GenomeNet

Database: RefSeq
Entry: NC_016110
LinkDB: NC_016110
Original site: NC_016110 
LOCUS       NC_016110             188552 bp    DNA     linear   CON 14-MAY-2014
DEFINITION  Streptomyces pratensis ATCC 33331 plasmid pSFLA01, complete
            sequence.
ACCESSION   NC_016110
VERSION     NC_016110.1  GI:357409092
DBLINK      BioProject: PRJNA40839
            BioSample: SRS152855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Streptomycineae; Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 188552)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid1 of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 188552)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 188552)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002476.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..188552
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /plasmid="pSFLA01"
                     /collected_by="Waksman and Lechevalier"
     gene            complement(1089..1976)
                     /locus_tag="Sfla_6444"
                     /db_xref="GeneID:11353822"
     CDS             complement(1089..1976)
                     /locus_tag="Sfla_6444"
                     /inference="similar to AA sequence:KEGG:SCAB_2941"
                     /note="KEGG: scb:SCAB_2941 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909380.1"
                     /db_xref="GI:357409093"
                     /db_xref="GeneID:11353822"
                     /translation="MNPPSAPDIYKDVPGAEVVFNAVAGEKSYLWSRNLTATSVSALK
                     SGDNIGMTFAVRCQYSSGSALPQGAETGAYWAANLVPPGETSLAPGLRWLFQAPTTAT
                     YKCRLSVTSYSSIINNDRQVTMRIPAGAELGRLAVGSGATRWTLPTASATTVARGTTA
                     TTLGYTYTPTDGKQTTIVQDANLTTCVAGSRICAGGTSAYQGTEAETWIEAQPQMPNG
                     DPCGGPIKGPVAKWSIPDAKHHQAATNTLNITKTQLGGCTQIRASLKVKDTAGNPVYI
                     HAGHASEQIAATHGLAYTL"
     gene            complement(2207..2620)
                     /locus_tag="Sfla_6445"
                     /db_xref="GeneID:11353623"
     CDS             complement(2207..2620)
                     /locus_tag="Sfla_6445"
                     /inference="similar to AA sequence:KEGG:SAV_743"
                     /note="KEGG: sma:SAV_743 peptidase inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase inhibitor"
                     /protein_id="YP_004909381.1"
                     /db_xref="GI:357409094"
                     /db_xref="GeneID:11353623"
                     /translation="MQLKRIGTTLAGILALAVGGTLVNAAPAAAVGGCPSDKLCLYRS
                     TEYRTLAFTAASTQACFWLSSYGMGPGTNGINSYVNNLPVKATIWNTNDLNNWYAHGT
                     IRPGGYTSDTGAVTGGEFSWWKESNMICTGSAVPD"
     sig_peptide     complement(2543..2620)
                     /locus_tag="Sfla_6445"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.980 at
                     residue 26"
     gene            complement(2731..3086)
                     /locus_tag="Sfla_6446"
                     /pseudo
                     /db_xref="GeneID:11353624"
     gene            complement(3305..3484)
                     /locus_tag="Sfla_6447"
                     /db_xref="GeneID:11353625"
     CDS             complement(3305..3484)
                     /locus_tag="Sfla_6447"
                     /inference="similar to AA sequence:KEGG:SCP1.339c"
                     /note="KEGG: sco:SCP1.339c hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909382.1"
                     /db_xref="GI:357409095"
                     /db_xref="GeneID:11353625"
                     /translation="MPTSDRPLLLLLLVLVVGLVLGALAYLSYEHPALTEPLTLVLAG
                     AAVLVPCIALTVTRR"
     sig_peptide     complement(3407..3484)
                     /locus_tag="Sfla_6447"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.881 at
                     residue 26"
     gene            4956..6290
                     /locus_tag="Sfla_6448"
                     /db_xref="GeneID:11353626"
     CDS             4956..6290
                     /locus_tag="Sfla_6448"
                     /inference="protein motif:PFAM:PF04892"
                     /note="PFAM: VanZ family protein; Propeptide PepSY amd
                     peptidase M4;
                     KEGG: kra:Krad_3089 VanZ family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="YP_004909383.1"
                     /db_xref="GI:357409096"
                     /db_xref="GO:0008237"
                     /db_xref="GO:0008270"
                     /db_xref="InterPro:IPR005075"
                     /db_xref="InterPro:IPR006976"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="GeneID:11353626"
                     /translation="MLQTVFNGRGEFVLIALAAVTIAALVGYFAARKFLDRPWAYAGL
                     FATLAAELSVTIFFPSPGHVSGQCVLNRNYNEPFATEQGLLNVAMFLPIGLFGVLALR
                     RVFPVFLGGALLSVATELGQALAPWVGRSCDSGDVLTNTLGAGIGALIGWAIVRAVRG
                     EVHSLRSAGKPAVVVFAVGFIVCAVVWEAWITPLAVDSTSLQIAGGDEKAQAQQVLAA
                     AFDDHVDIKNVQLQSGQNDAPDLLMITLESGFAELSWPDKEQLTVSLESTSQPGPGSF
                     AVPGAGAAPESADDALRIATKYAKERFPWGLEDSHVKSFPVGDDAEFGWMVSWRSRVD
                     GVLMPMRLDVQINRAGRVSALLTRHAEDFTSIPPRKVSEKQAAATASKYAGGAKTAAG
                     TLLAIRREGEWRAQWVIPVSSGTDSYPVYVDAETGKVDERASPVQGLPTAPN"
     misc_feature    5085..5405
                     /locus_tag="Sfla_6448"
                     /note="VanZ like family; Region: VanZ; cl01971"
                     /db_xref="CDD:261134"
     gene            complement(6389..7396)
                     /locus_tag="Sfla_6449"
                     /db_xref="GeneID:11353627"
     CDS             complement(6389..7396)
                     /locus_tag="Sfla_6449"
                     /inference="similar to AA sequence:KEGG:Sros_0053"
                     /note="KEGG: sro:Sros_0053 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909384.1"
                     /db_xref="GI:357409097"
                     /db_xref="GeneID:11353627"
                     /translation="MAVFGCAGCGAVLTRAVSEVALPIHLADTHWETLHPPLLEAGSY
                     AVDPAPFGPPWRQWDEVGAREAAERGRFAPFGALSNGPSDTVLLAPGDMRGTRLILER
                     AGGYCMGIDGRDGPNLACLGCDLPVGTRIDDCGCWQVVRLLPQTVVRLPGPPERPIME
                     WAELLATGTLWHRLSEYRDIPAGVAIAQVVVAAGGAPVDVAPGLVAELLGRALGALLP
                     AGEGAKRLDLAGPGFGEPTADLVLVPVHPQTGDMWQPRAGAVPVPMDAALWAELAFPP
                     HRTRLPVVGGLPAGVERDDPLPPHPWYPFQPSREAFRYTLARMPAAREPWLRAIYDRG
                     C"
     gene            complement(7560..8174)
                     /locus_tag="Sfla_6450"
                     /db_xref="GeneID:11353628"
     CDS             complement(7560..8174)
                     /locus_tag="Sfla_6450"
                     /inference="similar to AA sequence:KEGG:Sros_8269"
                     /note="manually curated;
                     KEGG: sro:Sros_8269 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909385.1"
                     /db_xref="GI:357409098"
                     /db_xref="GeneID:11353628"
                     /translation="MEEGGVAAGKSTAAARGAWIVCEDEASQSLRPPRARSWGRIGQT
                     PVVRVRGRGSGRVSMAGMVCFRRGDRSRLIYSFRVHRGRKGEPKGFTWQDYRDLILRA
                     HNQLKGPIVLVWDNLRTHLMPQMKDFIAANEDWLIVFHFPPYAPDLNPQEGIWSLMKQ
                     AIGNLAAANLEQLATAVKRSLKKTQYRPHLIDGCLIGTGLTLTS"
     misc_feature    complement(7656..8117)
                     /locus_tag="Sfla_6450"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            8364..8708
                     /locus_tag="Sfla_6452"
                     /db_xref="GeneID:11353629"
     CDS             8364..8708
                     /locus_tag="Sfla_6452"
                     /inference="similar to AA sequence:KEGG:SCAB_89241"
                     /note="manually curated;
                     KEGG: scb:SCAB_89241 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909386.1"
                     /db_xref="GI:357409099"
                     /db_xref="GeneID:11353629"
                     /translation="MRSEVGAAAAFWCGEPTGVGREHHVEWTVEEDVALGGNTRPATS
                     FSPGVDEEEGGRIVFRGRLGLTGDGGAMLEVAGTHILFDLADPAPSAAVDGTWVEISV
                     ERNSVSLWPYLL"
     gene            complement(8683..9501)
                     /locus_tag="Sfla_6453"
                     /db_xref="GeneID:11353630"
     CDS             complement(8683..9501)
                     /locus_tag="Sfla_6453"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: stp:Strop_4179 transposase, IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909387.1"
                     /db_xref="GI:357409100"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11353630"
                     /translation="MPRRQRPYPSDLSDARWELLEPTLTAWRVERRGKGLDIGRPPEH
                     DLRRIMDAILYVDRTGIPWRYLPRDFAPWETVYGYFAAWQKDGVFDQLNGLLRRLVRK
                     AGGRDAEPSACILGAQSIKTSANVPAAGQGIDAGKKIAGRKRHIGVDTVGLLLAVLVT
                     AASVSDNVGGIRLLSNIAEGHPRVTKAWADSGYRTKAIDHGARLGIDVEVIRRDPAQK
                     GFKVIPRRWVVERTFGWLMHHRRLARDYETNPHRSEVMINIAMIDLITAGRATG"
     misc_feature    complement(9169..9480)
                     /locus_tag="Sfla_6453"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(9223..9468)
                     /locus_tag="Sfla_6453"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    complement(9097..9276)
                     /locus_tag="Sfla_6453"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     misc_feature    complement(8716..9183)
                     /locus_tag="Sfla_6453"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(8716..8943)
                     /locus_tag="Sfla_6453"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            9790..10685
                     /locus_tag="Sfla_6454"
                     /pseudo
                     /db_xref="GeneID:11353631"
     gene            complement(10604..11008)
                     /locus_tag="Sfla_6455"
                     /db_xref="GeneID:11353632"
     CDS             complement(10604..11008)
                     /locus_tag="Sfla_6455"
                     /inference="similar to AA sequence:KEGG:Achl_0949"
                     /note="KEGG: ach:Achl_0949 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909388.1"
                     /db_xref="GI:357409101"
                     /db_xref="GeneID:11353632"
                     /translation="MERVGSARELVLGYVHALNAVDEVMRAAIPSLERLADVLGLVRS
                     RRIISRSGHIGAYSYTVHGAGCRFVSDNGTEIDVDFATDGSEIFDLWRLRWYGLSLPE
                     PLDVMDQDLRAAVQSLQPLLTEVQPGWFSVAS"
     misc_feature    complement(<10664..10840)
                     /locus_tag="Sfla_6455"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:260929"
     gene            complement(11093..11350)
                     /locus_tag="Sfla_6456"
                     /db_xref="GeneID:11353633"
     CDS             complement(11093..11350)
                     /locus_tag="Sfla_6456"
                     /inference="similar to AA sequence:KEGG:Rmar_1634"
                     /note="KEGG: rmr:Rmar_1634 CRISPR-associated RAMP protein,
                     Csm4 family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909389.1"
                     /db_xref="GI:357409102"
                     /db_xref="GeneID:11353633"
                     /translation="MRLEKVLVDQGFKEAVHRAGRVNITELLVDLHIQENAATARADE
                     LRNHMPTDEASVNVTRSRLGRLTRQGFLTQPGRGRYQKRTY"
     gene            11485..11769
                     /locus_tag="Sfla_6457"
                     /db_xref="GeneID:11353634"
     CDS             11485..11769
                     /locus_tag="Sfla_6457"
                     /inference="similar to AA sequence:KEGG:Snas_3618"
                     /note="manually curated;
                     KEGG: sna:Snas_3618 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909390.1"
                     /db_xref="GI:357409103"
                     /db_xref="GeneID:11353634"
                     /translation="MIVYPLWHVGHQNEAGDDGSTVHVDESGVFCDESDGDDVKLLGI
                     YSTLERVEERVRQARLLPGFRDEPECFYFDPCELDEDDWTEGFVRVPPGE"
     gene            11925..13142
                     /locus_tag="Sfla_6458"
                     /db_xref="GeneID:11353635"
     CDS             11925..13142
                     /locus_tag="Sfla_6458"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: sma:SAV_256 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909391.1"
                     /db_xref="GI:357409104"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11353635"
                     /translation="MKFSTLCDPGKSVPADVSSLIPPALDQLGPRPGATPSEIPDLLE
                     CLAQVPDPRNPRGVRHPLAAVLALTACAVLAGARSLLAVSEWVAEAPEELLERLGIRV
                     DPLFPKRSWPAETTIRRVLARIDANALDRAVGTWLACRQQDAGGLRALAVDGKSLRGA
                     ARAKGRRVHLLAACDHVGGLVLAQMDVGEKTNEITRFRPLLDTLPDLSGTVVTSDALH
                     TQTDHATYLRGRDTHYIVIVKRNTKKLSTQLKSLPWQQIPLQDRTRTTGHGRCEIRRL
                     KVCTVNNLLFPGARQAVQIVRRRVNRTTGKVSLKTIYAVTSLAAEQAPPARVAQLIRG
                     HWTVEALHHVRDVTFAEDASQLRSGNAPQAMATYRNLAIGALRLAGVRNIAAGLRRTA
                     RDQTRTLTHLGLT"
     misc_feature    12048..12338
                     /locus_tag="Sfla_6458"
                     /note="DDE_Tnp_1-associated; Region: DDE_Tnp_1_assoc;
                     pfam13808"
                     /db_xref="CDD:258088"
     misc_feature    12357..13043
                     /locus_tag="Sfla_6458"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(13135..13697)
                     /locus_tag="Sfla_6459"
                     /pseudo
                     /db_xref="GeneID:11353636"
     gene            complement(13878..14840)
                     /locus_tag="Sfla_6460"
                     /db_xref="GeneID:11353637"
     CDS             complement(13878..14840)
                     /locus_tag="Sfla_6460"
                     /inference="similar to AA sequence:KEGG:SCO4669"
                     /note="KEGG: sco:SCO4669 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909392.1"
                     /db_xref="GI:357409105"
                     /db_xref="GeneID:11353637"
                     /translation="MSIDPADFAARLRAEQNAPGREETLRRERVTRRRKALLGAGAGI
                     LLLGGFGVWLASAMGGRPADEPFAPRMLDEAMWPDAWPATTNIPFRGSPAAAWGNGAL
                     GIRLPQSKAVDGLTDLEVSTSLGAVRDFLIAANLSSQTVYGSKPVGALNFLAPSDPAR
                     RELDAAFTDPSTGRGSLQFLTRFDRDEVQVLASEGMAKTDGTMTYEVTPAGELLVQAD
                     YTFVYALVKTSGAKQINPNGFEVARVVVHRQLDILVRDGKLHLQTHATAIANDDCTAP
                     ADGFIHPLFYDDLKKTKKWASVDPYAEKHADASAPGACVRPTRT"
     gene            15087..15398
                     /locus_tag="Sfla_6461"
                     /db_xref="GeneID:11353638"
     CDS             15087..15398
                     /locus_tag="Sfla_6461"
                     /inference="protein motif:PFAM:PF01527"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: scb:SCAB_1321 putative IS3 family transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_004909393.1"
                     /db_xref="GI:357409106"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:11353638"
                     /translation="MESMGKKKPRRPRRSFTPEFKAEIVGLCRRGDRSVGQVAKDFEL
                     TETAVRDWVKQAGVDAGERNGLTSAEREELAALRRENRRLREDVDVLKRATAFFAKET
                     R"
     misc_feature    15114..15314
                     /locus_tag="Sfla_6461"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    15123..15395
                     /locus_tag="Sfla_6461"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            15395..16267
                     /locus_tag="Sfla_6462"
                     /db_xref="GeneID:11353639"
     CDS             15395..16267
                     /locus_tag="Sfla_6462"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: scb:SCAB_1311 putative integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic region"
                     /protein_id="YP_004909394.1"
                     /db_xref="GI:357409107"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11353639"
                     /translation="MTVHPFIEAEKRAGHSVKRACELMKVSRTAFYARRSGLPGSRAV
                     RDSELTEQITEVHARSRGTYGAPRVHAVLTREGAGCGRRRVARLMQAAGLQGRHRRRR
                     QVTTVPDPRAAFRPDLIVRDFQPGRTGLDARWCGDITYIPTDEGWLYLATVIDIASRR
                     VVGWATADHLRTDLVAEALTAACRQRRPTRPVIFHSDHGCQYTSQQFASLAAGFGVRL
                     SVGRTGQCWDNALAESFFSTIKRELLGTSAWPSRATARTAIFDFIEGWYNLHRLHSSL
                     GYLSPAEYETALAT"
     misc_feature    15464..16255
                     /locus_tag="Sfla_6462"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    15527..15700
                     /locus_tag="Sfla_6462"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    15791..16123
                     /locus_tag="Sfla_6462"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    16037..16237
                     /locus_tag="Sfla_6462"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(16305..16979)
                     /locus_tag="Sfla_6463"
                     /db_xref="GeneID:11353640"
     CDS             complement(16305..16979)
                     /locus_tag="Sfla_6463"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: rer:RER_08640 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004909395.1"
                     /db_xref="GI:357409108"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:11353640"
                     /translation="MAESTDVVVVGAGVIGSSIALELVRSGLRVVVVDKFGAAGNGST
                     SASSAVVRFTYPTIAGVNAAWESRHCWQAWRDHLQAPSSEPLAAFNRCGVTLLDVDFA
                     PCGMFTRHFDKVGVPYEKWDARELSERLPAVDTGRYFPPRPVDDDEFFADASARLGAL
                     HTPDGGFIEDPQLAAHNLATAAQRHGAVFRWKTLVTAVMRRGGRVRGVRLKDGTELSA
                     GVVVNG"
     misc_feature    complement(<16389..16946)
                     /locus_tag="Sfla_6463"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    complement(<16389..16946)
                     /locus_tag="Sfla_6463"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(17370..17972)
                     /locus_tag="Sfla_6464"
                     /db_xref="GeneID:11353641"
     CDS             complement(17370..17972)
                     /locus_tag="Sfla_6464"
                     /inference="similar to AA sequence:KEGG:Amir_3867"
                     /note="KEGG: ami:Amir_3867 putative transcriptional
                     regulator, TetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, TetR family"
                     /protein_id="YP_004909396.1"
                     /db_xref="GI:357409109"
                     /db_xref="GeneID:11353641"
                     /translation="MGVILSTSERKGSARERLLARLLDAFGEALPPPEMSLREVAARI
                     ETSHALLRYHFGSLPGVLAAMLTAQRSRDNEALLEAAQQGTFDDFVVAIWRTYTRPEQ
                     LSRARGFFYVVGLAAYGPEDFREFVESIGDLTVMLSSLAEREGLDTKEAQDAATVTIA
                     AIRGLLLQEVLTPGTRSEDAVTLILGIRKSRSVPRLRPER"
     misc_feature    complement(17406..17954)
                     /locus_tag="Sfla_6464"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     gene            18059..19284
                     /locus_tag="Sfla_6465"
                     /pseudo
                     /db_xref="GeneID:11353642"
     gene            19281..20135
                     /locus_tag="Sfla_6466"
                     /db_xref="GeneID:11353643"
     CDS             19281..20135
                     /locus_tag="Sfla_6466"
                     /inference="protein motif:PFAM:PF00756"
                     /note="PFAM: esterase;
                     KEGG: ami:Amir_3868 putative esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="YP_004909397.1"
                     /db_xref="GI:357409110"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="GeneID:11353643"
                     /translation="MSTMWQGCLPHTDYFEMRSSGGHDYGIWVTTPPNYDPATAQAPV
                     VYVLDGNWAVGMTAPLIVTQLDPMQAIHPYVQVSVGYAGEEAEQWERLRNRDLVPPGE
                     PIAKEYVDAVEMGVETGTMTREQADSYLSELSDSRGDRFLDFLTDDLHPRIERDYGTA
                     RSGHGLFGYSYGGLFSLYAWLTKSTFFESIGAGSPGIVSADSQVFALLRAMGDTLPDT
                     KLHVTFNDREILGDLAVYQNLAKNAATFLHHLTSRSGSVTSALMHETHVTGLQASFLS
                     YLRSCRAQ"
     misc_feature    19326..>19871
                     /locus_tag="Sfla_6466"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2819"
                     /db_xref="CDD:225375"
     gene            20472..21053
                     /locus_tag="Sfla_6467"
                     /db_xref="GeneID:11353644"
     CDS             20472..21053
                     /locus_tag="Sfla_6467"
                     /inference="protein motif:PFAM:PF01144"
                     /note="PFAM: coenzyme A transferase;
                     KEGG: nca:Noca_0331 butyryl-CoA:acetate CoA transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme A transferase"
                     /protein_id="YP_004909398.1"
                     /db_xref="GI:357409111"
                     /db_xref="GO:0008410"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="GeneID:11353644"
                     /translation="MASIGLPAKGWLGVRLPAHTMWEHERKLYSWRKRSFRWDCHQGC
                     WTVASDHFPRICKELLKRYPGALIGREFNPNERCNSSCQNARGFLCTCSCRAKKPRPR
                     EMAQRVEDSGRDLVHGARRVVVLMEHIARDGSFKIVEERSLALTGKRAVQRIITNLCV
                     LDVTTEGLRLVELAPNVSVGDVRARTQPEICCG"
     misc_feature    <20811..21041
                     /locus_tag="Sfla_6467"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            21265..21585
                     /locus_tag="Sfla_6468"
                     /db_xref="GeneID:11353645"
     CDS             21265..21585
                     /locus_tag="Sfla_6468"
                     /inference="protein motif:PFAM:PF03551"
                     /note="PFAM: transcriptional regulator PadR family
                     protein;
