEWLRWQVGQTERRVRELEIQEAQ
                     ERARRERARAEMAWKIQPQRSSSAALLHRGGCATYPDQVGLISREDAMVALAEPDIEP
                     CEVCRPQTGLLS"
     gene            complement(176337..177176)
                     /locus_tag="SFLA_RS32845"
                     /old_locus_tag="Sfla_6634"
                     /db_xref="GeneID:11353811"
     CDS             complement(176337..177176)
                     /locus_tag="SFLA_RS32845"
                     /old_locus_tag="Sfla_6634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140768.1"
                     /db_xref="GI:503906774"
                     /db_xref="GeneID:11353811"
                     /translation="MTERRRYPSDLSDARWELVEPVLTAWRAERRGRGLDIGRPPNHD
                     LRSLLDAVLYVNRTGIPWRYLPHDYPHWNTVYAYFARWQEEGVFDQLNSLLRRQVRRQ
                     EGRDDEPTACVIDSQSIKTSTNVPATGQGIDAGKKIVGRKRSIVIDTVGLLLGVLVTA
                     ASVQDSTAGRTLIERIAAEHPTIRKTWVDGGYRQHLVEHAATLGIDMHIVRRDTATRG
                     FTVLPRRWTVERTLGWLMNHRRLARDYEAHPHRSEAMIHVAMINLMTRRLSAESTPTW
                     RGA"
     gene            177566..177991
                     /locus_tag="SFLA_RS32850"
                     /old_locus_tag="Sfla_6635"
                     /db_xref="GeneID:11353812"
     CDS             177566..177991
                     /locus_tag="SFLA_RS32850"
                     /old_locus_tag="Sfla_6635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140769.1"
                     /db_xref="GI:503906775"
                     /db_xref="GeneID:11353812"
                     /translation="MPYSPLLVRPMKEELTAIGFKELLTAEEVDTAMKDAEKGLTLVA
                     VNAVNGAAAGMARPGVRRALEDSSKRPDRLVTVFAEQDLEATAQMRGYFPDIPPSAPS
                     FALFKDGELVHFIPCHRIEGRDASAVATDLRAAFDEHGQ"
     gene            complement(178002..178850)
                     /locus_tag="SFLA_RS32855"
                     /old_locus_tag="Sfla_6636"
                     /db_xref="GeneID:11353813"
     CDS             complement(178002..178850)
                     /locus_tag="SFLA_RS32855"
                     /old_locus_tag="Sfla_6636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140770.1"
                     /db_xref="GI:503906776"
                     /db_xref="GeneID:11353813"
                     /translation="MRGRRYPTDTTDTEWALIEPLLPVPACDTVVGGRPEKHPRREIV
                     DAIRYVVDTGCKWRALPADFPPWRTIWGFMARWAAAGIVNQIRDHLASRIRRELGKSP
                     RAVATVIDSQSVKAAETVSRATRGYDAGKKINGRKRHLVVDTRGLPLMVMVTPASLSD
                     RDAAKEILFRLRLTHPEITIVWADSAYAGKLVTWAKRHLNLTVKPVSRPKDTTGFIVL
                     PRRWVVERSLAWMMHARRHARDYERLVQHSETLITWAAITLMTRRLARKGATSGWPSK
                     AAPTAG"
     gene            complement(178924..>179118)
                     /locus_tag="SFLA_RS32860"
                     /db_xref="GeneID:23391546"
     CDS             complement(178924..>179118)
                     /locus_tag="SFLA_RS32860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015607684.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RacP protein"
                     /protein_id="WP_041826020.1"
                     /db_xref="GI:754215713"
                     /db_xref="GeneID:23391546"
                     /translation="LGAERAALEAYERQVVGEKLTQFRRFITGTVAPHAAAHPNDKWV
                     RHIVAQLNSIESTLDLIASA"