                     KEGG: sma:SAV_29 ParR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, PadR-like family"
                     /protein_id="YP_004909399.1"
                     /db_xref="GI:357409112"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="GeneID:11353645"
                     /translation="MTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIAVGTLYGA
                     LERMERAGLVAAGHEEIVDGRARRYYWLTEDGTETLGREALRMQQAAAVVIGRARDTG
                     AAPA"
     misc_feature    21286..21510
                     /locus_tag="Sfla_6468"
                     /note="Transcriptional regulator PadR-like family; Region:
                     PadR; pfam03551"
                     /db_xref="CDD:252023"
     gene            21582..22538
                     /locus_tag="Sfla_6469"
                     /db_xref="GeneID:11353646"
     CDS             21582..22538
                     /locus_tag="Sfla_6469"
                     /inference="similar to AA sequence:KEGG:SAV_30"
                     /note="KEGG: sma:SAV_30 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909400.1"
                     /db_xref="GI:357409113"
                     /db_xref="GeneID:11353646"
                     /translation="MNRLLLSAYPRSYRSRQGNELLACLTEAYPGRSWPPPREVAALV
                     HSGVQARARATVDDTTRPWWLDGVHLAALALAALALVPYLQDVWHWALRIDPGQHAIA
                     FHFSGWYPWAGGPTRIRLLPYGLLPLGCLIALLRGRAWIALPAAAAMIWAGATSHGRT
                     LFGSEGKAGLSYYGLGAPITARDLALSGALCAACTVLALCRPSRLRRRSYRWLAPVVL
                     AMFVAGGLHIISVSPAFQRGLFVLEVTALLGAWVATAATGDHRWLIPVAAVAIVRTQA
                     IVVQPDAFMQSLPDVVVLILLVAPLPALAITAQRRQARALAE"
     gene            22631..23542
                     /locus_tag="Sfla_6470"
                     /db_xref="GeneID:11353647"
     CDS             22631..23542
                     /locus_tag="Sfla_6470"
                     /inference="protein motif:PFAM:PF01569"
                     /note="PFAM: phosphoesterase PA-phosphatase related;
                     KEGG: sma:SAV_31 prepilin peptidase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase PA-phosphatase related protein"
                     /protein_id="YP_004909401.1"
                     /db_xref="GI:357409114"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="GeneID:11353647"
                     /translation="MTQHDSPILPAHHPRASRQAPEAPDNHSPSRSTRSWMPALLYTL
                     GFLTVYLLAICTPWGQRAENALFGLGRANPEDVWIYPLSGAAYGSTPLPPLELSAKPT
                     LMVGLAVIVLLTLVRRCWWQGCAALGVVVLTTGGKEVLRSILPRPDLVGAPENLLDQG
                     FPSGHTAIPAALTLAAVLLVSPRIRPYAATAGVLWLACIAAYSATNGGHRPSEVLGAA
                     LLACACYSLATWLLPPAAAPGAMWSPRALPVFTLTLALAIALVSGARNDTLTRSLVSA
                     ATGFVCAAMVWYAAVGRPARRTRPTLG"
     misc_feature    <22940..23380
                     /locus_tag="Sfla_6470"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    22997..23332
                     /locus_tag="Sfla_6470"
                     /note="PAP2 superfamily; Region: PAP2; pfam01569"
                     /db_xref="CDD:250712"
     misc_feature    order(23039..23041,23066..23068,23117..23125,23255..23257,
                     23267..23269)
                     /locus_tag="Sfla_6470"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            23670..23951
                     /locus_tag="Sfla_6471"
                     /pseudo
                     /db_xref="GeneID:11353648"
     gene            24209..24538
                     /locus_tag="Sfla_6472"
                     /db_xref="GeneID:11353649"
     CDS             24209..24538
                     /locus_tag="Sfla_6472"
                     /inference="similar to AA sequence:KEGG:SGR_2438"
                     /note="KEGG: sgr:SGR_2438 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909402.1"
                     /db_xref="GI:357409115"
                     /db_xref="GeneID:11353649"
                     /translation="MGAAYYRAESESGHHVEDPSEDALFTLIDDLNGSDNTFVVVQPD
                     EDDPVWFTSVAVLDEGGYEVVRRDTIRREHDVVTETNIDRIARDLTIWMAARDFPGRP
                     TQHASNF"
     gene            complement(24607..25377)
                     /locus_tag="Sfla_6473"
                     /db_xref="GeneID:11353650"
     CDS             complement(24607..25377)
                     /locus_tag="Sfla_6473"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: scb:SCAB_10801 putative transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909403.1"
                     /db_xref="GI:357409116"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11353650"
                     /translation="MGGVLRAEPLWVETFTGLRMGRFEKLVKVVRERGGNGPGGGRPW
                     CLPLADRVLLVAVYYRTNLTMRQLAPPFGISPATVCRVIHRLRPLLALEPAPRPVADV
                     ERLWIVDGTLVPVRDRRVAASSRNYRFSANVQVIIDADSRLVIASARPVPGNKADAHA
                     WRESGLPAIAAGTTVIADGAYLGTGLIVPHRRRAGRPLLRGQEEDNAEHRRVRARVEH
                     TFARMKNWKILRDCRQKGDGLHHAVQAVATMHNLAMTG"
     misc_feature    complement(25090..25248)
                     /locus_tag="Sfla_6473"
                     /note="Helix-turn-helix of DDE superfamily endonuclease;
                     Region: HTH_Tnp_4; pfam13613"
                     /db_xref="CDD:257926"
     misc_feature    complement(24616..25059)
                     /locus_tag="Sfla_6473"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(24625..25056)
                     /locus_tag="Sfla_6473"
                     /note="DDE superfamily endonuclease; Region: DDE_Tnp_4;
                     cl17710"
                     /db_xref="CDD:266781"
     gene            complement(25664..25939)
                     /locus_tag="Sfla_6474"
                     /pseudo
                     /db_xref="GeneID:11353651"
     gene            complement(26016..26585)
                     /locus_tag="Sfla_6475"
                     /db_xref="GeneID:11353652"
     CDS             complement(26016..26585)
                     /locus_tag="Sfla_6475"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: kra:Krad_2205 transcriptional regulator, TetR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein TetR"
                     /protein_id="YP_004909404.1"
                     /db_xref="GI:357409117"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:11353652"
                     /translation="MQESVGVRQAQAQLTRSGVLNAAAAVFVERGIQAPVRDIAERAG
                     VGVGTVYRNFPTRADLVTAVYRHQIDACTALAPRLLKESSSPFTALALWTDEFVDFLV
                     TKHGLGAALRSGDPGLENLHTLMLDTLVPACASLLDACAATEELRPGITAYTLLRAIG
                     NLCITGPDYDQADAKVMVAFLLTGCRIKR"
     misc_feature    complement(26106..26564)
                     /locus_tag="Sfla_6475"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(26394..26531)
                     /locus_tag="Sfla_6475"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            26688..27599
                     /locus_tag="Sfla_6476"
                     /db_xref="GeneID:11353653"
     CDS             26688..27599
                     /locus_tag="Sfla_6476"
                     /inference="protein motif:PFAM:PF07224"
                     /note="PFAM: Chlorophyllase-like;
                     KEGG: kra:Krad_2206 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Chlorophyllase-like protein"
                     /protein_id="YP_004909405.1"
                     /db_xref="GI:357409118"
                     /db_xref="InterPro:IPR010821"
                     /db_xref="GeneID:11353653"
                     /translation="MSSSHLLNHQIVSVRPISVPSPGRGIDLQVRVTAPRSGQNLPVI
                     VFSHGNAWSLDGYEPLVGRWSAAGFIVVQPTHLDSRRNAIAWDDPRFATIWRVRITDL
                     HAVLDHLDDVLAQAGLEARADRERIAVVGHSWGAQTAGALLGARVLDAEGVAGEDFSH
                     SAVSAGALIGATGTGDTLTPFAVENLPFMKPDFSTMTAPALVIAGGKDDSQLSTRGPE
                     WFTDAYHLSPAPKSLLSLTEAEHTMGGIAGEKVAETTDEDPARVALTADAISAYLRAA
                     LNLDAAEWAALNSTAEGRGDTWSLVSK"
     misc_feature    26736..>27431
                     /locus_tag="Sfla_6476"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    26814..27410
                     /locus_tag="Sfla_6476"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            27920..28600
                     /locus_tag="Sfla_6477"
                     /pseudo
                     /db_xref="GeneID:11353654"
     gene            29387..30565
                     /locus_tag="Sfla_6478"
                     /db_xref="GeneID:11353655"
     CDS             29387..30565
                     /locus_tag="Sfla_6478"
                     /inference="similar to AA sequence:KEGG:SAV_778"
                     /note="KEGG: sma:SAV_778 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909406.1"
                     /db_xref="GI:357409119"
                     /db_xref="GeneID:11353655"
                     /translation="MSTEQNLISTPITAAFLRGHLDVEKTAHGLLPHRLPAWARRQIP
                     DDLLAVAEAQPSGIRLAFRTSATTIHLDTLPTKRAYRGFPPPPDGIYDLLVGGRLTAQ
                     ANVAGGNLRTITDMQTQAAEFTPGPVGAAHFTDLPAGEKDVEIWLPHAEITEVIALRT
                     DGPVEPAPHTGRRVWLHHGSSISHGSNAVFPSTIWPALAASAGDVDLVNLGFGGSALV
                     DPFTARAIRDTPADLISLKLGINVVNSDAMRLRAFVPAIHGFLDTIREGHPTTPLLLV
                     SPVLCPTQENTPGPLMPDLSSGTLKFKATGDPAETDAGRLTLVIVRKVLADIVKQRSA
                     EDPNLHYLDGLDLYGESDHDEFPLPDAIHPSPEGHRRIGENFAKLVFANNGPFAGRIG
                     "
     misc_feature    29906..30523
                     /locus_tag="Sfla_6478"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cl01053"
                     /db_xref="CDD:260768"
     misc_feature    order(29927..29929,30026..30028,30107..30109,30464..30466,
                     30473..30475)
                     /locus_tag="Sfla_6478"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(29927..29929,30464..30466,30473..30475)
                     /locus_tag="Sfla_6478"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(29927..29929,30026..30028,30107..30109)
                     /locus_tag="Sfla_6478"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     gene            complement(30803..31258)
                     /locus_tag="Sfla_6479"
                     /db_xref="GeneID:11353656"
     CDS             complement(30803..31258)
                     /locus_tag="Sfla_6479"
                     /inference="similar to AA sequence:KEGG:SGR_482"
                     /note="KEGG: sgr:SGR_482 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909407.1"
                     /db_xref="GI:357409120"
                     /db_xref="GeneID:11353656"
                     /translation="MTSAWDDPADLTLTLQAKTSQAIVVTGVTIRRLSAAPAPSAGSI
                     VNKECGGAMYQRVFDVDLMAQEINLQPVSEGAAKAVDFPLKVSDSDPEQLSLRLLPGD
                     HDVRFSVEVNWISEGEAHGETVADGQPVLRVTGPGRLPVYAYGETFTKP"
     gene            31321..31638
                     /locus_tag="Sfla_6480"
                     /db_xref="GeneID:11353657"
     CDS             31321..31638
                     /locus_tag="Sfla_6480"
                     /inference="protein motif:PFAM:PF01527"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: rop:ROP_pROB01-04670 putative transposase orfA for
                     insertion sequence element"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_004909408.1"
                     /db_xref="GI:357409121"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:11353657"
                     /translation="MAAPRKYPDELRERATRLAIEARKDPVGRAGAIKRIADQLDVHP
                     EALRGWVKRAETDEGLVPGTTSAEAARIAELEREVKELRRANAILKSASAFFAAELDR
                     PLR"
     misc_feature    31321..31581
                     /locus_tag="Sfla_6480"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            31635..32543
                     /locus_tag="Sfla_6481"
                     /db_xref="GeneID:11353658"
     CDS             31635..32543
                     /locus_tag="Sfla_6481"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: cfl:Cfla_3288 integrase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic region"
                     /protein_id="YP_004909409.1"
                     /db_xref="GI:357409122"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11353658"
                     /translation="MKVAYIDQHKDLFGVQPICDVLAETDAPIAPSTYYAARTRPASA
                     RSLRDEHLTEEIHRIHTGNYGVYGARKIHAALVREDITVARCTVERLMRATGLRGVIR
                     ARSPRATRPAPETDRPADLVERQFTATAPNQLWVADITYIKTFSGWVYAAFVIDVFSR
                     MIVGWQVATSLYTELALEALEMAIWRRRHAGGDLAGLVHHSDRGVQYRAIRYTERLED
                     AAAVASVGSRGDSYDNALAEAFNSLFKAELIRNRGPWTGINDVEIAVAEYVDWFNQRR
                     LHGELGHVPPAEFEALYATTDATPAP"
     misc_feature    31719..32519
                     /locus_tag="Sfla_6481"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    31776..31940
                     /locus_tag="Sfla_6481"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    32013..32378
                     /locus_tag="Sfla_6481"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    32304..32492
                     /locus_tag="Sfla_6481"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(32551..32832)
                     /locus_tag="Sfla_6482"
                     /db_xref="GeneID:11353659"
     CDS             complement(32551..32832)
                     /locus_tag="Sfla_6482"
                     /inference="similar to AA sequence:KEGG:406368"
                     /note="KEGG: dre:406368 zgc:85611"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909410.1"
                     /db_xref="GI:357409123"
                     /db_xref="GeneID:11353659"
                     /translation="MPARPPRRASHMSNPAYWVPAVFAVTAAIVTAMFTGGWTWLQGQ
                     WSDPPGLTVHAALGSCPVYMNKTLDELRQDSGSDKLQKGVKPRVLWTVG"
     gene            complement(33165..33830)
                     /locus_tag="Sfla_6483"
                     /db_xref="GeneID:11353660"
     CDS             complement(33165..33830)
                     /locus_tag="Sfla_6483"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sco:SCP1.267 putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004909411.1"
                     /db_xref="GI:357409124"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11353660"
                     /translation="MITNVARGFASAALTVMPLLAATPVPAADITTLAEGVRALPLAA
                     ESRTGYERSAFKHWVDADKDSCNTRMEVLIAESRIAPTVEAGCKVTAGEWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLDAERSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTADQPEAAALTDLAETCGNQPLAYELATE
                     DGN"
     sig_peptide     complement(33765..33830)
                     /locus_tag="Sfla_6483"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.991) with cleavage site probability 0.838 at
                     residue 22"
     misc_feature    complement(33225..33632)
                     /locus_tag="Sfla_6483"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            34243..34974
                     /locus_tag="Sfla_6484"
                     /db_xref="GeneID:11353661"
     CDS             34243..34974
                     /locus_tag="Sfla_6484"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sco:SCP1.323c putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004909412.1"
                     /db_xref="GI:357409125"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11353661"
                     /translation="MRRSRVAALAAVVLSATLISCNPQLADDKPNDSTPTSGASAASQ
                     AAGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPEQGDRCKLTGGVWMSYYDEVEVTDAKKLDIDHMVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     AEKTALLDLAKDCTDTVVEFEEAAE"
     sig_peptide     34243..34323
                     /locus_tag="Sfla_6484"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.989 at
                     residue 27"
     misc_feature    34519..34923
                     /locus_tag="Sfla_6484"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            35030..35326
                     /locus_tag="Sfla_6485"
                     /pseudo
                     /db_xref="GeneID:11353662"
     gene            35436..35762
                     /locus_tag="Sfla_6486"
                     /pseudo
                     /db_xref="GeneID:11353663"
     gene            complement(35893..36921)
                     /locus_tag="Sfla_6487"
                     /db_xref="GeneID:11353664"
     CDS             complement(35893..36921)
                     /locus_tag="Sfla_6487"
                     /inference="similar to AA sequence:KEGG:SCO0145"
                     /note="KEGG: sco:SCO0145 secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="secreted protein"
                     /protein_id="YP_004909413.1"
                     /db_xref="GI:357409126"
                     /db_xref="GeneID:11353664"
                     /translation="MIRHLAAALLALAVGTTTPAAATPALVPAADREIVFTADGTTVY
                     GTLRVPEHRAGHRLRAALLLPGSGPTDRDGNQPSMSAPDTLARLADTLEGDGIATLRF
                     DKYGTGRTGLGAYKDRPEELDYPAFVRQAQAAYRALRDQPETDPRALLVVGHSEGAMT
                     GLLLGGTVHPRPAGLALLQPQAIRMLDLVTLQLKAQVAEAARQGQLTPEDQRTINAAI
                     DAAVTSLREQRPVDTTDLPPAIAQLFEAFQGPNARFVTSDDAVHPPDTAAALAPGTRV
                     LLTCGTNDTQVPCITTNALTTALRQAHAGRPGRVKLPGVDHLLHSAEHPDALAPLVLD
                     ALRRFTRR"
     sig_peptide     complement(36853..36921)
                     /locus_tag="Sfla_6487"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.791 at
                     residue 23"
     misc_feature    complement(35908..36834)
                     /locus_tag="Sfla_6487"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(35935..36738)
                     /locus_tag="Sfla_6487"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(36935..37285)
                     /locus_tag="Sfla_6488"
                     /db_xref="GeneID:11353665"
     CDS             complement(36935..37285)
                     /locus_tag="Sfla_6488"
                     /inference="similar to AA sequence:KEGG:SCO0144"
                     /note="KEGG: sco:SCO0144 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909414.1"
                     /db_xref="GI:357409127"
                     /db_xref="GeneID:11353665"
                     /translation="MALIRIADDNLVVVMEGLDKFWAFKSRLTIPLANVRGATVDPGI
                     ATDFKGIRAPGSHLPGVIIAGTFHHDGDKVFWDVKDASKAIVVELADEEYTRLVLQVD
                     DPRAAVALVENALV"
     gene            complement(37299..37799)
                     /locus_tag="Sfla_6489"
                     /db_xref="GeneID:11353666"
     CDS             complement(37299..37799)
                     /locus_tag="Sfla_6489"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: sco:SCO0143 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein TetR"
                     /protein_id="YP_004909415.1"
                     /db_xref="GI:357409128"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:11353666"
                     /translation="MGRPRAFDEDEAVRAAVGLFGGRAYDGVSVDDLVAHLGVHRNSL
                     YKTFGSKRGLYLVALRRHIADDVRPLLDALAEATDAATALRLVTSADLGLLLLAAIER
                     SPVDEEVAFEVTAALDSVDRAIADALGVPAALATALTAAALGILLRGNPDKVATALAQ
                     HLGPLT"
     misc_feature    complement(<37416..37799)
                     /locus_tag="Sfla_6489"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(37632..37763)
                     /locus_tag="Sfla_6489"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            37919..38044
                     /locus_tag="Sfla_6490"
                     /pseudo
                     /db_xref="GeneID:11353667"
     gene            complement(38503..39030)
                     /locus_tag="Sfla_6491"
                     /db_xref="GeneID:11353668"
     CDS             complement(38503..39030)
                     /locus_tag="Sfla_6491"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: sgr:SGR_3853 putative acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="YP_004909416.1"
                     /db_xref="GI:357409129"
                     /db_xref="GO:0008080"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11353668"
                     /translation="MTRVIDLQHYADGSLPEGFRQMLIDVHADAYADAMGDEFHQRFP
                     WFVDHWSQTKGFTCVVAYDGDEPTGFAYGAPQRPGREWWRSTTFEPAGGDTTTYAVSE
                     VMVRPRWRKQGVSDRLHEALLTERDEDLAVLLVDVTHPKVQALYETWGYEKAGEQQPF
                     ADSPVYAVMVKRLRS"
     misc_feature    complement(38563..39024)
                     /locus_tag="Sfla_6491"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_8; pfam13523"
                     /db_xref="CDD:257843"
     misc_feature    complement(38656..38859)
                     /locus_tag="Sfla_6491"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(38683..38688,38716..38724))
                     /locus_tag="Sfla_6491"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(39027..40286)
                     /locus_tag="Sfla_6492"
                     /db_xref="GeneID:11353669"
     CDS             complement(39027..40286)
                     /locus_tag="Sfla_6492"
                     /inference="similar to AA sequence:KEGG:SGR_3852"
                     /note="KEGG: sgr:SGR_3852 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909417.1"
                     /db_xref="GI:357409130"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353669"
                     /translation="MGANLVLHGRMQQLGFTQEELANRLNGALLEITGRPGEISARTV
                     RNLLNGSSRRPIGRTCAALERVFGCPVADLGLSAPSSMHRPREVPVRRRDFIASTTGA
                     AAAAVPAPIGKQRRSVGMTDVSRAAARVNLLVETDDRRGGHTSLATAALEGRAEVLGL
                     QQRNAGERVRRALYALAAEYTTIAAWSCIDLHDLDAAQRYLHESATFAGLSQDAATGM
                     RVWINMAMLAYQRQNWPEQLAAAQAASASPAARRDPLFGSMGRARLALAHSSLGDPRA
                     AKRALGAAEDILQRAVEADRPRWTAFYGPAELSHLAAVVLNRNGESAGAEAMAHRALA
                     RIPTDFRRNRALATCQLATAQLRQGDPDQATRTASSVFTIMDGAPLPGRMRTLIGDFH
                     RDLLRLAPSTTYARDWADRMRAEWSRA"
     misc_feature    complement(40065..40259)
                     /locus_tag="Sfla_6492"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40143..40145,40254..40256))
                     /locus_tag="Sfla_6492"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40140..40142,40251..40253))
                     /locus_tag="Sfla_6492"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(40137..40142,40152..40154,40161..40163,
                     40230..40235))
                     /locus_tag="Sfla_6492"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            40640..41440
                     /locus_tag="Sfla_6493"
                     /db_xref="GeneID:11353670"
     CDS             40640..41440
                     /locus_tag="Sfla_6493"
                     /inference="similar to AA sequence:KEGG:Francci3_2893"
                     /note="KEGG: fra:Francci3_2893 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909418.1"
                     /db_xref="GI:357409131"
                     /db_xref="GeneID:11353670"
                     /translation="MTVLTTDHPAWTETESGGRVRAVRTASGLWVLSWDRDGLNMRCV
                     DGTEDAKPTLVSTNPDCLPSSVPGGLRSGLDRLGVSQRLANPWLWDAITTAILRQVVR
                     AGQARKLYREWCGAYGTRVDSPFGELATAPSAGDVLALADEQFDDIGAKFHRGVLRAA
                     AEHYERHSADWLGMKAPELASALTAVPRIGPWTAAAAATDFTGDFSVYPHDDLAVRTW
                     ATQIAPHYPWPDKKDKAFGPLWTGWAGPDRTALHTLTLSTLTWGSHAR"
     misc_feature    40919..41335
                     /locus_tag="Sfla_6493"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cl19066"
                     /db_xref="CDD:267419"
     gene            41453..42994
                     /locus_tag="Sfla_6494"
                     /db_xref="GeneID:11353671"
     CDS             41453..42994
                     /locus_tag="Sfla_6494"
                     /inference="protein motif:PFAM:PF04055"
                     /note="KEGG: fra:Francci3_2894 radical SAM family protein;
                     PFAM: Radical SAM domain protein; cobalamin B12-binding
                     domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="YP_004909419.1"
                     /db_xref="GI:357409132"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0031419"
                     /db_xref="GO:0046872"
                     /db_xref="GO:0051536"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:11353671"
                     /translation="MQQLPRLSGADPTRALDALFVNAPLRDYGRRPRTNDYTLPVLGM
                     AYIATYAQRAGFNVGVLDAEAHGLGILETAELVNAARPRWAAMNLLAPTYEMSARIAA
                     RIDPDIALMVGGHHAKAMPDRILADPRMANLRALVLGEGELRVAALLEDEQRRRELPG
                     VLWRDRLLGTRATGIPSGRPNPQLLGPDINSLPYVNRAFLPQDPYRAAPTEADRRLAL
                     SRGTDPLRTAARTGHLEANIVGSRGCPYNCTFCGAAVSANPDLTIRVRSPENIIGELD
                     QLHDEYGVTAFRFVDDLFLGAGRVIAEQMTAFARHRIGERYVWDATGRINVLDRLGDR
                     DLDRLVQNGLREVALGIESGSDRVLRAMDKRIDAAMTERVAQRLVRHGIGVKGYFILG
                     FPGETHDDIAATVRHIRNLWAIADSSPGEVRASVFEFRPYPGTPVWTTLTDAGHDPEG
                     LLAYGDVDLTDDGADESMRQRDEFNFSVGVQFGDVPLAEVRSTLATLTREQHQRNQSV
                     QGAAA"
     misc_feature    41561..41899
                     /locus_tag="Sfla_6494"
                     /note="B12 binding domain; Region: B12-binding; pfam02310"
                     /db_xref="CDD:251215"
     misc_feature    order(41702..41707,41711..41719,41795..41797,41882..41884,
                     41891..41893,41930..41932)
                     /locus_tag="Sfla_6494"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     misc_feature    42164..42676
                     /locus_tag="Sfla_6494"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    42173..42793
                     /locus_tag="Sfla_6494"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(42182..42184,42188..42190,42194..42196,42200..42208,
                     42338..42340,42344..42346,42410..42418,42500..42502,
                     42620..42622,42734..42739)
                     /locus_tag="Sfla_6494"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            42991..43644
                     /locus_tag="Sfla_6495"
                     /db_xref="GeneID:11353672"
     CDS             42991..43644
                     /locus_tag="Sfla_6495"
                     /inference="protein motif:TFAM:TIGR00041"
                     /note="KEGG: fal:FRAAL2706 hypothetical protein;
                     TIGRFAM: thymidylate kinase;
                     PFAM: thymidylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="YP_004909420.1"
                     /db_xref="GI:357409133"
                     /db_xref="GO:0004798"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR000062"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="GeneID:11353672"
                     /translation="MKPKRGMFITIDGPSGVGKSTTIRALHQELTARGIPVHRTAEPT
                     TSDLGRFIRAHFSHIRGHALACLVAADRYEHVAQEIRPRLSAGDTVISDRYLASTLVM
                     QQLDGVPLKFLLDLNANVLMPDLAVILTAAPALIADRISARGPRNRFHLDPTAPGREV
                     LLYKAAAQTLMTTHVKVLVVNTGGATPSEVAATITDAIPCSSIASAASPQSTPPQEP"
     misc_feature    43000..>43443
                     /locus_tag="Sfla_6495"
                     /note="Thymidylate kinase [Nucleotide transport and
                     metabolism]; Region: Tmk; COG0125"
                     /db_xref="CDD:223203"
     misc_feature    43009..>43437
                     /locus_tag="Sfla_6495"
                     /note="Thymidine monophosphate kinase (TMPK), also known
                     as thymidylate kinase, catalyzes the phosphorylation of
                     thymidine monophosphate (TMP) to thymidine diphosphate
                     (TDP) utilizing ATP as its preferred phophoryl donor. TMPK
                     represents the rate-limiting step...; Region: TMPK;
                     cd01672"
                     /db_xref="CDD:238835"
     misc_feature    order(43048..43050,43192..43194,43204..43206,43267..43272,
                     43294..43296,43417..43419)
                     /locus_tag="Sfla_6495"
                     /note="TMP-binding site; other site"
                     /db_xref="CDD:238835"
     misc_feature    order(43051..43053,43405..43407)
                     /locus_tag="Sfla_6495"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238835"
     misc_feature    <43351..43584
                     /locus_tag="Sfla_6495"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     gene            43641..44087
                     /locus_tag="Sfla_6496"
                     /db_xref="GeneID:11353673"
     CDS             43641..44087
                     /locus_tag="Sfla_6496"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: sma:SAV_253 MutT-family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_004909421.1"
                     /db_xref="GI:357409134"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="InterPro:IPR020476"
                     /db_xref="GeneID:11353673"
                     /translation="MTPQPLAEPVIDTHVILRAGDKLLFSQRGGPYGYGRWHMPSGKL
                     DRGEALRAGAARELLEETGVTVDPAHLRMVHVVHHRQSAEVDRIGFFFEATRWSGEPV
                     NREPEKCLGLEWFSVHELPDDIIEYPQKGLLAYLEGDGALTEHGWE"
     misc_feature    43671..44024
                     /locus_tag="Sfla_6496"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    order(43764..43772,43800..43826)
                     /locus_tag="Sfla_6496"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(44215..44610)
                     /locus_tag="Sfla_6497"
                     /db_xref="GeneID:11353674"
     CDS             complement(44215..44610)
                     /locus_tag="Sfla_6497"
                     /inference="similar to AA sequence:KEGG:SCO6905"
                     /note="KEGG: sco:SCO6905 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909422.1"
                     /db_xref="GI:357409135"
                     /db_xref="GeneID:11353674"
                     /translation="MAPGVCPRRAVHRRLSTILEHVSEKSSRLDKLRFLLRVQEQQLD
                     VTRRWIADEERRQAERIQGERARPPQPDWVMELGIGVGAKPVEIHVGHCYAIGRRRKA
                     ITREQALAALAEGVDACTHCRPDTDLGLL"
     repeat_region   44725..45058
                     /note="CRISPRS"
                     /rpt_unit_range=44725..44754
     gene            complement(45281..45745)
                     /locus_tag="Sfla_6498"
                     /db_xref="GeneID:11353675"
     CDS             complement(45281..45745)
                     /locus_tag="Sfla_6498"
                     /inference="similar to AA sequence:KEGG:SCAB_11041"
                     /note="manually curated;
                     KEGG: scb:SCAB_11041 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909423.1"
                     /db_xref="GI:357409136"
                     /db_xref="GeneID:11353675"
                     /translation="MRLGDGGHRIASRADFAGWIVEQSLSELAEPFTFVVGMDLALRL
                     APRRSEHVACAGGDMVLSAGEISFMSEAGRWAVSEVSNQSTGYCPDVTSWAEVAPALD
                     AAELRRPSGFTHEVVFRRCPDCQEHNIVREGDFVCVFCGSDLPPAWNVDPTK"
     gene            complement(45812..45994)
                     /locus_tag="Sfla_6499"
                     /db_xref="GeneID:11353676"
     CDS             complement(45812..45994)
                     /locus_tag="Sfla_6499"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909424.1"
                     /db_xref="GI:357409137"
                     /db_xref="GeneID:11353676"
                     /translation="MWRREEKRRTARLLTSGMLAGDYRAFRERVAASSEVPSDVSDVT
                     ERRDVPPSDGTCVGSA"
     gene            complement(45994..46470)
                     /locus_tag="Sfla_6500"
                     /db_xref="GeneID:11353677"
     CDS             complement(45994..46470)
                     /locus_tag="Sfla_6500"
                     /inference="similar to AA sequence:KEGG:SCP1.296"
                     /note="KEGG: sco:SCP1.296 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909425.1"
                     /db_xref="GI:357409138"
                     /db_xref="GeneID:11353677"
                     /translation="MRTADDWSELAALLRRLMPVAHLATTRPLGRHYDVVITEAGPVG
                     DELLRLMDVLPGGCGPVIADAGRPVLRWVVPPGTGSWWHSRYGTCLSAPRSIPFPPLC
                     NEKPEGLYWLRPFRADRRVQPEDLAAALDAVRPSRDTHRELAAFRDLPGAAAEAQG"
     gene            complement(46467..46892)
                     /locus_tag="Sfla_6501"
                     /db_xref="GeneID:11353678"
     CDS             complement(46467..46892)
                     /locus_tag="Sfla_6501"
                     /inference="protein motif:PFAM:PF02518"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     KEGG: sco:SCP1.294 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region ATPase domain protein"
                     /protein_id="YP_004909426.1"
                     /db_xref="GI:357409139"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="GeneID:11353678"
                     /translation="MTVTFTITPLGGRPAPREQDARHVADLRRLVRGRLTSWGLSHLA
                     DDAELIVSELLTNSLIHSGGTQVSLDVRIEDDRLRIEVGDGARRRPCAPAHPCDEAEN
                     GRGLEIVHFLVQARGGAWGLGPDGTHTWCTLAIGTGKGR"
     misc_feature    complement(46539..46745)
                     /locus_tag="Sfla_6501"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(46575..46586,46638..46640,46644..46646,
                     46647..46649,46713..46715,46722..46724,46734..46736))
                     /locus_tag="Sfla_6501"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(46722..46724)
                     /locus_tag="Sfla_6501"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(46578..46580,46584..46586,46638..46640,
                     46644..46646))
                     /locus_tag="Sfla_6501"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            47149..48498
                     /locus_tag="Sfla_6502"
                     /db_xref="GeneID:11353679"
     CDS             47149..48498
                     /locus_tag="Sfla_6502"
                     /inference="similar to AA sequence:KEGG:SAV_343"
                     /note="KEGG: sma:SAV_343 regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_004909427.1"
                     /db_xref="GI:357409140"
                     /db_xref="GeneID:11353679"
                     /translation="MASRNRTPNPALADLLDQAKLTRTQLAQRVNRLGPQAGLELTYD
                     RTAVAHWIAGTLPKPEVRPLIVEALSVRLGRPVTHAEAGLAPSAAGAGDNGTDTVEEL
                     LDLGRADMDPSRRGVLAYTLFSAALAVPAFAATAHAADEPVADGKATTRIGASQVASV
                     RSMTDRIADILDEFGAGHARPLAAAFLVNTVAPWLRAQASERVHADMLAAASDLTYLT
                     GWMAMYDKAHGLGQTYYVKALQLAREAQDHVTFCRTLRGMSLQASSLGHGPKSLELAD
                     AAAEAAPMAGPRLVAFLRGQQAHAASMVKDRPQSHARLRQAETALAKADNHRDAIGGY
                     DRTAYLFHVSHVLYEERDLPGSIRALKQSIKVQPVQERQGRVHAYGLLAQRQLEHGHL
                     DAACDSWTRFLDAYEHVSSARGDDHFATMRRRLAPHSKVRAVREMAPRVREVAALKA"
     gene            complement(48630..48851)
                     /locus_tag="Sfla_6503"
                     /pseudo
                     /db_xref="GeneID:11353680"
     gene            49055..50326
                     /locus_tag="Sfla_6504"
                     /db_xref="GeneID:11353681"
     CDS             49055..50326
                     /locus_tag="Sfla_6504"
                     /inference="similar to AA sequence:KEGG:SGR_1521"
                     /note="KEGG: sgr:SGR_1521 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909428.1"
                     /db_xref="GI:357409141"
                     /db_xref="GeneID:11353681"
                     /translation="MLVDLLVEQGHVELLVRAASRGAWSCAKAAARELGKMAEFERAQ
                     GVLEPFVEVGWEPARWAAADLMLQAGRIQQALDWVRPEDADLASEHVCHDFAELLVKA
                     GQVDDAIAVLTPRLDRGWLLSALVELTEGQSRDERVLDLLAPKAERARSARGEERWNL
                     DASNAQDLQGQVLERAGRVDEAVRVLRADIAAGRFLVQNTLTAYAELCQRNGRMDELR
                     ELGIGEHAHVGLPYYARALEDRGQADEAETVLRRFMAADEWGRFRWPLIELLWRQGRI
                     AEAVEVGRPTFDHHDACLLDGVIHLLSEAGRFDDALAILDERDAEYIDEHASWFHTNR
                     IGLLGEAGRYEEALAYAKTLPTNVYELTSSTAWILEQSGRVDEALGLLRAGADVEAWE
                     VAALLIQHGRAEEAMDNMPSIAELRAASRWG"
     misc_feature    49955..50203
                     /locus_tag="Sfla_6504"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(49955..49957,50048..50053,50057..50062,50069..50074,
                     50141..50146,50153..50158,50165..50170)
                     /locus_tag="Sfla_6504"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(49985..49987,49997..49999,50012..50014,50057..50059,
                     50093..50095,50105..50107,50150..50152,50186..50188,
                     50198..50200)
                     /locus_tag="Sfla_6504"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(50525..50806)
                     /locus_tag="Sfla_6505"
                     /db_xref="GeneID:11353682"
     CDS             complement(50525..50806)
                     /locus_tag="Sfla_6505"
                     /inference="similar to AA sequence:KEGG:AMED_3612"
                     /note="KEGG: amd:AMED_3612 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909429.1"
                     /db_xref="GI:357409142"
                     /db_xref="GeneID:11353682"
                     /translation="MRVRIALSVYTAITVAGLGLSVVSPAIAASASTSQRVTAVQAAE
                     SLDVHREKFMTLNGCQTAGQQGIDRGHWDRYQCAEGSAWPWVWNLWTNR"
     sig_peptide     complement(50720..50806)
                     /locus_tag="Sfla_6505"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.808 at
                     residue 29"
     gene            51074..51925
                     /locus_tag="Sfla_6506"
                     /db_xref="GeneID:11353683"
     CDS             51074..51925
                     /locus_tag="Sfla_6506"
                     /inference="protein motif:SMART:SM00530"
                     /note="SMART: helix-turn-helix domain protein;
                     KEGG: sro:Sros_5351 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004909430.1"
                     /db_xref="GI:357409143"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353683"
                     /translation="MTGQQPDPRAAARELGAALRSLQQQSGRPLRSLEAAVRVSDSSL
                     SRYFRGETVPPWPVVRDLCRALQADPVPFRVLWEKTENAAPVEHDDAANASPALRTAV
                     GGADLSHMSGAAWWQRWRGLPGRRRRGTGGLGVIAVVGAAGAVGAVSLLVLLLPSQTT
                     PGAATGTKDAKGDPSRSSRLGVVVHNVERACQRPRTTLCALSLAHSPYRPYNTANSAA
                     RVWHHDLLQATCFVANGVTVTDENLKHTSIWIRITHHEGQLWLPGIRLRPDHLTQVTT
                     VLPTCSQ"
     misc_feature    51119..51283
                     /locus_tag="Sfla_6506"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(51131..51133,51143..51145,51218..51220)
                     /locus_tag="Sfla_6506"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(51140..51142,51215..51217)
                     /locus_tag="Sfla_6506"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(51161..51166,51197..51199,51206..51208,51218..51223)
                     /locus_tag="Sfla_6506"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     repeat_region   52231..52875
                     /note="CRISPRS"
                     /rpt_unit_range=52231..52260
     gene            complement(52989..53507)
                     /locus_tag="Sfla_6507"
                     /db_xref="GeneID:11353684"
     CDS             complement(52989..53507)
                     /locus_tag="Sfla_6507"
                     /inference="similar to AA sequence:KEGG:Namu_0455"
                     /note="KEGG: nml:Namu_0455 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909431.1"
                     /db_xref="GI:357409144"
                     /db_xref="GeneID:11353684"
                     /translation="MADPYSNPASLWPTHSPEEPSEQQRWVWSAMEPAERQERLRELA
                     VWVDWLRTTFELHNSIPTCWYRHSPVVEHLTALYAGWIRTYAGEQVPGRELAEVDWIN
                     ALHALTPRLQLAACAAGQHEEPPPMPRERPEAADDFETFLDTSRTTTEPARHPAEAEL
                     GRRRAENALTGR"
     gene            complement(53500..55206)
                     /locus_tag="Sfla_6508"
                     /db_xref="GeneID:11353685"
     CDS             complement(53500..55206)
                     /locus_tag="Sfla_6508"
                     /inference="protein motif:PFAM:PF02534"
                     /note="PFAM: TRAG family protein;
                     KEGG: fre:Franean1_1381 type IV secretory pathway VirD4
                     protein-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAG family protein"
                     /protein_id="YP_004909432.1"
                     /db_xref="GI:357409145"
                     /db_xref="InterPro:IPR003688"
                     /db_xref="GeneID:11353685"
                     /translation="MAAEKTGSSTAGLDDNTLLAAYGIGAAAAVGGAVLLAAPAAAVL
                     SGRGWAVRTDSIPATVLKSLAQGPGAAFTPAPPNWLFYGLTVVFVLAVLILVVKAVSH
                     FGSSGRTGGAQWGGAEVERKLRAPEDPAERANRITAGRGMRTRKLVAAQPNISATVFG
                     VPGSSKTTGLVLPNAAEWQGPLVVTTTKAADLDIIHARRRCLGPVWVIAPAGIPGRPT
                     HRWSPVDYCTDAKAADRMASWMAEASSSGDSKRAAPWVDQAKSVLKGVLLAAQLSGGG
                     VGAMRRWLGLGKDAVDHVRAVLLQHGYQEVAEDYASPWLRLHEDGIGSIQFTLNVLAR
                     VYADEEVRETCAGTDFTVEELLERNGTVCLIASEADAERFAPLLTSIIASIIHGAEVR
                     YNSTGKPLDPSLGVMVDEAGNMLRYPRLPNILTTGRGMGIDVLTVWHDLSQLRDRLGP
                     QKANTVLSASGLRMLLPGCGDLETLRYFSGLYGRTEVMKTSHGRSRGEYSTNTSSTET
                     DLAPVHSLQQLPDFTAIAQYSNQPPIKVRMRLTFRDKDLRKLLAGPGHDSGVPGKSAS
                     HG"
     misc_feature    complement(53554..54969)
                     /locus_tag="Sfla_6508"
                     /note="Type IV secretory pathway, VirD4 components
                     [Intracellular trafficking and secretion]; Region: VirD4;
                     COG3505"
                     /db_xref="CDD:226036"
     misc_feature    complement(53689..54735)
                     /locus_tag="Sfla_6508"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(54706..54714,54724..54729))
                     /locus_tag="Sfla_6508"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(53977..53982,54646..54651,54655..54657,
                     54706..54714,54724..54726))
                     /locus_tag="Sfla_6508"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(53980..53991,53995..53997))
                     /locus_tag="Sfla_6508"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(55381..55971)
                     /locus_tag="Sfla_6509"
                     /db_xref="GeneID:11353686"
     CDS             complement(55381..55971)
                     /locus_tag="Sfla_6509"
                     /inference="similar to AA sequence:KEGG:SGR_6201"
                     /note="manually curated;
                     KEGG: sgr:SGR_6201 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909433.1"
                     /db_xref="GI:357409146"
                     /db_xref="GeneID:11353686"
                     /translation="MTTSCCTSSGSAEAPPTWVESMGGPLIAVPASVLDGWGGCTMSG
                     MLISYGDVADDYDRACEIDGLAGVIGVGGRNAQGLVLADEPAMTCYLPQHRAFVRWGA
                     ADSEAELMVAAEAVLSDPTVKWGTYGVWETDGPAVLMDAATKGAELNIEDLNGGGMPE
                     QAPVRIPAGRWTVRAVHASVDEETCVGLVQLLPSSV"
     misc_feature    complement(55417..55923)
                     /locus_tag="Sfla_6509"
                     /note="Immunity protein 12; Region: Imm12; pfam15589"
                     /db_xref="CDD:259720"
     gene            complement(56118..57665)
                     /locus_tag="Sfla_6510"
                     /db_xref="GeneID:11353687"
     CDS             complement(56118..57665)
                     /locus_tag="Sfla_6510"
                     /inference="similar to AA sequence:KEGG:Caci_8941"