     gene            179473..180486
                     /locus_tag="SFLA_RS32865"
                     /old_locus_tag="Sfla_6638"
                     /db_xref="GeneID:11353815"
     CDS             179473..180486
                     /locus_tag="SFLA_RS32865"
                     /old_locus_tag="Sfla_6638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018522911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140772.1"
                     /db_xref="GI:503906778"
                     /db_xref="GeneID:11353815"
                     /translation="MIRAGRRHLVRTLADLAAQQGVRTHSYLNAKHHLVDGFPAPIGS
                     AGARVRLYDAEQVDAFLTGQPIPPLPAHDDDQDLLDRRESADALGLSPRSWDKYKTTD
                     PLLTEHQVTVGGVEHWPRAIVNQYQARRTSKVQAPSGRPTRSGDQVPRDQLLPLTAPL
                     LDADPTITAVRVTEELGVHRDTAQDALLRLRADRIAHLMLTDPPLTPDQSAAALGYPA
                     GQVRRATVRAQAVVRAHRVAPYLADVAHALHQAGWTATAAVPDIQHPADDLVVAALVL
                     DGTSAPAPALVWDERHGWRTATSRRHPLTKGAVPPPPGDGIRYLAQGTTPPPDALTAA
                     LTA"
     gene            181073..181422
                     /locus_tag="SFLA_RS32870"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391547"
     gene            complement(181438..182814)
                     /locus_tag="SFLA_RS32875"
                     /old_locus_tag="Sfla_6640"
                     /db_xref="GeneID:11353817"
     CDS             complement(181438..182814)
                     /locus_tag="SFLA_RS32875"
                     /old_locus_tag="Sfla_6640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003963841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825990.1"
                     /db_xref="GI:754215677"
                     /db_xref="GeneID:11353817"
                     /translation="MDMDDLAWQASNYRGLPPRTVRLLLEHGHLNLVAQAAVDRGEWF
                     CAEGAVEELCQAGDFGRALSVMEPFVAAGWRAALYAKAEILLRAGRRTEEALDLLRPE
                     DSGWVSTTECRDLAEVLGKAGRIDEAIELLVPHLDKSWLLSVLVDITDGQGRDERVLE
                     LIAPLVDRAREARGEVHRDYAFSDAQELQARVLERAGRADEAIRILGQDIAGRRFLAQ
                     NTLIAYAELLARHGRLDELRELGGGQDAHTVLDIYAGALRSHGRVEEAEAVMRDAIAA
                     DDWVGYRAWLSSMLLAEGRLEDAIVVAEPGFGWYDCSNLLAPLVHPLLDRPEELLYLV
                     EHPRVVPHHGHEEFQHWWRAWALAGLGRVDEAITVAGLDRPWTDPRIVKADLLKRAGR
                     LDEAADELRALGTIKAREELCEILVLQGRADEAIAVHPTVAEQRAAEPKPKPVPLGDN
                     GYSLEPPF"
     gene            complement(183057..183824)
                     /locus_tag="SFLA_RS32880"
                     /old_locus_tag="Sfla_6641"
                     /db_xref="GeneID:11353818"
     CDS             complement(183057..183824)
                     /locus_tag="SFLA_RS32880"
                     /old_locus_tag="Sfla_6641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041826022.1"
                     /db_xref="GI:754215715"
                     /db_xref="GeneID:11353818"
                     /translation="MVTGASNGIGYEIARLCAANGFDLVATGRSAKIDEAAERFTRDG
                     AHVIPVRADLADTDEVETVWKAVEKTGRPLAAAVLNAGRSIGGAFLDTDLDDELSLIS
                     LNVTSVVHLAKRVARHMAANSDGKILITSSLSATLPTPYETVYGPSRAFTRMFALGLR
                     EELKEHGVTVTCLMPGATDSDFHARAGMNNTAFGTGAKKNSRKEVARQGFVAMMEGRA
                     EIVGGDAATKRTAIEHRFLPETYKAARHATKAKPRQR"
     gene            complement(183851..184756)