                     /note="KEGG: cai:Caci_8941 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909434.1"
                     /db_xref="GI:357409147"
                     /db_xref="GeneID:11353687"
                     /translation="MGLLARRRATDTALDASGLGEATGIDVAHVPAPAGPTPAEQRDS
                     RRLEDAETVMRVAPRKGWPQPFAGRCASLPRTEVVRADTGNAAGAYPFLHAGSLPPVG
                     AYIGHNTLTTQAFSAHPAVWVREGLCTNPNVMITGIPGSGKSAHIKALCFRLMAFGHR
                     TLIAGDVKGEYAGLCRHLGVEPVRLGPGLPGRLNPLDAGPLGTGLDGIKDPAELRGRL
                     QEIHRRRLTLLKALLELQLRRTLESREEEALDVAVREVTGELYGQSRLAVPTLPLVYD
                     KLRDPTDVMAQELRVRDGEVQLAREQMVSIRSALGTMVNGHLGGLFDEQTSIGLDWDA
                     PIQSVDISALEQYGDETIAMVLSCVSSWAQAAIDRPGRRPWIVVRDELWRQMRSGGAA
                     MVRKIDADLRLSRATGTIQILATHRLSDFESVGAASSEAVAIAKDLISSCETRIQLAQ
                     DTRPLQITREAIGLSDAECDLIGSWGAGQRGRALWKVGRGGGHAVQLVLSHIEQKLFE
                     TDERMAV"
     misc_feature    complement(56265..57278)
                     /locus_tag="Sfla_6510"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     gene            complement(57665..59188)
                     /locus_tag="Sfla_6511"
                     /db_xref="GeneID:11353688"
     CDS             complement(57665..59188)
                     /locus_tag="Sfla_6511"
                     /inference="similar to AA sequence:KEGG:Snas_5434"
                     /note="KEGG: sna:Snas_5434 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909435.1"
                     /db_xref="GI:357409148"
                     /db_xref="GeneID:11353688"
                     /translation="MTQPVTYSGWQSEKSGFMGRLSGPGFALVAIGCTLLLVPLNLAS
                     WAAAALCVPLAVMLLVLAFGRVSGLSADEWILLAVRHQIAVARNQNVFVSGPFAPRST
                     RTDRQPMDLPGTLARLRILEAPDGLGGLLGVAHDPVAGTYTAVSRVSFPGLALVDTDK
                     QAARVSSWAALLRTFCTEDSPIVRLSVHQRCLPDDGAALRSWTAHHITPDAPPAAVSA
                     LSDLMEGAGPAATNRETYLSVTLSAGRARLAIKGAGGGQVGAAAVLVREIHALGGALS
                     TASLQVMEWLSPRKLAQSIRTAYDPDAQAAIATANAAAQKPGWEGVEEGVNPALAGPA
                     AADAGWGTYRHDGAWTVTYQVRTWPQAQVYATFLQPLLRPRRNARRSMSLVYEPLGPR
                     RARQELAREKSKRSSARYLRAKTGRDESEDERREADLARTQDAARAAGQGVVRMTAVL
                     SVTVTDLDELETACAELQADAAASALELRRMWGAQDVGFTAGALPLGQGLPDRRMGF"
     gene            complement(59185..61065)
                     /locus_tag="Sfla_6512"
                     /db_xref="GeneID:11353689"
     CDS             complement(59185..61065)
                     /locus_tag="Sfla_6512"
                     /inference="similar to AA sequence:KEGG:Caci_8939"
                     /note="KEGG: cai:Caci_8939 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909436.1"
                     /db_xref="GI:357409149"
                     /db_xref="GeneID:11353689"
                     /translation="MRTDRRRPAAGVWCLLLVLLCCVAGGTACAPAAVADHGGKHAEY
                     GPPEPPPEEWAADGDVAGIDTQGHWCVLDFGATDGDCGPAEAGDLPGTIGVCESADGN
                     AARNCSETDRRQYENLRLDKWRKAYDQDQGNFDELNGYVTACVERGGLFQQCLQGGQN
                     TYPPDAKSPVSWAAGKISELASDALQEAARYIGKAVVWLLEEYAKIFNSSSTIDLSRT
                     GIDSATGVMTTLSLVIATFLLLLQFGKVAVSQRGEPAATAVIGLAKWGVVSSVYVLAT
                     QTALSWSDAVSTWIINYTFEGGGSGEADATEAMQHQLGTLFGGLITGGGGAATVGTAL
                     VTGEGVAAAAVGVIIVVGIVCILAIAALWLEVLLRQAGIMILVATMPVVLAGQLSDST
                     QEWWPKARNALIALILMKPMIVLCFAIGFGAMAEGQGVQNMFVGLVIFILACFAWPVL
                     AKFMTFSTVGGGSAIASGLMSSVGSSAASAGGGYRPEMGGAGAVGGGSAYTRALEQDT
                     AQTAASGSHAAPVPGSGAGGSAAGGAGRSFGSKVFGTVALPLQLLAAGKDTLESGMAS
                     TAGHAGLDHGAAGGRHVVIAQRSAAAASAHPPGARPEGAAAQSPAPVQPPPPALPPRD
                     DP"
     sig_peptide     complement(60958..61065)
                     /locus_tag="Sfla_6512"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.928) with cleavage site probability 0.716 at
                     residue 36"
     gene            complement(61055..61837)
                     /locus_tag="Sfla_6513"
                     /db_xref="GeneID:11353690"
     CDS             complement(61055..61837)
                     /locus_tag="Sfla_6513"
                     /inference="similar to AA sequence:KEGG:Snas_5432"
                     /note="KEGG: sna:Snas_5432 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909437.1"
                     /db_xref="GI:357409150"
                     /db_xref="GeneID:11353690"
                     /translation="MDNHERRARRAKLLLAGLTVLVVGALAVGGVVAHGLIEDGNTRT
                     PAAGPTAGETKPSAPAPAGSRPAMTPERAKKVSLNEPTGQRGGASTGFPHSPGGAISA
                     VVHFWEEYAWMDDEKARQQLDVVTSPDATGYVDRQISEVRKLREGAGLPVSGGTPAGI
                     TFTTMVDAVRMRSLTDDDLPRGDVVHIWLSFDRYATTPDRATDDNPVKGDTVDFIVKW
                     QDGAWRITDEPAYVAQRTFPVAYDPDSPFAWRDQWIQVRHED"
     sig_peptide     complement(61736..61837)
                     /locus_tag="Sfla_6513"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.986) with cleavage site probability 0.697 at
                     residue 34"
     gene            complement(61851..62198)
                     /locus_tag="Sfla_6514"
                     /db_xref="GeneID:11353691"
     CDS             complement(61851..62198)
                     /locus_tag="Sfla_6514"
                     /inference="similar to AA sequence:KEGG:MCA1801"
                     /note="KEGG: mca:MCA1801 cation efflux family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909438.1"
                     /db_xref="GI:357409151"
                     /db_xref="GeneID:11353691"
                     /translation="MFALTFMDAVHALAADPGLQTLAADTPPIVPKPAPALPAAVNTQ
                     VQTVLNWTAGFGLAAAVIGGLTGWLLVAVGHNTERAQLAARGKQSVLWSLCGAGGIGL
                     TSSMVLAVYNMSI"
     gene            complement(62214..63113)
                     /locus_tag="Sfla_6515"
                     /db_xref="GeneID:11353692"
     CDS             complement(62214..63113)
                     /locus_tag="Sfla_6515"
                     /inference="similar to AA sequence:KEGG:FRAAL5218"
                     /note="KEGG: fal:FRAAL5218 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909439.1"
                     /db_xref="GI:357409152"
                     /db_xref="GeneID:11353692"
                     /translation="MGVGVNKQDLSPIVFSSGCRLVVPVMGATGGSGRSTVADLLAER
                     MAAAGAATVVLDTAPRLTSPWPSWTVGQQAGGLAALPPDRPLTRSRVRHAAAVRSDGG
                     GPDRHVLTDGRDWHSPPLVLPDDPAAWLQLAAIGGWQCVVADTPHPVAHDVLESRCAG
                     RIGRTRAWYELPYAVPVLCASATAGGVQALQQAVMALHADGMPLRRTVVALVAQTDGR
                     LPAVVRAGATMLSARTAAVVHLPHDPHIRSHGLRTVFRLRTRTRQAAGLLCREVLAAA
                     RASWGTPLPDAPRPAPSAVVAPS"
     gene            63353..64450
                     /locus_tag="Sfla_6516"
                     /db_xref="GeneID:11353693"
     CDS             63353..64450
                     /locus_tag="Sfla_6516"
                     /inference="protein motif:PFAM:PF00877"
                     /note="PFAM: NLP/P60 protein; Lytic transglycosylase
                     catalytic;
                     KEGG: sco:SCO4132 secreted transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="NLP/P60 protein"
                     /protein_id="YP_004909440.1"
                     /db_xref="GI:357409153"
                     /db_xref="InterPro:IPR000064"
                     /db_xref="InterPro:IPR008258"
                     /db_xref="GeneID:11353693"
                     /translation="MRVRGWLAIAVGGAVMTPVALGVGVVLLIAAFGEDDGEFGGGLG
                     PTAGSLRVGRGGVPSAYAPMILKAAADCEAGLQPAVLGAQLKQESNFDPQARSPGVGA
                     QGIAQFMPGTWPTWATDGNGNGTRSVWEPADAIAGQGRFMCSLMRKGRAHPKYDGSPT
                     ELALAGYNAGWGRVDEYRGVPPAEFARGQTFHYVRNIMALAKQFTAPASSGEVRLPAG
                     YTLPSGTPREVRTAVAWALRQRGGWYRLGGDCTDAHGGDPAHWCDCSSLMQRAYGAAG
                     VSIPRVTYDQVNSGTRVSVDRPRPGDLVFNPGSDGSDARPGHVGMYIGDDMVIEAPRT
                     GVRTRVVPYSSWRDSTSAVTRVTEVRRVVPW"
     sig_peptide     63353..63421
                     /locus_tag="Sfla_6516"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.744) with cleavage site probability 0.716 at
                     residue 23"
     misc_feature    <63491..63901
                     /locus_tag="Sfla_6516"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    63584..63958
                     /locus_tag="Sfla_6516"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(63614..63616,63677..63679,63773..63775,63851..63853)
                     /locus_tag="Sfla_6516"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    63614..63616
                     /locus_tag="Sfla_6516"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     misc_feature    <64046..64399
                     /locus_tag="Sfla_6516"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    64082..64417
                     /locus_tag="Sfla_6516"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            64444..65037
                     /locus_tag="Sfla_6517"
                     /db_xref="GeneID:11353694"
     CDS             64444..65037
                     /locus_tag="Sfla_6517"
                     /inference="similar to AA sequence:KEGG:SCAB_44721"
                     /note="KEGG: scb:SCAB_44721 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909441.1"
                     /db_xref="GI:357409154"
                     /db_xref="GeneID:11353694"
                     /translation="MVTYETEGRPTPMPQNTAHEELYRPWGTVTPAFWDLRQQAEPER
                     TVVHVPQVLRGRLTAIAARAAGGRFPDAAWMAHQLDTEVTDEYGPEHLNTVHVREVRA
                     HLAYLAGDHAASLGWYLHTARLRATIQGPGHPDTEEATRRVYSLWRTVPDADAPALGV
                     ELLGTVTDIHGPEAAVARRTRRRLQALAASGDVRSIT"
     gene            65213..65593
                     /locus_tag="Sfla_6518"
                     /db_xref="GeneID:11353695"
     CDS             65213..65593
                     /locus_tag="Sfla_6518"
                     /inference="similar to AA sequence:KEGG:Aave_0242"
                     /note="KEGG: aav:Aave_0242 FAD linked oxidase
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909442.1"
                     /db_xref="GI:357409155"
                     /db_xref="GeneID:11353695"
                     /translation="MNALDDNLASRDPSTVLAGAWDALDLGARVADAITWEETSDELL
                     ALTAAQECSAARALLPLPGTGRPVPLEASEIQAGPGGLAPYAGLLERTYRALAGLAEQ
                     DVQLSEAAEHAAAAARSLAAVRGQ"
     gene            65593..67155
                     /locus_tag="Sfla_6519"
                     /db_xref="GeneID:11353696"
     CDS             65593..67155
                     /locus_tag="Sfla_6519"
                     /inference="similar to AA sequence:KEGG:RoseRS_0128"
                     /note="KEGG: rrs:RoseRS_0128 peptidase C14, caspase
                     catalytic subunit P20"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909443.1"
                     /db_xref="GI:357409156"
                     /db_xref="GeneID:11353696"
                     /translation="MATLDELFDAAGARLRTAAGTPSSDRSASARDLDLFLSALTEPL
                     DLRDGLGTEDVPRSPVTNDLVYHLRRASDALRSAQRLLPSPGGGPAEGNLPEASAAVH
                     AVRDVIESHRGPDRVPLSAYAYALTTGPAHHYLTRRCAELAWGATQVASALARDSLDP
                     SAAAAFGDVHRFLSEASVFGREGTRDADAAIGALSLTLPVAPVQARSTDRTRDVPANL
                     AEDCDRLSRAAFETLHHRSDHRMSGSDLQQLARWTAIQRLLAGRVLLRAAEELPDEAA
                     AALRDSAGALRGSAQAWQKSATAWHRIVDIADPRSHPKLPPPSYEIVRRGEVVRLPQV
                     VPHPATVIAHTAAVRVGQLLYGPEWRPETATRPEPRAGSEVLADARGTGALASALYRL
                     PAAGWQLALAAPQAVSLARGGLVTDVFEQQAPGRENHRFRPVNPYQLEALSHPYKAVL
                     PAEQASAASLLEVAGQAGVSVPRALLDAAAHRTLAAGQGWGQARKAVRSGQSGFQAQQ
                     PQVRARQRPRSL"
     gene            67308..67427
                     /locus_tag="Sfla_6520"
                     /pseudo
                     /db_xref="GeneID:11353697"
     gene            67498..68571
                     /locus_tag="Sfla_6521"
                     /db_xref="GeneID:11353698"
     CDS             67498..68571
                     /locus_tag="Sfla_6521"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein; integrase domain
                     protein SAM domain protein;
                     KEGG: rop:ROP_pROB01-04990 putative transposase for
                     insertion sequence element"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004909444.1"
                     /db_xref="GI:357409157"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="GeneID:11353698"
                     /translation="MGTVLLDEKWPVLGRHEQAAGWLQVWSDLGRAPRTIDAYARGLA
                     EYLEMCERENVDPLTANRAHIAVYVRELTSRPSRRGANVVSIDSGSGLANATIQQRLV
                     PVRLFYDFLMEDGQRDSNPVGRGRYTPGRRHRGGHERGLVPRLTKMPWIPAEQQWLDI
                     LAVAAAEPVRNRVMLALAYDAALRREELCSLRTDDLDPAHRTLRVRAETTKNRLERVV
                     PYSAPTGVLLSGYLAHRATVSRARGPLFLSESRRNHAQPLSLWTWSKVVRRIALAADV
                     PRFSTHTTRHLCLTDLARMGWELHAIATFAGHRHTDSTLTYIHLSGRDLADKLSRGME
                     QIHGWRVQMLARLGEQATGTVAL"
     misc_feature    67573..68478
                     /locus_tag="Sfla_6521"
                     /note="Site-specific recombinase XerD [DNA replication,
                     recombination, and repair]; Region: XerD; COG4974"
                     /db_xref="CDD:227308"
     misc_feature    67573..67842
                     /locus_tag="Sfla_6521"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_1; cl12235"
                     /db_xref="CDD:245915"
     misc_feature    67975..68454
                     /locus_tag="Sfla_6521"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(68047..68052,68128..68130,68338..68343,68446..68448)
                     /locus_tag="Sfla_6521"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(68047..68049,68128..68130,68341..68343,68350..68352,
                     68419..68421,68446..68448)
                     /locus_tag="Sfla_6521"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(68047..68049,68341..68343,68350..68352,68419..68421,
                     68446..68448)
                     /locus_tag="Sfla_6521"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(68047..68049,68350..68352,68446..68448)
                     /locus_tag="Sfla_6521"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            68568..70931
                     /locus_tag="Sfla_6522"
                     /db_xref="GeneID:11353699"
     CDS             68568..70931
                     /locus_tag="Sfla_6522"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein;
                     KEGG: rop:ROP_pROB01-05000 putative transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004909445.1"
                     /db_xref="GI:357409158"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:11353699"
                     /translation="MTAAISAAASETAATPSWPWPIDLARYDRRPALTERERAALTSL
                     GWEVRRRRGYAPDRVEWPAISRLLRPLDDARAALRWCPDTPSHRRAVTDAIGLVLRRC
                     LEDGTSLWAWSADDWVRLIAPGHKEFEAAWPGWIDGSVRPYVAAFAYLLGDFTDFHRI
                     GGFIRRSLAWRVFGQEPVEETIAQVAATLQGWGYHPSNGAFGQFRTVLVQIMLINRSP
                     LLQDMTTDALQRARESPALPSGARRGNLHGVHRAIAALGHAGPPPKPIHAVMPDLEGV
                     PEPWAAMVERWHDTSTLTPKVRGGFRSIVAKAGRWLAAEHPEIVEPGQWTRETCAAWV
                     AALDRMTVGEHVQRRAGLDKRGGKPLSPRTKAGYLTATRTFFRDCQEWEWIPRRFDPV
                     RALATPRSVAALIGPNPRVIADDIWAKLLWAGLNVDPEDFPTNTYGLCYPIELIRAVT
                     LTWLFGGLRSDEISRLRTGCIRWQHDGFPIPGDSDEVLARDAVCLLDVPTHKTGTSFT
                     KPIDPLLGKAIEAWQDARPQQPKMLDRKTGEQVDFLFAHRAKRLANTYINTAVIPSLC
                     RKAGVPTADVRGNITSHRARSTIASQLYNAKEPMTLFELQAWLGHRSPESTQHYAKIT
                     PNTLARAYNDAGYFERNVRTIEVLVDRDAVTSGAAASGEPWQYYDLGHGFCTYTFFEQ
                     CPHRMACARCDFYTPKATSKGQLLEAKDNLQRMLASVPLSDEERAAVDDGQAALDQLL
                     ERLVDVPTPAGATPREIGAPATATLLPIVAVNQGASAECRPAMRAPR"
     misc_feature    69903..70433
                     /locus_tag="Sfla_6522"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(69942..69947,70071..70073,70311..70316,70425..70427)
                     /locus_tag="Sfla_6522"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(69942..69944,70071..70073,70314..70316,70323..70325,
                     70398..70400,70425..70427)
                     /locus_tag="Sfla_6522"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(69942..69944,70314..70316,70323..70325,70398..70400,
                     70425..70427)
                     /locus_tag="Sfla_6522"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(69942..69944,70323..70325,70425..70427)
                     /locus_tag="Sfla_6522"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(70912..71634)
                     /locus_tag="Sfla_6523"
                     /db_xref="GeneID:11353700"
     CDS             complement(70912..71634)
                     /locus_tag="Sfla_6523"
                     /inference="similar to AA sequence:KEGG:Krad_3402"
                     /note="KEGG: kra:Krad_3402 GCN5-related
                     N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="YP_004909446.1"
                     /db_xref="GI:357409159"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11353700"
                     /translation="MSIDPLLARARGLWEELASVPVSFASTGGVRVVVSPESRMCPSG
                     WVGVVVLGNSAIVTAPSQDTAKTVRDALAKLPVGALAGAHSVRGVLPVARVLGPAALA
                     YVSDNGFRPVADRRLTVQLVPGEHPDLRELENLAGADDSDEAGLNEITSPAFVIRERG
                     QIVAAAGYRSWPSRTAHVSVLTAPAWQGRGLARATGSGAVAHALTAGLLPQWRARVPA
                     SRRVALALGFRELGAQLSVELA"
     misc_feature    complement(70939..>71205)
                     /locus_tag="Sfla_6523"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            71790..72173
                     /locus_tag="Sfla_6524"
                     /pseudo
                     /db_xref="GeneID:11353701"
     gene            complement(72293..72682)
                     /locus_tag="Sfla_6525"
                     /db_xref="GeneID:11353702"
     CDS             complement(72293..72682)
                     /locus_tag="Sfla_6525"
                     /inference="similar to AA sequence:KEGG:SCO4460"
                     /note="KEGG: sco:SCO4460 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909447.1"
                     /db_xref="GI:357409160"
                     /db_xref="GeneID:11353702"
                     /translation="MSSPQVITPADKLAEAKEQLNFPRIVAICGSTRFMAEMAEADVR
                     ETKAGRIVVKPGCDLKSPHELWSDPVAAEALKIQLDELHRSKILLADEVLVVGDYIGD
                     STTSEIAYARSLGRPVRFTHPEVDPDA"
     gene            complement(73039..73338)
                     /locus_tag="Sfla_6526"
                     /db_xref="GeneID:11353703"
     CDS             complement(73039..73338)
                     /locus_tag="Sfla_6526"
                     /inference="similar to AA sequence:KEGG:Amir_3273"
                     /note="KEGG: ami:Amir_3273 aminoglycoside
                     phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909448.1"
                     /db_xref="GI:357409161"
                     /db_xref="GeneID:11353703"
                     /translation="MVGAIRGQARSAGEAFGLASHVRGGRWEHWGELPFGYDVALLEA
                     CSQAAPSTAARLHHEFSRDLDASAGRAGDWSRSGGACRLAAGVITGGQLCVTAVI"
     gene            74387..74962
                     /locus_tag="Sfla_6527"
                     /db_xref="GeneID:11353704"
     CDS             74387..74962
                     /locus_tag="Sfla_6527"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: sco:SCP1.305 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_004909449.1"
                     /db_xref="GI:357409162"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:11353704"
                     /translation="MTQPTTPPPALLAWASRELGARPAVKDVSHPRESSRVWRLDLPG
                     AVRFYLKISPKAVMYERETLALRSAAPALGAGAAPQLRASSAEDLALLLTAVPGRPLK
                     HLKLSPVEEARAHRHGGALLARLHAASDLSGTRRADAEQALQTAADNAEGHLAAAGDR
                     LTAPEQKLVRQLAEELRALPPLAPAYIHGDA"
     misc_feature    74486..>74956
                     /locus_tag="Sfla_6527"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    <74645..74776
                     /locus_tag="Sfla_6527"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     gene            complement(75063..75830)
                     /locus_tag="Sfla_6528"
                     /db_xref="GeneID:11353705"
     CDS             complement(75063..75830)
                     /locus_tag="Sfla_6528"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: mxa:MXAN_1754 short chain dehydrogenase/reductase
                     family oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004909450.1"
                     /db_xref="GI:357409163"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:11353705"
                     /translation="MNPTYDFTGQVAFVTGASSGMGLATARAFAASGAAVALADINED
                     AVNAAAKQLADDGHQALALVCDVTDEHQVAAAVDRTVEAFGRLDMAYNNAGIMPAPTD
                     AADESADQFDRVQNINLRGIWAAMKHELRHMRTQGSGAIVNCSSLGGLVGNPGRAAYH
                     ASKHGVIGLTKSAALEYGSRGVRINAVCPGTISTPMVDAMIEGGELDRSQAEGGQAID
                     RLGTADEIAQAVLWLCSDGASYVTGIALPVDGGYVAQ"
     sig_peptide     complement(75738..75830)
                     /locus_tag="Sfla_6528"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.833) with cleavage site probability 0.747 at
                     residue 31"
     misc_feature    complement(75066..75815)
                     /locus_tag="Sfla_6528"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06172"
                     /db_xref="CDD:180440"
     misc_feature    complement(75084..75797)
                     /locus_tag="Sfla_6528"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(75246..75251,75255..75266,75342..75344,
                     75354..75356,75393..75401,75480..75482,75546..75554,
                     75630..75638,75705..75713,75768..75779,75783..75785))
                     /locus_tag="Sfla_6528"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(75342..75344,75354..75356,75393..75395,
                     75477..75479))
                     /locus_tag="Sfla_6528"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(75889..76656)
                     /locus_tag="Sfla_6529"
                     /db_xref="GeneID:11353706"
     CDS             complement(75889..76656)
                     /locus_tag="Sfla_6529"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: mno:Mnod_8333 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004909451.1"
                     /db_xref="GI:357409164"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11353706"
                     /translation="MTVTYDFHGKSAFVTGAASGIGRTTALAFARAGAQVALVDRSAE
                     GLRETARLLEADGGKALALTCDVTSEEDVQAAVDQTVERFGSLDAAFNNAGVEQPVQS
                     AADTAKDDWDRILGVSLTGAFLCTRAQVRQMLRQAGGGAIVNVSSGAGVKGFKGQAAY
                     AAAKHGVIGFTRSAALDHAAAGIRINALCPGIIDTEMIRRFGDSRPGGRAGLIADEPV
                     GRLGKPEEIASAVLWLCSDDAAFTTGTALVVDGGQTV"
     misc_feature    complement(75895..76641)
                     /locus_tag="Sfla_6529"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06172"
                     /db_xref="CDD:180440"
     misc_feature    complement(75907..76623)
                     /locus_tag="Sfla_6529"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(76069..76074,76078..76089,76165..76167,
                     76177..76179,76216..76224,76306..76308,76372..76380,
                     76456..76464,76531..76539,76594..76605,76609..76611))
                     /locus_tag="Sfla_6529"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(76165..76167,76177..76179,76216..76218,
                     76303..76305))
                     /locus_tag="Sfla_6529"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(76704..77954)
                     /locus_tag="Sfla_6530"
                     /db_xref="GeneID:11353707"
     CDS             complement(76704..77954)
                     /locus_tag="Sfla_6530"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: amd:AMED_3723 MFS transporter, arabinose efflux
                     permease"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="YP_004909452.1"
                     /db_xref="GI:357409165"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11353707"
                     /translation="MSSATGSAPGKLPFVVWVLATGTFLMGTTEFVIAGLLPEMAADL
                     TVSVSHAGLLITAFAVGMIIGGPTMAMATLRLPQRHTLIGALAVFALGHAVAALSTSF
                     TVVLTARVVTALATGAFWAVGFVIATTTAGPASATRAVGVMMGGLTLANVVGVPIGSF
                     VGQYTGWRGPFWALAVLAALAAAFVGRFIPRTDQEAQVSVRAEVRALKQGRLWLALGA
                     AVLIMGGVLATYTYITPLLTDRAGIPAGAVPLVLIAFGIGALGGTAIGGRLGDRRPMV
                     TTITASAATSLILLALIPASSSPVAAVVLVFGMALAGFTVNPVVTSLAVRFAGDAPTL
                     TSALTTSGYNTGIAAGSLAAGRALDSSLGLTGPALVGAVFAALTLLPLIALALSGTRH
                     RTRIVAQRATAAPVREDASAPAHH"
     misc_feature    complement(76782..77948)
                     /locus_tag="Sfla_6530"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(76815..77909)
                     /locus_tag="Sfla_6530"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(76914..76916,76923..76928,76935..76940,
                     76947..76952,76980..76982,76989..76994,77004..77006,
                     77013..77018,77025..77027,77166..77168,77178..77180,
                     77187..77189,77199..77201,77211..77213,77253..77255,
                     77262..77267,77274..77279,77286..77288,77502..77504,
                     77520..77525,77532..77537,77571..77573,77580..77585,
                     77592..77597,77604..77609,77745..77750,77754..77759,
                     77769..77771,77778..77783,77790..77792,77841..77846,
                     77850..77858,77865..77867))
                     /locus_tag="Sfla_6530"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(77996..78532)
                     /locus_tag="Sfla_6531"
                     /db_xref="GeneID:11353708"
     CDS             complement(77996..78532)
                     /locus_tag="Sfla_6531"
                     /inference="similar to AA sequence:KEGG:AMED_3727"
                     /note="KEGG: amd:AMED_3727 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909453.1"
                     /db_xref="GI:357409166"
                     /db_xref="GeneID:11353708"
                     /translation="MTAFSLRRSLTATAATGVLLLAATACSDDSSAEQTTASASSSAL
                     ATTPASASASPTWPDRSTPMDIRVTIDGQEVEATLNGSPAARDLASLLPLTLDLEDFH
                     GTERITDPPRKLTTENAPEPQAPKTGDLTYYAPWGNLAIFYKDGPSASEDLLVLGHID
                     ADADQLSGAGRITIEAAS"
     sig_peptide     complement(78449..78532)
                     /locus_tag="Sfla_6531"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.848 at
                     residue 28"
     misc_feature    complement(78008..>78391)
                     /locus_tag="Sfla_6531"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4925"
                     /db_xref="CDD:227262"
     gene            complement(78529..79212)
                     /locus_tag="Sfla_6532"
                     /db_xref="GeneID:11353709"
     CDS             complement(78529..79212)
                     /locus_tag="Sfla_6532"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: sma:SAV_2345 dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004909454.1"
                     /db_xref="GI:357409167"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="GeneID:11353709"
                     /translation="MTTFALVGAGPGLGLAAARRFGQAGHRVALLSRSAQHQDNLAAE
                     LARDNIHARGFTADVLDPASLTAALQEAADTLGPVEILQFSPVPRGDFMKPVLDTTAA
                     DLDDPLAFSVKGPLTCVNAVLPGMRELGRGTLLFVNGGSAVRPKASVAGTSIAFAAES
                     AYAAMLHTALADENIHAAQLIVPGAISPDSATSSPEKLAELLYGLHTGRKGFRHYAEP
                     MPDPQDGTP"
     misc_feature    complement(78592..79206)
                     /locus_tag="Sfla_6532"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(78658..78669,78745..78747,78757..78759,
                     78796..78804,78952..78960,79108..79116,79174..79176,
                     79180..79185,79189..79191))
                     /locus_tag="Sfla_6532"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(78745..78747,78757..78759,78796..78798,
                     78880..78882))
                     /locus_tag="Sfla_6532"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(79287..79697)
                     /locus_tag="Sfla_6533"
                     /db_xref="GeneID:11353710"
     CDS             complement(79287..79697)
                     /locus_tag="Sfla_6533"
                     /inference="protein motif:PFAM:PF07883"
                     /note="PFAM: Cupin 2 conserved barrel domain protein;
                     KEGG: gob:Gobs_2099 cupin 2 conserved barrel domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin 2 conserved barrel domain protein"
                     /protein_id="YP_004909455.1"
                     /db_xref="GI:357409168"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:11353710"
                     /translation="MQITRSSIDTIKGPADWFTGDVYIDAVAAAPAPSRVTANLVHFM
                     PGARTYWHRHPLGQTVFVTEGVGLCQRRGGPVEVIRPGDRVLFEADEEHWHGAAPNRL
                     MVHLAVNEGDDDHAVVHWLNPVTDEEYTATPATG"
     misc_feature    complement(79323..79664)
                     /locus_tag="Sfla_6533"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(79732..80748)
                     /locus_tag="Sfla_6534"
                     /db_xref="GeneID:11353711"
     CDS             complement(79732..80748)
                     /locus_tag="Sfla_6534"
                     /inference="protein motif:PFAM:PF00107"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: amd:AMED_3724 threonine dehydrogenase and related
                     Zn-dependent dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_004909456.1"
                     /db_xref="GI:357409169"
                     /db_xref="GO:0008270"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:11353711"
                     /translation="MRGAVIYAPGDIRFEAVDDAKILKPTDAVIRTAVTCVCGSDLWP
                     YRGAEPTEHAHPMGHEYVGFVEEVGSEVTSVKPGQFVVGSFATSDNTCANCRNGFQSN
                     CLNREFMSTCQAEYVRIPNAQGTLVATEDVPGEDLWPGLLAVSDVMGTGWWAADAAEV
                     RPGSTAVVVGDGAVGLCGVIAAKELGAERIIAMSRHASRQKLAREFGATDIVTERGEE
                     GVARIKELTGGIGADSVLECVGTAQAMSQALHSARPGGNVGFVGVPHEVAVDGQELFF
                     SHVGLRGGPAPVRRYLPDLIDRVLSGRIDPGKVFDLTLPLDQVAEGYKAMDERRAIKT
                     LLTP"
     misc_feature    complement(79735..80748)
                     /locus_tag="Sfla_6534"
                     /note="formaldehyde dehydrogenase (FDH)-like; Region:
                     FDH_like_ADH3; cd08287"
                     /db_xref="CDD:176247"
     misc_feature    complement(79735..80748)
                     /locus_tag="Sfla_6534"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(order(80311..80313,80572..80574,80629..80631,
                     80635..80637))
                     /locus_tag="Sfla_6534"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176247"
     misc_feature    complement(order(79891..79899,80017..80019,80032..80037,
                     80152..80154,80164..80169,80227..80235,80239..80241,
                     80299..80301,80311..80313,80494..80496,80620..80622,
                     80629..80634))
                     /locus_tag="Sfla_6534"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176247"
     misc_feature    complement(order(80440..80442,80464..80466,80473..80475,
                     80482..80484))
                     /locus_tag="Sfla_6534"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176247"
     gene            81013..81909
                     /locus_tag="Sfla_6535"
                     /db_xref="GeneID:11353712"
     CDS             81013..81909
                     /locus_tag="Sfla_6535"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: amd:AMED_3725 XRE family transcriptional
                     regulator;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004909457.1"
                     /db_xref="GI:357409170"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353712"
                     /translation="MDNREEVREFLTSRRAKITPEQAGLPAGPRRRVPGLRRSEVAAL
                     ADMSVEYYAKLERGNLAGVSPSVLEALARALQLDDAERAHLLNLAQAADGSDVLNRPR
                     RRRTKDQWRPHRSLQWTLDAITAGPAFVRNGRMDILAANPLARAFYGDVYATPGNQAN
                     LARFNFLDPASRRFYPDWDLFADVAVAILRTEAGRNPHDKDLHDLVGELSTRSEEFRT
                     RWGAHNVRHHGTGTKRFHHSAVGELTLAFEGLEMAAEPGLTLTIYTAEPGSPSEEGLR
                     LLASWAATQNSDSPSTTENAGR"
     misc_feature    81100..81255
                     /locus_tag="Sfla_6535"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(81103..81105,81178..81180)
                     /locus_tag="Sfla_6535"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(81106..81108,81181..81183)
                     /locus_tag="Sfla_6535"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    81115..>81363
                     /locus_tag="Sfla_6535"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    order(81124..81129,81160..81162,81169..81171,81181..81186)
                     /locus_tag="Sfla_6535"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(82043..82480)
                     /locus_tag="Sfla_6536"
                     /db_xref="GeneID:11353713"
     CDS             complement(82043..82480)
                     /locus_tag="Sfla_6536"
                     /inference="similar to AA sequence:KEGG:Noca_4887"
                     /note="KEGG: nca:Noca_4887 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909458.1"
                     /db_xref="GI:357409171"
                     /db_xref="GeneID:11353713"
                     /translation="MTRKSRDREAERQHIRAAAERLLAGTPLRSPVGKLTGTELIAEC
                     GLRRDVVYGDHKELVDEFRARAKAQNFTPQVVQSMADENIVLREALAKIKAELAAERE
                     RVRALVRAATELSLELEQAREELAAAQQVTWLPGPRETRRVPD"
     gene            complement(82477..84621)
                     /locus_tag="Sfla_6537"
                     /db_xref="GeneID:11353714"
     CDS             complement(82477..84621)
                     /locus_tag="Sfla_6537"
                     /inference="protein motif:PFAM:PF02899"
                     /note="PFAM: integrase domain protein SAM domain protein;
                     KEGG: nca:Noca_4886 phage integrase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase domain protein SAM domain protein"
                     /protein_id="YP_004909459.1"
                     /db_xref="GI:357409172"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="GeneID:11353714"
                     /translation="MTTANDGAATLPSLLSELADREVLHTRSVRHGTDRAALSKVGDR
                     VWSLAEAQPDQHTQSIMLHWSTYPNLLEYDFRLFILATLDSPYPPALGRFTGIDQASV
                     STVSNWFKRLRVFATWLRHRGIDRLYEVSDRDLDLYLDHVRSIQASTGTRRQLLSAVR
                     AVWAYAQYLPPECRMSVAEPWQGRSPGELAEDIQTGRGNKTARIAVDTMIPLLDWALR
                     IVEDIGPDVRDAWREFRQLYTGTHPGQARFAGLPRTERLNLFLRDAHRTGAALPGDPE
                     NPGAIDYKYLACLLGLPVLSNSLGLGPRSIAEASGIPVAGDFFIGSVTGQVDGRPWRD
                     KPITASELPELVWVVTAACFVIVSYLSGMRPGEVSNLRRGCRAEDPDSGELLVLGHRG
                     KGHNRTAAESHRPASRPWAVVRPVHQAIDLLETLHATDLLFPTRLPGSSGRKSRRMGT
                     LTWGSSKTIRELQRLQDWVNSTFTPTEGGVAIPPDPIKHLHASRFRRTLAYFIVRRPR
                     GLIAAALQYGHLKTKVTLNYAATGDDSWLDDVAVERLEMVLEQSEDDWTRLDEDNEHV
                     SGPAAAEYRRRTAGAATFLGRTVRAQASVKRLLEQSDTDIHHGEAMTCVHRAETAECR
                     KEKLLLGLPADDGPDESLCHSTCANLAYTDRDIADHRMRLLVLETEARDPMTPRPRRD
                     RAAAKAAQICAVIELHEASRPEVTHVEGGRVA"
     misc_feature    complement(84124..84327)
                     /locus_tag="Sfla_6537"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_1; cl12235"
                     /db_xref="CDD:245915"
     gene            complement(84618..86477)
                     /locus_tag="Sfla_6538"
                     /db_xref="GeneID:11353715"
     CDS             complement(84618..86477)
                     /locus_tag="Sfla_6538"
                     /inference="similar to AA sequence:KEGG:Franean1_2617"
                     /note="KEGG: fre:Franean1_2617 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909460.1"
                     /db_xref="GI:357409173"
                     /db_xref="GeneID:11353715"
                     /translation="MPPSDWRPPERLLEASGGTAVRVIEESGARSRVFDFANIRDPKG
                     KRVLIDEGLQRWFASAFAERTSPRSGVKRVRGAESLYSVLSWLARYFSVQSPTVREPG
                     DVTEAHVLELWTHTEGRNAASQCTHLHRLRQLWRDDKKLSKEVRDALYKERMPEVTEI
                     SDVPEYDDDAMQRIMVALRHDIRVARDRIRAGQHLLARYRAGQIRSGHPDHELGMLLD
                     VFERTGDLPRTPGGTMVSVVWKLGGSQEITRRLCLSSRELTAFGLLLTALTAENFGTV
                     AAWPAAHYRPDGGVEGVPQIALIEASKPRRGPEREHMVTPVEDVPEELAVLLVADDPE
                     PRLFRSPLRVYQLLLDLTQLARRHGGHSSAFAGFRTQTSGAKRWTRGADAKNIARWSV
                     QHGFPTKEPTKDGVEPVEARRLRQTGIERKRRPVAHSRSTMNDHYLARSQDVATQSRV
                     VVADALRSQVAAARKRRSIAVLPAALVARAASDLEGAARDAELDPTVLRRLVSGEQDT
                     VLAGCTDHLNSPGAPPGEPCAESFLACLGCENARALPHQLPLQIAALDQMSILKVHTD
                     VATWNARHAVHHERLQDLVGQYHQSEQDLARRRLTGRQSEMINDLMAGRMDLR"
     gene            complement(86510..88078)
                     /locus_tag="Sfla_6539"
                     /db_xref="GeneID:11353716"
     CDS             complement(86510..88078)
                     /locus_tag="Sfla_6539"
                     /inference="protein motif:PFAM:PF02899"
                     /note="PFAM: integrase domain protein SAM domain protein;
                     KEGG: fre:Franean1_2813 integrase domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase domain protein SAM domain protein"
                     /protein_id="YP_004909461.1"
                     /db_xref="GI:357409174"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="GeneID:11353716"
                     /translation="MRDRWSVEFYDFLKPPPSLGEVMLGGFGDLHDRAARNGAQHGTP
                     VLFTVSGFADPGVNLFFRVSPMKGRGARTWKRYAYTLVVWLNFLQVFGKGWREATARD
                     VEAFKDWRLTDVRNDDRIKAASFDTDRAALNTFYTWAFGKYGVQNPVSGIAPASNSGS
                     RPEQGIGPGGERRDGLRPAGSRGRKVKWMLRAPFEQWRDIGLRGYGFDGLRRTGWSGP
                     NEDRDAVFVDGLYGTGLRLQEWGSVLDVEMPRSAGGRLPRAWLAAACVKGAKEGRWYR
                     MPRAVLREIEGYTDPLEGSRTQAIRRAQRRGAYEKIPYRRVVSGYNARSRLLYLESGG
                     SLSVDVLGPDERRLLFRRTTTGLEPLALWLSPNGMPKKFEGWEDTFTAANERIQRVWV
                     QAGGEGLVPLWCRPHMCRHSFALKWYSLLSTVWQPQLDGFTEQELLDIREMFGGVWYA
                     LSLMLGHADPSTTRETYLEPFTALQVDYLMELLDSEETQAVEALIRTVAEQGGRTLTS
                     VARPGALAQTGGRA"
     misc_feature    complement(87653..87883)
                     /locus_tag="Sfla_6539"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_4; cl17873"
                     /db_xref="CDD:266900"
     misc_feature    complement(86675..>87043)
                     /locus_tag="Sfla_6539"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(86678..86680,86858..86863))
                     /locus_tag="Sfla_6539"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(86678..86680,86708..86710,86849..86851,
                     86858..86860))
                     /locus_tag="Sfla_6539"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(86678..86680,86708..86710,86849..86851,
                     86858..86860))
                     /locus_tag="Sfla_6539"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(86678..86680,86849..86851))
                     /locus_tag="Sfla_6539"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            88191..88493
                     /locus_tag="Sfla_6540"
                     /pseudo
                     /db_xref="GeneID:11353717"
     gene            88490..89521
                     /locus_tag="Sfla_6541"
                     /db_xref="GeneID:11353718"
     CDS             88490..89521
                     /locus_tag="Sfla_6541"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase; GCN5-related
                     N-acetyltransferase;
                     KEGG: sgr:SGR_1261 putative acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_004909462.1"
                     /db_xref="GI:357409175"
                     /db_xref="GO:0008080"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11353718"
                     /translation="MNPDTKTAAASNGFGGSASVRAATAGDAEAICRMRSAYVLSAPL
                     ADEWLRHGAADLAPRLTSTGDARAFVIDAPDGTLAACALGLVSPVLPAPSYPRGLSAR
                     VQLVATHPHHRRRGYARAVVSALLDRLVDEDVTLFELHTSPEAAPLYREFGFSGSAAL
                     MRMTRRSTSAPPSTATGSRSSPVPPEQHAQSLPPSVAFVCLYVTDEDDRPLGLHSVYS
                     PSHPWHMIGGALDLGETPWAAAVRECREETGLTIAGPPRLLASVYGPPRDRRPYSTVQ
                     FVFDGGRLGEDQIARIVLAPDEHDEARFLPLEQWQELMPASDFARLRSVSEARRTGVA
                     AYLDTWGTT"
     sig_peptide     88490..88558
                     /locus_tag="Sfla_6541"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.912) with cleavage site probability 0.818 at
                     residue 23"
     misc_feature    88568..88951
                     /locus_tag="Sfla_6541"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    88712..88909
                     /locus_tag="Sfla_6541"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(88805..88813,88841..88846)
                     /locus_tag="Sfla_6541"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    89084..89428
                     /locus_tag="Sfla_6541"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cd02883"
                     /db_xref="CDD:239217"
     misc_feature    order(89171..89179,89207..89233)
                     /locus_tag="Sfla_6541"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            89536..90120
                     /locus_tag="Sfla_6542"
                     /pseudo
                     /db_xref="GeneID:11353719"
     gene            complement(90185..91702)
                     /locus_tag="Sfla_6543"
                     /db_xref="GeneID:11353720"
     CDS             complement(90185..91702)
                     /locus_tag="Sfla_6543"
                     /inference="similar to AA sequence:KEGG:SCAB_74181"
                     /note="KEGG: scb:SCAB_74181 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909463.1"
                     /db_xref="GI:357409176"
                     /db_xref="GeneID:11353720"
                     /translation="MNHVLCGLAANVSLPAELVDRLIAVADAEIAADLAHRAGLSHAQ
                     AVVLASRVEESAVSLAYAGLLTAADVDPATQPDVALALLAERSGRPEWGRLLAEDPVV
                     ERREKLAACSGLPLDVVEMLATDSDVQVVAALALGTTPETATRLAAHPHAEVRRAVAA
                     NEATPPAVLAALLTGEGQPPAQWCLVCDREEAPFMHDPQCSRLDCDLLSGASCDGSHE
                     STRHDMQQMAIRNPATPTEAVVDFVGHPSLLLRWALAGRPDLPSEVCAQLAVDSNPGV
                     RADLAENPAIDEALIRVLATDRDHEVRRRLAHNPLVPLDVLTHLAGATKIGATLLPRI
                     ASASPDEVEKLAESPNPAARMLVAQRRNLPPATRDALAADSDAKVLKSIAPHPGLSEG
                     QLRTMLDRHGVRVVAKVASNPDAAPALLEDLARHAPSVQKAFREIARHRNASAPALLA
                     CLADAQARRIAASHAALPPPLIEELLTDADWQVVEAAAANPSLPLAVMSELTSRL"
     misc_feature    complement(<90299..90673)
                     /locus_tag="Sfla_6543"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2336); Region: DUF2336; cl19891"
                     /db_xref="CDD:268244"
     gene            complement(91759..92001)
                     /locus_tag="Sfla_6544"
                     /db_xref="GeneID:11353721"