                     /locus_tag="SFLA_RS32885"
                     /old_locus_tag="Sfla_6642"
                     /db_xref="GeneID:11353819"
     CDS             complement(183851..184756)
                     /locus_tag="SFLA_RS32885"
                     /old_locus_tag="Sfla_6642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014140775.1"
                     /db_xref="GI:503906781"
                     /db_xref="GeneID:11353819"
                     /translation="MAGNVDLTQFLRRCRDRIDPESLGLPERGAYRRVPGLRREEVAQ
                     LAGVSTDYYTRLEQGRSITPSDSVLDAIAEALRLDSAERTHLHDLVKTRPGRRARHAT
                     PSVQRARPGLLRFLESFSDHAAFILGRRGDILATNHLCRVLIADFDAMPYRERNLTRW
                     IVLAPEARALYVDWERIAAEMTAILRLDAGRHPDDTRTAQLVGELTMKSEHFRRWWDD
                     HRVLTRTHGQKRFHHPLVGELTIDYQALNPPGEDDQTLFLYMPAGDRTSQEAWRLLAD
                     WNTPAPGRPQPADDAPSPSDDRSSL"
     gene            complement(185399..185587)
                     /locus_tag="SFLA_RS32890"
                     /db_xref="GeneID:23391548"
     CDS             complement(185399..185587)
                     /locus_tag="SFLA_RS32890"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825992.1"
                     /db_xref="GI:754215679"
                     /db_xref="GeneID:23391548"
                     /translation="MIPVDRIDYYGQQAVEAFWAAHQEGVGTGRLGVSGRRSGAGHGR
                     PGAGVQCPWSALRPSTPY"
     gene            complement(185887..186927)
                     /locus_tag="SFLA_RS32895"
                     /old_locus_tag="Sfla_6643"
                     /db_xref="GeneID:11353820"
     CDS             complement(185887..186927)
                     /locus_tag="SFLA_RS32895"
                     /old_locus_tag="Sfla_6643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140776.1"
                     /db_xref="GI:503906782"
                     /db_xref="GeneID:11353820"
                     /translation="MFIAGLGVMLGALWSVPSHAAGATVTGAGSVTRGVLAVDTDLTP
                     GVTIDLVRRSMTLSAGEKRHLRGRLEATSTTTGIVGLTQRIRCLNASGATVPVVAASA
                     RNHEGSDTTTYATPGHLPLYADLLFTAPAAGTYTCVLQGTAYSSLPGSYHLTAVASNT
                     WLESDDTDRSGARWWQNPACESDDSAGACTYLGGGAARPDAWVFYDDGTPVYKWQAHP
                     DAVSVSAQANLELTTCYQGTASCAASMEVYPRGKNAVVDARFELVQLDATGHACRTNS
                     VTARRTITDDAHHAVGYSFLTDVPIDPACGTRTFLLRIYVKHVSGQTVKIDGIQSGAT
                     SLTNGIAFNNFN"
     gene            187618..188007
                     /locus_tag="SFLA_RS32900"
                     /old_locus_tag="Sfla_6644"
                     /db_xref="GeneID:11353821"
     CDS             187618..188007
                     /locus_tag="SFLA_RS32900"
                     /old_locus_tag="Sfla_6644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014156313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proteinase inhibitor I36 SMPI"
                     /protein_id="WP_014140777.1"
                     /db_xref="GI:503906783"
                     /db_xref="GeneID:11353821"
                     /translation="MTWKKRIAGTASVMLLAAGGMMATASPAAADGPCPANRLCIYDG
                     ANFTGNRIASGSTNSCFFPQDFTFDAIVSYDNNLPVDAKVYHYYADIDAYTVARTLVS
                     GGFSSNIGVANLGGAFGDLVCMGSARP"
CONTIG      join(CP002476.1:1..188552)
//
DBGET integrated database retrieval system