     CDS             complement(91759..92001)
                     /locus_tag="Sfla_6544"
                     /inference="similar to AA sequence:KEGG:Micau_1771"
                     /note="KEGG: mau:Micau_1771 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909464.1"
                     /db_xref="GI:357409177"
                     /db_xref="GeneID:11353721"
                     /translation="MWAGDRPLDNHQAGSTYDELYERYLESDEVVVPPVPDIRAYVEA
                     LSESSSEAAANVVPLQPKGDEQTGTSERRSGPPLYR"
     gene            92279..92623
                     /locus_tag="Sfla_6545"
                     /db_xref="GeneID:11353722"
     CDS             92279..92623
                     /locus_tag="Sfla_6545"
                     /inference="similar to AA sequence:KEGG:611437"
                     /note="KEGG: cfa:611437 hypothetical protein LOC611437"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909465.1"
                     /db_xref="GI:357409178"
                     /db_xref="GeneID:11353722"
                     /translation="MYRALRLLAVGVTALAMAVSLDVPAHAAASACTHHLSGPRVCIS
                     VTGSSGSANPGRVHTARTNQPRCSTTATVHITEPGGQTYTLTDRRHGGRLVASFAPGI
                     QTDGKLCARYQG"
     sig_peptide     92279..92362
                     /locus_tag="Sfla_6545"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.905 at
                     residue 28"
     misc_feature    <92282..92407
                     /locus_tag="Sfla_6545"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     gene            complement(92953..93165)
                     /locus_tag="Sfla_6546"
                     /db_xref="GeneID:11353723"
     CDS             complement(92953..93165)
                     /locus_tag="Sfla_6546"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909466.1"
                     /db_xref="GI:357409179"
                     /db_xref="GeneID:11353723"
                     /translation="MSVRDLPPARELTEYQRRGWSCVWCHAVLDATRAVDLGQQRVKP
                     DEGAAYSWFPRACADKAGCAERETAK"
     gene            complement(93274..94458)
                     /locus_tag="Sfla_6547"
                     /db_xref="GeneID:11353724"
     CDS             complement(93274..94458)
                     /locus_tag="Sfla_6547"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: fre:Franean1_1330 XRE family transcriptional
                     regulator;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004909467.1"
                     /db_xref="GI:357409180"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353724"
                     /translation="MPRLDDDATGTRIKEQRRLARLTQRELADRLPYSYSLLNQVECG
                     AKPANLDFVAAVARALHVDVTVLTGQPYVTELQQDRLAELVRPIREALDLYDLGIDDS
                     IPDRPHAQLVAGADHLCAQVRATHLRNAARVLPATIAELTTAAWRTQSTELWQALAST
                     YRTAHDIAVKLGYYDLSSVALDRMDWAAQRASDPCLAAIRQYMRAMGHFREGGNAIGL
                     RLIAAGHGVVGATEQTREALAVTGQLHLGASVIAARAGDQTAVDAHIAEAEHCAEQVG
                     DASEIHWLSFGPTNVDLHRMSAAVEMRHYGDALEQAGQVFLPGSLATSRRAHFLIDRA
                     RSEMETGRTEAALGSIVEARQAAPEQTRYHPGARETIKGLVHASRRAPHSLGGMAAWI
                     GL"
     misc_feature    complement(<94186..94431)
                     /locus_tag="Sfla_6547"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(94258..94431)
                     /locus_tag="Sfla_6547"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(94330..94332,94405..94407,94417..94419))
                     /locus_tag="Sfla_6547"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(94333..94335,94408..94410))
                     /locus_tag="Sfla_6547"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(94327..94332,94342..94344,94351..94353,
                     94384..94389))
                     /locus_tag="Sfla_6547"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            94577..95113
                     /locus_tag="Sfla_6548"
                     /db_xref="GeneID:11353725"
     CDS             94577..95113
                     /locus_tag="Sfla_6548"
                     /inference="protein motif:PFAM:PF02441"
                     /note="PFAM: flavoprotein;
                     KEGG: cai:Caci_8590 flavoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_004909468.1"
                     /db_xref="GI:357409181"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="GeneID:11353725"
                     /translation="MTTLYLFGAAAPPVLEISGVIERAQSRGWDVCLGLTPTAARWLE
                     SDLLALEELTRHPVRSEYKMPCEPDAWPSADVILFAPATFNSVNHWALGLTDRFVIGV
                     VAEAVGKRIPVVAMPCLNAAYVQHRAFGRSVAELREMGVTVLYGEGGFVPNRPGDKVP
                     FPWHLALAAVESIVSRRP"
     misc_feature    94616..95101
                     /locus_tag="Sfla_6548"
                     /note="Flavoprotein; Region: Flavoprotein; cl19190"
                     /db_xref="CDD:267543"
     gene            95434..95880
                     /locus_tag="Sfla_6549"
                     /db_xref="GeneID:11353726"
     CDS             95434..95880
                     /locus_tag="Sfla_6549"
                     /inference="similar to AA sequence:KEGG:Franean1_1581"
                     /note="KEGG: fre:Franean1_1581 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909469.1"
                     /db_xref="GI:357409182"
                     /db_xref="GeneID:11353726"
                     /translation="MHALFDQPEVRRVSRGEYPLWDEALAVLNQDLAVTLPEQGPLQL
                     LAQPSYEAGEPEYVYVALANGEWHGSHLYPKTAEDSAHALAIVADAAQESVAERLWQA
                     WPLCVEHNLGMHTRDVEGLLSWWCAGRRSGGRPGHICAAVGALDTF"
     gene            96343..97272
                     /locus_tag="Sfla_6550"
                     /db_xref="GeneID:11353727"
     CDS             96343..97272
                     /locus_tag="Sfla_6550"
                     /inference="protein motif:PFAM:PF03747"
                     /note="KEGG: sco:SCO0086 ribosylglycohydrolase (secreted
                     protein);
                     manually curated;
                     PFAM: ADP-ribosylation/Crystallin J1"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribosylation/Crystallin J1"
                     /protein_id="YP_004909470.1"
                     /db_xref="GI:357409183"
                     /db_xref="InterPro:IPR005502"
                     /db_xref="GeneID:11353727"
                     /translation="MKRIQRVTGAVVGAAVGDALGGPFEFGPPGAFSARFSAPGAGGE
                     MSGGGGWDPGEATDDTQMAVLVAESLLEQGGLDLPDIFGRFQRWAASEPKDIGLQTED
                     VLTNGMPWDLAAAIHFQVNQRAAGNGSLMRASTSAVHFAAAGQEATMDAARRIAALTH
                     GDRAAWEGTAIFHELIRVTFEDTDPVAALPDILAHVHPDHRSRYATVLAPDWHPDQAT
                     EFNGAVWPCLGSAVWALRTTTSFEDAIRAAIDLGGDTDTVAAVAGGLAGAYYGLDAIP
                     ARWAQPVHVPLPGFDGRVLHLADLLLLAHRLGG"
     misc_feature    96367..97179
                     /locus_tag="Sfla_6550"
                     /note="ADP-ribosylglycohydrolase; Region: ADP_ribosyl_GH;
                     pfam03747"
                     /db_xref="CDD:252144"
     gene            complement(97865..98712)
                     /locus_tag="Sfla_6551"
                     /pseudo
                     /db_xref="GeneID:11353728"
     gene            complement(98699..99007)
                     /locus_tag="Sfla_6552"
                     /pseudo
                     /db_xref="GeneID:11353729"
     gene            complement(99118..101392)
                     /locus_tag="Sfla_6553"
                     /pseudo
                     /db_xref="GeneID:11353730"
     gene            complement(100085..101068)
                     /locus_tag="Sfla_6554"
                     /db_xref="GeneID:11353731"
     CDS             complement(100085..101068)
                     /locus_tag="Sfla_6554"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: sma:SAV_884 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic region"
                     /protein_id="YP_004909471.1"
                     /db_xref="GI:357409184"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11353731"
                     /translation="MSHRNARLTVHGRRLLIQRVRSGRPVAHMAEEMGISRATAHKWV
                     RRWQAEGDPGLFDRSSRPRTTPHRTAPETEAAVCDLRQTRKLGPARIGPILGLPASTV
                     HRILTRHGLNRLAWLDRPTGEPIRRYERSRPGELVHVDIKKLGNIPDGGGWRAVGRTA
                     GNQNRQNTTDLRKSCKPVIGYSYIHSAVDDHSRLAYSEVLADERQHTAIGFWQRAHAF
                     FMGHGVTVERVMTDNGSCYKSRLFTQALTTHGIAHKRIRPYRPQTNGKVERFNRTLLD
                     EWAYLRPYTSNDERTEALADFLHTYNHHRCHTALGGLPPVSRVNNASGQYT"
     misc_feature    complement(100826..101065)
                     /locus_tag="Sfla_6554"
                     /note="Homeodomain-like domain; Region: HTH_23; cl17451"
                     /db_xref="CDD:266692"
     misc_feature    complement(100739..101032)
                     /locus_tag="Sfla_6554"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    complement(100235..100531)
                     /locus_tag="Sfla_6554"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(100124..100324)
                     /locus_tag="Sfla_6554"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            101889..102806
                     /locus_tag="Sfla_6555"
                     /db_xref="GeneID:11353732"
     CDS             101889..102806
                     /locus_tag="Sfla_6555"
                     /inference="protein motif:PRIAM:2.7.1.72"
                     /note="KEGG: sgr:SGR_5932 streptomycin
                     6-phosphotransferase;
                     PFAM: aminoglycoside/hydroxyurea antibiotic resistance
                     kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Streptomycin 6-kinase"
                     /protein_id="YP_004909472.1"
                     /db_xref="GI:357409185"
                     /db_xref="InterPro:IPR006748"
                     /db_xref="GeneID:11353732"
                     /translation="MSTSGDEVPHHLAASYVAAFGEEGRAWIAGLPSLAANMLERWDL
                     ERDGIARAGEASVVLPVLRRGTPAVLRLQMPRQEITAAVIGLRTWNGKGMVRLLDHDP
                     MSSSMLLERLDATRTLASINDDDMAMSTLADLLARLVAVPAPRGLRSLGDIASEMADQ
                     APQAIMKLVDPADRQHLRNWASAVAELADEPGDRMLHWDLHYDNVLAAQREPWIAIDP
                     EPLAGDPGFDLWPALDSRWDDVVAKGDTLRIVRRRFDLLTDVLGLDRARATGWTQGRL
                     LQNTLWDIDDGGTRIAPSSIAIADSLRNR"
     misc_feature    102009..102749
                     /locus_tag="Sfla_6555"
                     /note="Aminoglycoside/hydroxyurea antibiotic resistance
                     kinase; Region: APH_6_hur; pfam04655"
                     /db_xref="CDD:252722"
     gene            103055..103369
                     /locus_tag="Sfla_6556"
                     /db_xref="GeneID:11353733"
     CDS             103055..103369
                     /locus_tag="Sfla_6556"
                     /inference="similar to AA sequence:KEGG:SGR_6954"
                     /note="KEGG: sgr:SGR_6954 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909473.1"
                     /db_xref="GI:357409186"
                     /db_xref="GeneID:11353733"
                     /translation="MIQKKLDALAQMMDEYRAMPFPKGFRGLDVEDQDMVMLDADTAG
                     YVYRVLDGPLPEPSRGGLIRLLGVFEKVLPAISNEYASKYYTQARDVAALAAEIEAMR
                     DK"
     gene            103426..104574
                     /locus_tag="Sfla_6557"
                     /db_xref="GeneID:11353734"
     CDS             103426..104574
                     /locus_tag="Sfla_6557"
                     /inference="protein motif:PFAM:PF00665"
                     /note="KEGG: scb:SCAB_44241 hypothetical protein;
                     manually curated;
                     PFAM: Integrase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic region"
                     /protein_id="YP_004909474.1"
                     /db_xref="GI:357409187"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11353734"
                     /translation="MSDPTAGGAVAKPVRVRRLTDQEGQRLQQIVRRGSTSSVRYRRA
                     MMLLASAGGNRVPVIAQLVQADEDTVRDVIHRFNEIGLACLDPQWAGGRPRLLSPDDE
                     DFVIQTATTRPVKLGQPFTRWSLRKLAAYLRKVHGRTIRVGREALRRLLARRGVTFQR
                     TKTWKESPDPDREAKLDRIEEILDRFPDRVFAFDEFGPLGIRPTAGSGWAGQEHPNRL
                     PATYHRTHGVRYFHGCYSAGDDRLWGVNRRRKGAVNTLAGLKSIRAARPDGAPIYVIM
                     DNLSAHKGSDIRRWAGKNKVELCFTPTYASWANPIEAHFGPLRQFTIANSNHPNHTVQ
                     TRALHAYLRWRNANARHRDVLAAERKERARIRSEKGIRWGGRPLAAAA"
     misc_feature    103549..103680
                     /locus_tag="Sfla_6557"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     misc_feature    103552..103890
                     /locus_tag="Sfla_6557"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    103630..103878
                     /locus_tag="Sfla_6557"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    103990..104361
                     /locus_tag="Sfla_6557"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     cl19249"
                     /db_xref="CDD:267602"
     gene            complement(104796..104936)
                     /locus_tag="Sfla_6558"
                     /db_xref="GeneID:11353735"
     CDS             complement(104796..104936)
                     /locus_tag="Sfla_6558"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909475.1"
                     /db_xref="GI:357409188"
                     /db_xref="GeneID:11353735"
                     /translation="MRCRISSCSRPQTPALDQIKNLRWAVDFDIPKHGGNARQAQPLT
                     ST"
     gene            105030..105473
                     /locus_tag="Sfla_6559"
                     /db_xref="GeneID:11353736"
     CDS             105030..105473
                     /locus_tag="Sfla_6559"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: sma:SAV_7554 IS1647-like transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909476.1"
                     /db_xref="GI:357409189"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:11353736"
                     /translation="MDRGKPGSKMHVLSDANGLPLLVGLSAANVHDSLALKPMITGHQ
                     TRHDPHRGRYFKPQRLHADKAYDVPHLRKWLWGKHIGVRIARKGIESSERLGRRRWVI
                     ERTMSWLTGYRRLNHRYERQPRNYLAFLGLAAALCCYKRLARLTT"
     misc_feature    105036..105392
                     /locus_tag="Sfla_6559"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    105207..105407
                     /locus_tag="Sfla_6559"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(105578..106591)
                     /locus_tag="Sfla_6560"
                     /db_xref="GeneID:11353737"
     CDS             complement(105578..106591)
                     /locus_tag="Sfla_6560"
                     /inference="similar to AA sequence:KEGG:Ndas_0563"
                     /note="KEGG: nda:Ndas_0563 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909477.1"
                     /db_xref="GI:357409190"
                     /db_xref="GeneID:11353737"
                     /translation="MGDWRTDPTFSMCRALDDGADLASFVGGPFDIRAVVAAIQPEKI
                     DEAVLDDVPWENFPHGEKVHDAVRLLCNGGGSARFAMGVLVGICANDSRASAALAVPF
                     LIRIATDPHHPHHTDALRGLAAPARARHFGVASRDELLLHRSGPQHGVLDGYDDYGAE
                     VTGYPAGWSVAAARTAITAAIPMLLPLLYDSDVTTRIDASYALATAADPYRRVRSAFA
                     ARFDKERDPVALAGLVLATAESNRAHPHRPDTAWIRALWQDRAQAPEVRLAAAIGWLC
                     LTNEPVPHPLHTTIDALVTEERARAMDTLPWMNAAGCGKPGLLRCVRRMLHPEEPEPC
                     DDP"
     gene            106926..107321
                     /locus_tag="Sfla_6561"
                     /pseudo
                     /db_xref="GeneID:11353738"
     gene            107404..110361
                     /locus_tag="Sfla_6562"
                     /db_xref="GeneID:11353739"
     CDS             107404..110361
                     /locus_tag="Sfla_6562"
                     /inference="similar to AA sequence:KEGG:AMED_3527"
                     /note="KEGG: amd:AMED_3527 P-loop containing NTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909478.1"
                     /db_xref="GI:357409191"
                     /db_xref="GeneID:11353739"
                     /translation="MSIEAAIAGRLAGAVAGPLVGRLQRELARRGRARGSLAHALDRI
                     AAPDGRPVSPTALLNDLPHGVNNRDVLSCIETPEFRALAQQLMAVEILDGDLRAATKI
                     KFALRDFFRGRFPNADVAALNNYSELLFAHLHRRCEGLVRELRAALKDESQAIDWAHA
                     TLARATADSIESYLAVLARPHRLTPEDREEWTQRYRKAFSLHEEIPLPDLGNRRRIHY
                     SEIFVEPRLIHGQAGGRISFDDFIDSIDRTVLLGDPGAGKSTSSAISASLLFQRGRLI
                     PFYVVMREVDFAASGFPLVRVVEEQLSHRYQIKAPEGLIEELLFEGSALLVFDGLDEV
                     QSASLRRRSSEIIETASRLYPLSRVLATSRIVGYSSARLNPVTFHEYRIQPFDDGLVL
                     ENGQVRAYVSKWFSVGSRLPEPPGQVTDAFMRESASIPDLRCNPLLLAYICVLYRGHR
                     FIPRSRAQLYKKCAELLLADWDNFQGLPVDSETDLDTVRHTLAALAYRSITDPQWLAG
                     MPEADVKAVAAAAMSDESVPAHEEARRLAEDLVDLCRGRAWIFTELGTELDGSGIFGF
                     THQSLQEYFAALHLARNSGTPELLADRLLPELTGGRWEILAQICMNLADEKWAGGSSR
                     VVTRLLERGQTAEGDGLRTLVEFMARRLDVVKINVATMQLLMRLAIESYISTGSGELR
                     EFLSPSGPYPEAAWAAFQAVAESQLTLEAGKGTRHGLAVAWLVANVHYLPASSHDRQT
                     VSVHAGPVRTHLDSVEGLREIALNALHHSPAGWALSLYTGAADIRTLASPQARRAAGP
                     PDAAHSNVLSVMLDTAGTPNSLGPISPAVWIFDILGGTGADQTRYGRARVALADLAAM
                     LGDPMDTLVNLDIPRLDDQFLEYWNTYGAARCDRAVRELYEQSGGADRGGSPALTGLI
                     YLCMGLMELFEEAFTAQVRYPLSLALLAKARREDWRVLAALLPRLTYPARRFVQNWAK
                     GRHIWNMDRTEVS"
     misc_feature    107638..>109215
                     /locus_tag="Sfla_6562"
                     /note="Predicted NTPase (NACHT family) [Signal
                     transduction mechanisms]; Region: COG5635"
                     /db_xref="CDD:227922"
     misc_feature    108139..108621
                     /locus_tag="Sfla_6562"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            complement(110426..110803)
                     /locus_tag="Sfla_6563"
                     /db_xref="GeneID:11353740"
     CDS             complement(110426..110803)
                     /locus_tag="Sfla_6563"
                     /inference="similar to AA sequence:KEGG:PODANSg320"
                     /note="KEGG: pan:PODANSg320 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909479.1"
                     /db_xref="GI:357409192"
                     /db_xref="GeneID:11353740"
                     /translation="MEQVWWDDPGARGTPFFDLAVAYLACRRGDLDRAGQWKEMNWDR
                     YETGSARIDVLAVDACLARRRGGSRDLAWVLARLADARGAPLLSEGLDLLAAELARPL
                     LESRAPEPGEALRRLLAPYLRAA"
     gene            110852..111046
                     /locus_tag="Sfla_6564"
                     /pseudo
                     /db_xref="GeneID:11353741"
     gene            complement(111704..112369)
                     /locus_tag="Sfla_6565"
                     /db_xref="GeneID:11353742"
     CDS             complement(111704..112369)
                     /locus_tag="Sfla_6565"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sco:SCP1.267 putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004909480.1"
                     /db_xref="GI:357409193"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11353742"
                     /translation="MITNVARGFASAALTVMPLLAATPVQAAEITTLAEGVRALPLAA
                     ESRTGYERSAFKHWVDADKDSCNTRMEVLIAESRIAPTVEAGCKVTAGEWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLDAERSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTADQPEAAALTDLAETCGNQPLAYELATE
                     DGN"
     sig_peptide     complement(112286..112369)
                     /locus_tag="Sfla_6565"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.996 at
                     residue 28"
     misc_feature    complement(111764..112171)
                     /locus_tag="Sfla_6565"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            112782..113513
                     /locus_tag="Sfla_6566"
                     /db_xref="GeneID:11353743"
     CDS             112782..113513
                     /locus_tag="Sfla_6566"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sco:SCP1.323c putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004909481.1"
                     /db_xref="GI:357409194"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11353743"
                     /translation="MHRSRIATLAAVVLSATLISCNPQLADDKPNGSTPTSTASAASP
                     APGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPKQGDRCKLTGGVWMSYYDEVEVTDAKKLDIDHVVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     AEKTALLDLAKDCTDTVVEFEEAAE"
     sig_peptide     112782..112862
                     /locus_tag="Sfla_6566"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.991 at
                     residue 27"
     misc_feature    113058..113462
                     /locus_tag="Sfla_6566"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            113678..114868
                     /locus_tag="Sfla_6567"
                     /db_xref="GeneID:11353744"
     CDS             113678..114868
                     /locus_tag="Sfla_6567"
                     /inference="similar to AA sequence:KEGG:Adeh_3089"
                     /note="KEGG: ade:Adeh_3089 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909482.1"
                     /db_xref="GI:357409195"
                     /db_xref="GeneID:11353744"
                     /translation="MKAKRGPLGDERRDRGPETPPTRGVLVTGSLVRVSSAAAAGCGA
                     LFVLLPVLALIGRLGFPDDPPDFVPVFGGPLIAASLGIAVFLIVLGYSLTFQQLALAD
                     MYAAEGDSPSLRNAVEVRGPVSRTPFFPAVATSIVIGSLLLATAGVLLAASAWPAVAT
                     ILLILGILSAPAVLALIAVGRRWRRTAGERLPAQALGEQGHARLLLGDADTKRRQQAK
                     ARDRAEATDLDRASIPVRAALVIAVFAVMSPSLSPTAPLWKQVQLAGAGLGVLCLLLD
                     SCLAMLRSRRLRRTLVRVRSGGADVTAIDRAHAITATAAQASEVHAVSTVWALLGAGV
                     LGTLIPRNTDIAPVLIVAGTWVLGFIALVAVSMRSDAAAPKLREEYGYRLPTQTSGND
                     NTWH"
     gene            114960..115205
                     /locus_tag="Sfla_6568"
                     /db_xref="GeneID:11353745"
     CDS             114960..115205
                     /locus_tag="Sfla_6568"
                     /inference="similar to AA sequence:KEGG:Adeh_0009"
                     /note="KEGG: ade:Adeh_0009 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909483.1"
                     /db_xref="GI:357409196"
                     /db_xref="GeneID:11353745"
                     /translation="MGAQAVRRRQAPMRPAAAKPPGSYQGRPKKVGAVARPFPAPAET
                     VCPLRERLPTVGRTENQLASAQVWVAQSSKLVQETPG"
     gene            complement(115139..115273)
                     /locus_tag="Sfla_6569"
                     /pseudo
                     /db_xref="GeneID:11353746"
     gene            complement(115282..116029)
                     /locus_tag="Sfla_6570"
                     /pseudo
                     /db_xref="GeneID:11353747"
     gene            116036..116307
                     /locus_tag="Sfla_6571"
                     /pseudo
                     /db_xref="GeneID:11353748"
     gene            116699..117943
                     /locus_tag="Sfla_6572"
                     /db_xref="GeneID:11353749"
     CDS             116699..117943
                     /locus_tag="Sfla_6572"
                     /inference="similar to AA sequence:KEGG:SCP1.138"
                     /note="KEGG: sco:SCP1.138 putative plasmid partitioning
                     protein, para1"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid partitioning protein, para1"
                     /protein_id="YP_004909484.1"
                     /db_xref="GI:357409197"
                     /db_xref="GeneID:11353749"
                     /translation="MTSSASGDREKVVSKLPPALQQDLKIRAAQHGIDIQHAVEAGIA
                     AWSRLGANLPAADTGRAKPFATFLPPGQWDEFRENCASRGVSLIQGLTQSVLFWLDTN
                     PAPGVVRPEHPKRIIICNQKGGVGKTALAAGVGEAFAEDSDQLHPVRISKHFAAAILE
                     PDNEPASYLDYEDLPGLGLRVLLVDFDPQCHLTNQLGHSPLPIEGDSLTKHMAGEAKG
                     NLKDLIVPIDDPRFGDRLHLLPACTDAFLLDVKLSSVRAREAALERVLGTIEGDYDVI
                     IIDCPPSLGLSMDAAAYYGRRRDGEAPGNSGILIIVQAEDSSADAYGLLTNQIEDLRA
                     DMHLELDYLGIVVNHYDARRGYIATSSLQSWIDIKDPRVVGVIGDLKEQKEAVRLKRP
                     LLAYAPRCDQAVGMRALTREIS"
     misc_feature    117032..117937
                     /locus_tag="Sfla_6572"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    117041..117742
                     /locus_tag="Sfla_6572"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    117062..117082
                     /locus_tag="Sfla_6572"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(117080..117082,117533..117535)
                     /locus_tag="Sfla_6572"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     misc_feature    117227..>117547
                     /locus_tag="Sfla_6572"
                     /note="transport-energizing ATPase, TRC40/GET3/ArsA
                     family; Region: GET3_arsA_TRC40; TIGR00345"
                     /db_xref="CDD:232932"
     gene            117940..119061
                     /locus_tag="Sfla_6573"
                     /db_xref="GeneID:11353750"
     CDS             117940..119061
                     /locus_tag="Sfla_6573"
                     /inference="protein motif:TFAM:TIGR00180"
                     /note="KEGG: sco:SCP1.139 plasmid partitioning protein,
                     ParB1;
                     TIGRFAM: parB-like partition protein;
                     PFAM: ParB domain protein nuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="parB-like partition protein"
                     /protein_id="YP_004909485.1"
                     /db_xref="GI:357409198"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="GeneID:11353750"
                     /translation="MSKADTLRASASFGQARGGISARRAAIEAAATAPTDGAPPPLQL
                     PVDVISLNPDNPREILGDLTDLGASLRDHKQKTAISIMSRFAYLEGNPGRADDLEEGT
                     KYVVIDGNSRLAAAREAGLAQIKVMLDDELGSNPDEILESAFVANVHRQDLDPLDEAK
                     VLQRLLAIHKTQDALAARLHRSQGWVSQRLALLGLTPELKEKLQAGEESAALLRRVGK
                     KKPEEQEEHLRRLKEKGKKTPQRSAAPQPAATPAPTPPAQDHYAVMNPAPDGDQGVDG
                     PGADNTAGRPSNTRPAPRVSDHASPSSKPRQQGETLMDAAFDQLNDEQRSAFILRYFQ
                     RSTGIEAVTADMRGKLPAEARSSLASILQQVAAALRRDE"
     misc_feature    118060..118617
                     /locus_tag="Sfla_6573"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    118066..118329
                     /locus_tag="Sfla_6573"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     misc_feature    118447..>118644
                     /locus_tag="Sfla_6573"
                     /note="KorB domain; Region: KorB; pfam08535"
                     /db_xref="CDD:254862"
     gene            119840..120472
                     /locus_tag="Sfla_6574"
                     /pseudo
                     /db_xref="GeneID:11353751"
     gene            120486..121643
                     /locus_tag="Sfla_6575"
                     /db_xref="GeneID:11353752"
     CDS             120486..121643
                     /locus_tag="Sfla_6575"
                     /inference="similar to AA sequence:KEGG:SCP1.221"
                     /note="KEGG: sco:SCP1.221 putative plasmid partitioning
                     protein, para2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid partitioning protein, para2"
                     /protein_id="YP_004909486.1"
                     /db_xref="GI:357409199"
                     /db_xref="GeneID:11353752"
                     /translation="MTVPYSPDDREKVVAKLPAILRQELKVRAAELGVDIKDAVTEGV
                     QAWRADDVERVPVDTTGGSSFSTYLPTGLYGEFKNDCKQRGIPFNQGIAQAIRLWLDT
                     HHSPRRTAARPAWARRLIFGNQKGGVGKTATSSGVAQALAEAGNRVLLIDFDPQGHLT
                     KQLGYELFDIESPSLAKHMLGEAKGELRELLVPIENGAFSGRLFMLPACKDAFLLDAK
                     LATSRFVRIKETALEKALEPLEKEFDYIVVDCPPSLGYTMDTALYYCRTREGETSGLS
                     GIFIPVLAEDSSADAYDMLYDQIQDLSVDMEVEISMLGFIVNMYDSRKGYIATSSLHS
                     WKEIGDPPVVGVMPELKEQRESVRLKQPLLSYAPDCEQSEVMRAIARKVMS"
     misc_feature    120831..121640
                     /locus_tag="Sfla_6575"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    120837..121439
                     /locus_tag="Sfla_6575"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    120858..>121241
                     /locus_tag="Sfla_6575"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    120858..120878
                     /locus_tag="Sfla_6575"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(120876..120878,121230..121232)
                     /locus_tag="Sfla_6575"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            121640..122890
                     /locus_tag="Sfla_6576"
                     /db_xref="GeneID:11353753"
     CDS             121640..122890
                     /locus_tag="Sfla_6576"
                     /inference="similar to AA sequence:KEGG:pnf120"
                     /note="KEGG: nfa:pnf120 putative plasmid partitioning
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909487.1"
                     /db_xref="GI:357409200"
                     /db_xref="GeneID:11353753"
                     /translation="MSVADRLGTGSSFGGVPRGRSARGRAKAIVQGDVPSYELRRLPL
                     EDVAPTPLNPRRNFGSDEDLTRFGEELRIAQLAACVAVSRSAYLRLWPEHEAQIGDSA
                     YVLVNGERRFRSAVHVALEALDFVVRDDLAASREEFVDHLLKENLEREDFDVVERARG
                     VLELVRVCSEESEKGARTRAAKRLGRDRSWITNQLALLELPTELQAMLSSGSLPERDG
                     RLLARRLKEEPGLDGAGLLAHLKETREQEVRVREEEKLLLQRARQTAGTGPLLSTDNA
                     EPMDHSPARGSALSADNTPRETDTAQRASAQTRTPAPTRPAPAEEPVLSADNADVRES
                     QSPAKATSVPAPVLSSDNTTSTATPTARTGRQEDETAVSADQRSLLLVRQLGASVEEQ
                     ARTLASGLPPEQLTQLIEELHSYV"
     misc_feature    121751..>122323
                     /locus_tag="Sfla_6576"
                     /note="nucleoid occlusion protein; Region: nucleoid_noc;
                     TIGR04285"
                     /db_xref="CDD:234533"
     misc_feature    122180..>122272
                     /locus_tag="Sfla_6576"
                     /note="KorB domain; Region: KorB; pfam08535"
                     /db_xref="CDD:254862"
     gene            123123..123464
                     /locus_tag="Sfla_6577"
                     /db_xref="GeneID:11353754"
     CDS             123123..123464
                     /locus_tag="Sfla_6577"
                     /inference="protein motif:PFAM:PF03551"
                     /note="PFAM: transcriptional regulator PadR family
                     protein;
                     KEGG: sma:SAV_29 ParR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, PadR-like family"
                     /protein_id="YP_004909488.1"
                     /db_xref="GI:357409201"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="GeneID:11353754"
                     /translation="MTRQNPPLTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIA
                     VGTLYGALERMERAGLVSAGHEEIVDGRARRYYRLTKDGAEALGREALRMQQAAAVVI
                     GRWRDAGVAPA"
     misc_feature    123144..123437
                     /locus_tag="Sfla_6577"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    123165..123389
                     /locus_tag="Sfla_6577"
                     /note="Transcriptional regulator PadR-like family; Region:
                     PadR; pfam03551"
                     /db_xref="CDD:252023"
     gene            123461..124420
                     /locus_tag="Sfla_6578"
                     /db_xref="GeneID:11353755"
     CDS             123461..124420
                     /locus_tag="Sfla_6578"
                     /inference="similar to AA sequence:KEGG:SAV_30"
                     /note="KEGG: sma:SAV_30 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909489.1"
                     /db_xref="GI:357409202"
                     /db_xref="GeneID:11353755"
                     /translation="MNRLLLAAYPEPYRSRQGQEVLACLTEAYPGRSWPPPQEVAALV
                     RAGVQARARAVVDDTARTWWLDGIHLTALVLAALALVPYLQDVWHWALHIDPGRNAIA
                     FPFSGWYPWAQGAGGRTRLLPYGLLPLVCLIALLRGRAWVALPAAAVMIYAGATFNST
                     TLFGDEGKSGLSYYGLGAPIDARDLVLSGTLCAACAVLALCRPSRLRRRSYRWLAPVV
                     LAMFIAGSLHIISVSPAFQRGLFVLEAVALLSAWVATAATGDHRWLIPVAGVAIVRTQ
                     AIVVRPDAFMQSFPDLVVLILLIAPLPALAFTAQRRQGQALAE"
     gene            124514..125428
                     /locus_tag="Sfla_6579"
                     /db_xref="GeneID:11353756"
     CDS             124514..125428
                     /locus_tag="Sfla_6579"
                     /inference="protein motif:PFAM:PF01569"
                     /note="PFAM: phosphoesterase PA-phosphatase related;
                     KEGG: sma:SAV_31 prepilin peptidase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase PA-phosphatase related protein"
                     /protein_id="YP_004909490.1"
                     /db_xref="GI:357409203"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="GeneID:11353756"
                     /translation="MTQHDSPILPAHRPGASRQAPDCLGPSRTPRPWIPALLYTLGFL
                     TVYLLAICTPWGQRAENTLFDLGGGNPEDVWLYPLSGAEYGSTPLPPLELSAKPTLMV
                     GLAVIVVLTLVRRCWRLGCAALGVVILTTGGKEVLKSTILPRPDLVGAPESLLDQGFP
                     SGHTAIPAALTLAAVLVVSPRIRPYIATAGVLWLACIAAYSATKGGHRPSEVLGATLL
                     ACACYGLATWLRPPATVPGATRSLRALPAITLTLALAVALVSGARNDTLTRSLVSAAT
                     GFICAALVWYAAVGRPAPTARRTRLALD"
     misc_feature    124868..125215
                     /locus_tag="Sfla_6579"
                     /note="PAP2 superfamily; Region: PAP2; pfam01569"
                     /db_xref="CDD:250712"
     misc_feature    order(124913..124915,124943..124945,124994..125002,
                     125132..125134,125144..125146)
                     /locus_tag="Sfla_6579"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            125613..125714
                     /locus_tag="Sfla_6580"
                     /pseudo
                     /db_xref="GeneID:11353757"
     gene            complement(126141..127652)
                     /locus_tag="Sfla_6581"
                     /db_xref="GeneID:11353758"
     CDS             complement(126141..127652)
                     /locus_tag="Sfla_6581"
                     /inference="protein motif:PFAM:PF00575"
                     /note="PFAM: RNA binding S1 domain protein;
                     KEGG: scb:SCAB_3591 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA binding S1 domain protein"
                     /protein_id="YP_004909491.1"
                     /db_xref="GI:357409204"
                     /db_xref="GO:0003723"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="GeneID:11353758"
                     /translation="MPQNGAVLPHVYQVTKYDPADRDEHGHYAGAQEVTSDRGEYEAA
                     YLQAVAAFAADAGVDRLSVREPGVPSFVHFGSREAADDYGLGALFLHGLHGFHDGAEV
                     QFATALELVRIMLRDSGAWCRLEADGIFEVHVGWDQYLYICTSRPSTDAVARTRALGL
                     FPERLSASPYAVETEPSGIQRPADDEFWSALLWAVGSGRAGMLEETYIEGATRYHRLS
                     RETLGIVRARLTPRARLAVWPALSPDVGAVLGSLPREGLVEGVWQDTDGRLHSAVADE
                     ADYVELTTRMKGAAAAALLSIDADERVPLFTAVLPDTDGVVRARWRTEPTPEDRKWAF
                     LKTLQPGQVVTGTVTETASFGVTFVDVDGYEGFINIPELSWRSVAHPADVVSVGQRIH
                     AGVLGVDGVRAQMALSLRAVQDDPMQQLTGQVGTTLPGRVTKIVPFGVFVRIEEIENG
                     FAGLVHNSELLGRQEKEPQGGIEVGSTLRVKILDVDLGSRRITLSQRQADPEV"
     misc_feature    complement(126429..126635)
                     /locus_tag="Sfla_6581"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(126546..126548,126552..126554,
                     126579..126581,126606..126608))
                     /locus_tag="Sfla_6581"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(126162..126386)
                     /locus_tag="Sfla_6581"
                     /note="Ribosomal protein S1-like RNA-binding domain;
                     Region: S1; smart00316"
                     /db_xref="CDD:197648"
     misc_feature    complement(order(126285..126287,126291..126293,
                     126330..126332,126354..126356))
                     /locus_tag="Sfla_6581"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            complement(128112..129122)
                     /locus_tag="Sfla_6582"
                     /db_xref="GeneID:11353759"
     CDS             complement(128112..129122)
                     /locus_tag="Sfla_6582"
                     /inference="similar to AA sequence:KEGG:SCO4449"
                     /note="KEGG: sco:SCO4449 hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_004909492.1"
                     /db_xref="GI:357409205"
                     /db_xref="GeneID:11353759"
                     /translation="MLAAVLVATGCESSGSGSRTDARSTPSASAAPAVIRLPPKAWPA
                     DVVLSQDGTLWVAESSLAAIAQIAPSGKVTQHPLPRDGGFAPRPSDLVPSPDGGIWYA
                     AGDQLGHLSRSGKFTWWGDGGEVGNGPGAGPDVPGFPDALTLGPDDTVWYEHSAVGDK
                     VFSRVDLKQGPTQITRLDTQFSVVAMTEGPDGAVWFTQSEEYDAKQREGIGRLTSDGK
                     YRKWPLPANSSPGALVAGPDRALWFTDSAGISRIDTDGDLTRYPVRDATYLGDIVVGA
                     DKSLWFTADHRIGRLTTEGRMTLWPVPDAEDLGALVPLEDGSFWLADRKADVLRRFTP
                     PQ"
     misc_feature    complement(128382..>129083)
                     /locus_tag="Sfla_6582"
                     /note="Streptogramin lyase [Defense mechanisms]; Region:
                     Vgb; COG4257"
                     /db_xref="CDD:226708"
     gene            complement(129136..132555)
                     /locus_tag="Sfla_6583"
                     /db_xref="GeneID:11353760"
     CDS             complement(129136..132555)
                     /locus_tag="Sfla_6583"
                     /inference="similar to AA sequence:KEGG:SCAB_3601"
                     /note="KEGG: scb:SCAB_3601 putative WD-40 repeat protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909493.1"
                     /db_xref="GI:357409206"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="GeneID:11353760"
                     /translation="MTETGNTHRTALHSVLRESTPQGAVHELLGERRLWWESCSEAAR
                     VDAAWLAGPAEALADWIDANAPDRESVALTPARHAYLLARALASPPDQDEALVSVRTL
                     WAGSGLLSANAAPGPVQPSGRGLAAVPEAAAARLEAVLERIPHLAGETAPAPDSMLVA
                     TLLLMAGCETGRRVQLPVVFGETERSGEAGATGVLELCEFPAGPPGLYPDPRYMSGLR
                     SSYGQFASALGRAWAVAGRGPGARCVLWRLVFTDRSPTRVEGPSLGVAFALGLRELLR
                     YPQRRRPSAAWLRGVFHGLRPRTAVTGALGHGERLDGVSGMEDKLLAARRKGLRLVAP
                     VANRPDAAHAPEPADVMFAETLRQADRYARRFRTGRLATVVALVLAVVASGVVVQYRE
                     ATARERMVEAHRLAEVSGDLLSTDVALAGLFAERAYRQHADPQTRKALFRSVTESPHL
                     AGSVRAAGTVSVVAASQSGERALTGTRSGDVEVWGLEDGRFTGHHRRVGRLPGSVETV
                     ASDADGRVVAASDDRTVSVWTAGQSSPVPSLPEEQTPAAVAVSPSGRFIAVATESGRF
                     QVPGTLSVLDRDSGRTQQLKLADLSLAPSALAFDGDEELVVSEFGYGGWNRVSVPRLK
                     RTAGSTIGFGVHNSASALAPDGSHISYSNKASSLAVWPSRGKPEGDAPKLVADTEPGL
                     PSALAVSRGGTHVALAIGSTLRVSRTHGPDEKGSGSLTLPGAGPVPANAVTFLGSGGD
                     RLLSASSEFLSLWDLRQHTRIAWESNIDIPGCGLSCAPPQVAVSPDGQDAAFIDGSGD
                     KLAMVRLGPPGTKPRGYEGTMQIPGFSTLVWRPDSRRLIVLAPDGSAQRVERGKKWRA
                     ASSWPPVPNPLRLSDPPALARYLPDGRTLVEVHMSGTVWFRDAASGKPLRKVDGPRSM
                     APTADGNRHPSFNQVALDERGSYAAILEQQTADNPSGKIVLHVISTASGRIRTIPADG
                     ARGITYSGDHLLIQHDSGSIKVRSASGARQLDTAEGVDDPAVGPVTDGRLLAGTTVKD
                     QAVRLLDLASQTGIGTLPLPEHNFENSTGLALIPDGTGLVTATEADYSETDSPSADGP
                     TTEELGTLIQWRLDPRDWISTVCATAGRELRPRDWEQHMDSPTPSSLRCGK"
     misc_feature    complement(130315..131178)
                     /locus_tag="Sfla_6583"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    complement(130159..>131175)
                     /locus_tag="Sfla_6583"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    complement(order(130324..130326,130387..130389,
                     130435..130440,130456..130458,130468..130470,
                     130525..130530,130573..130575,130591..130593,
                     130603..130605,130648..130653,130708..130710,
                     130735..130737,130786..130788,130828..130833,
                     130855..130857,130882..130884,130933..130935,
                     130969..130974,130990..130992,131002..131004,
                     131074..131079,131101..131106,131122..131124,
                     131134..131136))
                     /locus_tag="Sfla_6583"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     misc_feature    complement(129334..>129927)
                     /locus_tag="Sfla_6583"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    complement(order(129343..129345,129406..129411,
                     129445..129450,129466..129468,129484..129486,
                     129529..129534,129568..129573,129589..129591,
                     129601..129603,129646..129648,129679..129684,
                     129706..129708,129739..129741,129787..129789,
                     129862..129867,129883..129885,129898..129900))
                     /locus_tag="Sfla_6583"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     gene            complement(132552..132953)
                     /locus_tag="Sfla_6584"
                     /db_xref="GeneID:11353761"
     CDS             complement(132552..132953)
                     /locus_tag="Sfla_6584"
                     /inference="similar to AA sequence:KEGG:Sare_0785"
                     /note="KEGG: saq:Sare_0785 ABC transporter transmembrane
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909494.1"
                     /db_xref="GI:357409207"
                     /db_xref="GeneID:11353761"
                     /translation="MVSPDGRTVFVLRRVGGRTGEYGLELVSRGVADQLELATVQYTR
                     PDGEQRTILVPVSPSPVGPTASFVRLDGFAAGSTWQATGPTPIPEDPAWPSETVADSI
                     RAAHNEATREAWRQVRERTGQGIRETIDGAL"
     gene            133092..133832
                     /locus_tag="Sfla_6585"
                     /db_xref="GeneID:11353762"
     CDS             133092..133832
                     /locus_tag="Sfla_6585"
                     /inference="similar to AA sequence:KEGG:CLUG_01018"
                     /note="KEGG: clu:CLUG_01018 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909495.1"
                     /db_xref="GI:357409208"
                     /db_xref="GeneID:11353762"
                     /translation="MSKARGQIDSGERGPDTLPQRVSVAAPQPRARGSSTTTGGEGRP
                     GAPDDRYTRHGPTSPDGGGGETWLAGAAEATDAPGAPGTAEADCGTAGWGAPGTAGLG
                     AAPGTPSAAAPGVVPNCSASVTVVALPICASTAGAEAPTATPASIPPNSPWSNHPAAQ
                     PSTTRNSAASESAGGSIYAPSLGRTSPATRDTCRACCQACSRPKVTTASTTSPPPAPY
                     SAPSAPESIRPPLHEPALAAPPGAISKI"
     misc_feature    <133125..133811
                     /locus_tag="Sfla_6585"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     repeat_region   134111..134626
                     /note="CRISPRS"
                     /rpt_unit_range=134111..134139
     gene            134861..137782
                     /locus_tag="Sfla_6586"
                     /db_xref="GeneID:11353763"
     CDS             134861..137782
                     /locus_tag="Sfla_6586"
                     /inference="protein motif:TFAM:TIGR01596"
                     /note="TIGRFAM: CRISPR-associated HD domain protein;
                     CRISPR-associated helicase Cas3;
                     PFAM: DEAD/DEAH box helicase domain protein;
                     KEGG: tcu:Tcur_2679 CRISPR-associated helicase Cas3;
                     SMART: DEAD-like helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated HD domain protein"
                     /protein_id="YP_004909496.1"
                     /db_xref="GI:357409209"
                     /db_xref="InterPro:IPR006474"
                     /db_xref="InterPro:IPR006483"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="GeneID:11353763"
                     /translation="MTVEGGSHTGMRARLRGPVLKVWAKHDRDSDGWLPLWRHMEDSA
                     AVAGRLWDEWLPLSVQRLIADELPDGTADARRLVVWLAGVHDIGKATPAFACQVDLLA
                     EAMRADGLEMRSQRAMGADRKLAPHGLAGQVLLGEWLENRHGWAVSQTGQFTVAVGGH
                     HGVPPEYGQITALDRHPQLLRTPGKSGPLWQRVQQELLEACAAEFGVQDRLGAWRSVK
                     LPQPVQVVLTALVIVSDWIASNPDLFPYFPQDASRSNEDRITAAWQGLNLPGAWRAAD
                     PPADVQELFASRFALPPGARVRPVQEAAVELARTMEEPGLLVIEAPMGEGKTEAALGA
                     AEVLAARSGAGGVFFALPTMATGNAMFPRLLNWLERLPSPDGARHSVLLAHSKSALND
                     DFTDLMERGPIAALNLDAAEDQELRPTSRGRSASAELVAHAWLRGRKKAMLSSFVAGT
                     IDQLLFAGLKSRHLALRHLAIAGKVVVIDEAHAYDTYMSSYLDRVLSWLGAYRVPVVV
                     LSATLPATRRRELVEAYAGRRKGDSRDFDAVAQAGDYPLLTAVPPGGTPVLRRPPASG
                     RGVDVEIERIDDNLDHLADRLEDELEDGGCVLVVRNTVRRVLDAAKVLRERFGDAHVT
                     VAHSCFIDVDRAAKDASLLQRFGPPEKAEGRPTKHVVVASQVAEQSLDVDFDLLVTDL
                     CPADLLLQRMGRLHRHLRGGEKQTERPERLRAARCLVSGVNWTNGVPEPVRGSVAVYG
                     AYALLRSAAALLPHLDAGPRRPVRLPADISPLVQHAYGEGSPVPTDWAQDVETARGAY
                     DELRADQAERAATFRLGAVARPGRPLFDWVTAGVGDADDTSRGKAQVRDSRESLEVVV
                     VQKKADGTLATVPWLVPDRQNRQLADLALPTDQVPTPLAARTAASCGLRLPMQFSYAE
                     TMDRAIAELEELHLRAWQVKGSHWLAGQLVLALDEDCQTQLAGFTLRYSKSDGLEVTR
                     A"
     misc_feature    134927..137566
                     /locus_tag="Sfla_6586"
                     /note="helicase Cas3; Provisional; Region: PRK09694"
                     /db_xref="CDD:182031"
     misc_feature    134945..135595
                     /locus_tag="Sfla_6586"
                     /note="CRISPR/Cas system-associated protein Cas3'';
                     Region: Cas3''_I; cd09641"
                     /db_xref="CDD:193608"
     misc_feature    135806..136987
                     /locus_tag="Sfla_6586"
                     /note="CRISPR/Cas system-associated protein Cas3; Region:
                     Cas3_I; cd09639"
                     /db_xref="CDD:187770"
     gene            137775..139469
                     /locus_tag="Sfla_6587"
                     /db_xref="GeneID:11353764"
     CDS             137775..139469
                     /locus_tag="Sfla_6587"
                     /inference="protein motif:TFAM:TIGR02547"
                     /note="KEGG: nda:Ndas_1281 CRISPR-associated protein, CSE1
                     family;
                     TIGRFAM: CRISPR-associated protein, Cse1 family;
                     PFAM: CRISPR-associated protein Cse1"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Cse1 family"
                     /protein_id="YP_004909497.1"
                     /db_xref="GI:357409210"
                     /db_xref="InterPro:IPR013381"
                     /db_xref="GeneID:11353764"
                     /translation="MPDNSQSDREDALSFDLTTQPWIPVLRINGQQDELSLHQVFEQA
                     SELRRIVGDLPTQEFALVRLLLAIAHDALDGPADIDDWADLWSDEQCFAPVGPYLDAH
                     TDRFDLLDTTAPFFQTAGLRTTKDEVFSLNRIVADVPNGEPFFSARMPDVDRLTFAEA
                     ARWVIHAHAYDTSGIKTGVEGDKRVKGGKVYPLGVGWAGNLGGVYVERPTLRETLLLN
                     LVAADTTGVRIDEQDAPAWRRDPCGPGGAERASTGVRDLYTWQTRRLRLHFDEHGVHG
                     VVLGYGDPLSPRNMHDREPMSAWRRSLAQEKKLRESPVYLPRDHDPERAAWRGIASLI
                     ADTLPGLQGSEPPSSLRPAVLEWVARLVSQGELEQGFLVRARVIGPKYGTQQSVIDEI
                     VDDSVSMGVVLLHQQDRRYAEQAIAAVEDADRAVYAIGDLATNLARAAGAETNGPRAT
                     ARDHAYGLLEAPYRSWLRDLAKSDDPYEQRLAWQRQVYRIATKFGDQLMAAAGDGAWQ
                     GRIVETKKGTEWLNSALADKWFRIALNRELGSPDSSGTAPATDERSDSETTVKALT"
     misc_feature    137817..139247
                     /locus_tag="Sfla_6587"
                     /note="CRISPR/Cas system-associated protein Cse1; Region:
                     Cse1_I-E; cd09729"
                     /db_xref="CDD:187860"
     gene            139466..140164
                     /locus_tag="Sfla_6588"
                     /db_xref="GeneID:11353765"
     CDS             139466..140164
                     /locus_tag="Sfla_6588"
                     /inference="protein motif:TFAM:TIGR02548"
                     /note="KEGG: tfu:Tfu_1599 CRISPR-associated CSE2 family
                     protein;
                     TIGRFAM: CRISPR-associated protein, Cse2 family;
                     PFAM: CRISPR-associated protein Cse2"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Cse2 family"
                     /protein_id="YP_004909498.1"
                     /db_xref="GI:357409211"
                     /db_xref="InterPro:IPR013382"
                     /db_xref="GeneID:11353765"
                     /translation="MTTVAASLPPRKQVARLAAQILAPLQQGYLADRSPDVAALARLR
                     RGAGREAGQLPDLWSLIDTGPLHVPPDDARPLDESDLVRAEDALHVALTLWALHQQSR
                     PTGMHQADRKDSRRGLGTAVRRMMKPGEIDEPLRKRLVRAGTAPDLTSLAQRLRDIVV
                     LLRRADIPLDYALLAGQLYTWQRPGGADVVRREWGSSFHAWHDKDAEKPGDAATAPAG
                     DKTTDSTDIDKDAS"
     misc_feature    139577..140062
                     /locus_tag="Sfla_6588"
                     /note="CRISPR/Cas system-associated protein Cse2; Region:
                     Cse2_I-E; cd09731"
                     /db_xref="CDD:187862"
     gene            140161..141354
                     /locus_tag="Sfla_6589"
                     /db_xref="GeneID:11353766"
     CDS             140161..141354
                     /locus_tag="Sfla_6589"
                     /inference="protein motif:TFAM:TIGR01869"
                     /note="KEGG: nda:Ndas_1283 CRISPR-associated protein, CSE4
                     family;
                     TIGRFAM: CRISPR-associated protein, Cse4 family;
                     PFAM: CRISPR-associated protein CT1975"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Cse4 family"
                     /protein_id="YP_004909499.1"
                     /db_xref="GI:357409212"
                     /db_xref="InterPro:IPR010148"
                     /db_xref="GeneID:11353766"
                     /translation="MNRIFLDVHALQTVPPSNLNRDDTGAPKTAVYGGVPRARVSSQA
                     WKRAARTYFSNEHLLDASELGVRTKKIVEAVAARITALDPSIEGEAALLIADETVKAT
                     GLKTEVPKRKATAAKDGEPEPAPEAKYLVFLSTRQLDGLARLAVEGASDITAHLKDKE
                     TKAKAKEIADTHHSVDIALFGRMVADSADFNVDAAVQVAHAISVHRVENESDYYTAVD
                     DKNTDEETGAGMIGTVDFNSSTLYRYAALGVHQLAANLGEGLREDEPLTTPVRRAVEA
                     FVHGFTASLPTGKINTFGHHTLPDAVVVKLRTTRPVSFVSAFEEPVRGDQGGYVREAS
                     ERLAEYIPDIERAYGDEGSTLTWVLRVGPNTAKLAGIGTEAQNIGELVAAVGQAVAER
                     LEKPA"
     misc_feature    140176..141315
                     /locus_tag="Sfla_6589"
                     /note="CT1975-like protein; Region: Cas_CT1975; pfam09344"
                     /db_xref="CDD:255301"
     gene            141351..142076
                     /locus_tag="Sfla_6590"
                     /db_xref="GeneID:11353767"
     CDS             141351..142076
                     /locus_tag="Sfla_6590"
                     /inference="protein motif:TFAM:TIGR01868"
                     /note="KEGG: tfu:Tfu_1597 CRISPR-associated Cas5e family
                     protein;
                     TIGRFAM: CRISPR-associated protein Cas5 family;
                     CRISPR-associated protein Cas5;
                     PFAM: CRISPR-associated protein, Cas5"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas5 family"
                     /protein_id="YP_004909500.1"
                     /db_xref="GI:357409213"
                     /db_xref="InterPro:IPR010147"
                     /db_xref="InterPro:IPR013422"
                     /db_xref="InterPro:IPR021124"
                     /db_xref="GeneID:11353767"
                     /translation="MSVLSLRLAGPLQSWGASGRFTRRTTESAPTKSAVIGLLAAAAG
                     IERGDDTRLEPLAALRFGVRIDQPGSRVRDFQTAHHSVSGKSMPLSERFYLADAVFVA
                     AVEGDTTLLSDLHAALRNPVYPPFLGRRSCPPAQPVDLGLHDGAASLMDVLGEVPWQA
                     SSWYRRQHGSRTDIELTVLREACGSEAEFADTLRDQPISYAAEHRRHALRSIVSNTVR
                     VPGPSAGRLPRHDPFDALQEENV"
     misc_feature    141360..141845
                     /locus_tag="Sfla_6590"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas5; Region: Cas5_I-E; cd09756"
                     /db_xref="CDD:187886"
     gene            142076..142852
                     /locus_tag="Sfla_6591"
                     /db_xref="GeneID:11353768"
     CDS             142076..142852
                     /locus_tag="Sfla_6591"
                     /inference="protein motif:TFAM:TIGR01907"
                     /note="KEGG: nda:Ndas_1285 CRISPR-associated protein, CSE3
                     family;
                     TIGRFAM: CRISPR-associated protein, Cse3 family;
                     PFAM: CRISPR-associated protein CT1974"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Cse3 family"
                     /protein_id="YP_004909501.1"
                     /db_xref="GI:357409214"
                     /db_xref="InterPro:IPR010179"
                     /db_xref="GeneID:11353768"
                     /translation="MFLTRFRVNTARLGARRLLSSPQVLHASVMSSFPSLLPSDAPPP
                     DGPRVLWRLDHTARAEVMLYVVSPDRPDMTHLVEQAGWPAAAISSAPGWESRPYGPFL
                     DRLTPGEQWAFRLTANPVHHIRRKADEPTKRTAHITPVHQMGWLLQRQEQCGFRVLEK
                     PADRRLLPSGTTHTGLPHHGDRYELTVHDKRALSFDKSRGSAKAATRKGAVSLVTVTF
                     DGRLEVTDPEKLRRTLRQGIGKAKAYGCGLLTLAPLGTAG"
     misc_feature    142076..142834
                     /locus_tag="Sfla_6591"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6e; Region: Cas6_I-E; cd09727"
                     /db_xref="CDD:187858"
     gene            142857..143834
                     /locus_tag="Sfla_6592"
                     /db_xref="GeneID:11353769"
     CDS             142857..143834
                     /locus_tag="Sfla_6592"
                     /inference="protein motif:TFAM:TIGR00287"
                     /note="KEGG: sgr:SGR_3547 putative CRISPR-associated Cas1
                     family protein;
                     TIGRFAM: CRISPR-associated protein Cas1;
                     PFAM: protein of unknown function DUF48"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="YP_004909502.1"
                     /db_xref="GI:357409215"
                     /db_xref="InterPro:IPR002729"
                     /db_xref="InterPro:IPR019851"
                     /db_xref="GeneID:11353769"
                     /translation="MTTVSRRAALTPRQLTRTGERLSFVYLERCVVHRDANAITAEDA
                     EGTTHIPSATIGTLLLGPGTRITHQAMSILGETGAAVCWVGERGVRYYAGGRALTRSS
                     ALAEAQAVQWANVRSRLGVARAMYRLRFPDEDPAGLTRHELLGCEGRRVKDCYRAQSA
                     RTGVPWHGRRYTPGDFSSGDAVNQAITAAAQCMYGIAHAVVASLGCSPALGFVHSGHE
                     LSFVLDVADLYKTEIGIPLAFDVAAEDEEDVGSRTRRALRDRINETSLLDRCVNDIKR
                     LLLGEERKENTATNDAPDVVTLQSDGGREVAAGRNYGGGEDFDVLETTW"
     misc_feature    142914..143690
                     /locus_tag="Sfla_6592"
                     /note="CRISPR/Cas system-associated protein Cas1; Region:
                     Cas1_I-E; cd09719"
                     /db_xref="CDD:187850"
     gene            143831..144181
                     /locus_tag="Sfla_6593"
                     /db_xref="GeneID:11353770"
     CDS             143831..144181
                     /locus_tag="Sfla_6593"
                     /inference="protein motif:TFAM:TIGR01873"
                     /note="KEGG: cai:Caci_3903 CRISPR-associated protein Cas2;
                     TIGRFAM: CRISPR-associated protein Cas2;
                     PFAM: CRISPR-associated protein Cas2"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas2"
                     /protein_id="YP_004909503.1"
                     /db_xref="GI:357409216"
                     /db_xref="InterPro:IPR010152"
                     /db_xref="GeneID:11353770"
                     /translation="MTVIVLTNCPAGLRGFLTRWLLEISAGVFIGNPSARIRDLLWAE
                     VQEYADQGRALLAHTANNEQGFTFLTHDHAWHPVDHEGLTLIRRPNANSPSTEQSPKK
                     GWSNAAKRRRFGRR"
     misc_feature    143903..144085
                     /locus_tag="Sfla_6593"
                     /note="CRISPR/Cas system-associated protein Cas2; Region:
                     Cas2_I-E; cd09755"
                     /db_xref="CDD:187885"
     repeat_region   144274..145279
                     /note="CRISPRS"
                     /rpt_unit_range=144274..144303
     gene            145365..146150
                     /locus_tag="Sfla_6594"
                     /db_xref="GeneID:11353771"
     CDS             145365..146150
                     /locus_tag="Sfla_6594"
                     /inference="similar to AA sequence:KEGG:Gbro_2639"
                     /note="KEGG: gbr:Gbro_2639 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909504.1"
                     /db_xref="GI:357409217"
                     /db_xref="GeneID:11353771"
                     /translation="MPSVLERIDRARHTISFVSHFAEPDSFALTALAQWLDTSPGGMA
                     TTAEDGKGMESGTEGTTPSNPVQQLAAHIRDQLGAGPFSQADGWTHMGAVISDASFQA
                     RSRYKATILPRILALQTAWPDAATVKGFQARLATDDLATAMNFHHARKVAKAHNVTDL
                     LAAHGVDTRDDLRAWLDIQPNRAALRAVKDVGPKTVDYLGNLVGGSQIAVDVHLRAFA
                     AEAGVTDLRYEQLRTTYEHAAALLGHEPGGMEHAVWRLKAGVS"
     misc_feature    <145887..146132
                     /locus_tag="Sfla_6594"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cl19066"
                     /db_xref="CDD:267419"
     misc_feature    145926..145949
                     /locus_tag="Sfla_6594"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(145956..145958,146112..146114,146124..146126)
                     /locus_tag="Sfla_6594"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    145995..145997
                     /locus_tag="Sfla_6594"
                     /note="active site"
                     /db_xref="CDD:238013"
     gene            146346..146597
                     /locus_tag="Sfla_6595"
                     /db_xref="GeneID:11353772"
     CDS             146346..146597
                     /locus_tag="Sfla_6595"
                     /inference="similar to AA sequence:KEGG:SAP1p06"
                     /note="KEGG: sma:SAP1p06 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909505.1"
                     /db_xref="GI:357409218"
                     /db_xref="GeneID:11353772"
                     /translation="MREEPHSTNAQQRLEPAAADAVRAYAAKTREEANRLAAVLEDVA
                     ANGLPAVEECTPGKISATHASRSAPQRPDGPQTRPYRIH"
     gene            147625..148665
                     /locus_tag="Sfla_6596"
                     /db_xref="GeneID:11353773"
     CDS             147625..148665
                     /locus_tag="Sfla_6596"
                     /inference="protein motif:PFAM:PF09250"
                     /note="KEGG: sen:SACE_1124 hypothetical protein;
                     manually curated;
                     PFAM: Bifunctional DNA primase/polymerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional DNA primase/polymerase"
                     /protein_id="YP_004909506.1"
                     /db_xref="GI:357409219"
                     /db_xref="InterPro:IPR015330"
                     /db_xref="GeneID:11353773"
                     /translation="MPQPRPADVARWLAGRHWPVHPLAPGRKTPAANCEQCRVRSHEP
                     SSCPCQARGLWCHGFHSATTDLARVEDWWSREPRAGVGVSCGPAHLVVLDVDAHAAPV
                     PDRNRLLPGIPIPEQVDLAGLASGFDTLALLAAYRKEANPAEDETTLRVRTPSGGLHI
                     WYVNTEPAVRYRSSTGSSPRTALAWQVDVRAHGGYIVAPTTRTSAGAYTPLGAVRDPA
                     PLPAWLAAELRRTGHVIQTAPVPGPRPARVPRRPRTGAVQALLQPLIEAVRECATSAE
                     GTSFTEKLNRAAYTAGGLAGAGYLNQSEARQELTEAAHYARPHQTRRSETIIDAALSA
                     GASRPFHPKGLA"
     misc_feature    147676..148299
                     /locus_tag="Sfla_6596"
                     /note="Prim_Pol: Primase-polymerase (primpol) domain of
                     the type found in bifunctional replicases from archaeal
                     plasmids, including ORF904 protein of the crenarchaeal
                     plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol).
                     These primpol domains belong to the...; Region: Prim_Pol;
                     cd04859"
                     /db_xref="CDD:240129"
     misc_feature    order(147706..147708,147904..147906,147910..147912,
                     148099..148101,148186..148188)
                     /locus_tag="Sfla_6596"
                     /note="polymerase nucleotide-binding site; other site"
                     /db_xref="CDD:240129"
     misc_feature    order(147709..147711,147721..147723,148207..148209,
                     148225..148227)
                     /locus_tag="Sfla_6596"
                     /note="DNA-binding residues [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:240129"
     misc_feature    order(147868..147870,147904..147906,147910..147912,
                     148081..148083,148090..148095,148099..148101,
                     148186..148188,148207..148209)
                     /locus_tag="Sfla_6596"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240129"
     misc_feature    order(147904..147906,147910..147912,148099..148101,
                     148186..148188)
                     /locus_tag="Sfla_6596"
                     /note="primase nucleotide-binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:240129"
     gene            148662..150209
                     /locus_tag="Sfla_6597"
                     /db_xref="GeneID:11353774"
     CDS             148662..150209
                     /locus_tag="Sfla_6597"
                     /inference="protein motif:TFAM:TIGR01613"
                     /note="TIGRFAM: phage/plasmid primase, P4 family;
                     PFAM: primase P4;
                     KEGG: sco:SCP1.196 putative DNA primase/helicase;
                     SMART: primase P4"
                     /codon_start=1
                     /transl_table=11
                     /product="phage/plasmid primase, P4 family"
                     /protein_id="YP_004909507.1"
                     /db_xref="GI:357409220"
                     /db_xref="InterPro:IPR006500"
                     /db_xref="InterPro:IPR014015"
                     /db_xref="InterPro:IPR014818"
                     /db_xref="GeneID:11353774"
                     /translation="MSSAESSRFDAAAAAQQMLDFEAAAPAWVPPQQVQAPAMTDTPV
                     LLPPMLTDRGNAKLFAQLYSDQFRHVEGLGWYCWDQFRWKRVGGEKAALWAAGDMAEQ
                     MSPTDPRGVFSDREIAQHRRRTMSTSGMKALLHQAKAAPVLSLDPDVLDGDAYSLCTP
                     AGVVDLRNGRLHKPNPLRDLHSRATNVAPQATPTPRWHAFLDDTFGADTKGQEMIDFL
                     HLLLGYSITGDVGAQVLPFLWGKGANGKSVLLDVMIQVMGDYADAAPPGFLMDKGNFA
                     EHSTELTELHGRRIFVCSELKPNDKFDEARVKLLTGGDKIKARRMRQDYFSFTPTHKL
                     WLLGNHQPEVGTGGHAFWRRIRLIPFERVVAADRKIDNLAGELVEEEGPGILHWLIQG
                     AMRYLTSRDPLTGPSSVRLATAAYETTEDHIGRFLSEACARQGPETGDLRVEQGLLYA
                     TYTAWCSSEGIRADTARAFAGRIRQEVGLASPAEMLKSSGKKYYPAMALLPDDLVRPD
                     GTAGRRG"
     misc_feature    148695..150083
                     /locus_tag="Sfla_6597"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14709"
                     /db_xref="CDD:173172"
     misc_feature    148827..149279
                     /locus_tag="Sfla_6597"
                     /note="D5 N terminal like; Region: D5_N; pfam08706"
                     /db_xref="CDD:254987"
     misc_feature    149124..150068
                     /locus_tag="Sfla_6597"
                     /note="phage/plasmid primase, P4 family, C-terminal
                     domain; Region: primase_Cterm; TIGR01613"
                     /db_xref="CDD:130674"
     gene            150346..150726
                     /locus_tag="Sfla_6598"
                     /db_xref="GeneID:11353775"
     CDS             150346..150726
                     /locus_tag="Sfla_6598"
                     /inference="similar to AA sequence:KEGG:SCP1.197"
                     /note="KEGG: sco:SCP1.197 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909508.1"
                     /db_xref="GI:357409221"
                     /db_xref="GeneID:11353775"
                     /translation="MSSLLQESQLTHEANVVWLEDLDELDYVRQALDKSARRSGKPRY
                     ARDGRMVGYAELDRDAEASPDSGLFQRRTFFLLPHDRPNDPEGLYKEGAPGEAVDPRT
                     IDARRVGEKTPRSQGKHRSEIVPS"
     gene            151024..151290
                     /locus_tag="Sfla_6599"
                     /pseudo
                     /db_xref="GeneID:11353776"
     gene            151275..151709
                     /locus_tag="Sfla_6600"
                     /pseudo
                     /db_xref="GeneID:11353777"
     gene            complement(152034..152771)
                     /locus_tag="Sfla_6601"
                     /db_xref="GeneID:11353778"
     CDS             complement(152034..152771)
                     /locus_tag="Sfla_6601"
                     /inference="protein motif:SMART:SM00116"
                     /note="SMART: CBS domain containing protein;
                     KEGG: amd:AMED_5201 signal transduction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain containing protein"
                     /protein_id="YP_004909509.1"
                     /db_xref="GI:357409222"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="GeneID:11353778"
                     /translation="MRCPRARTRRRTSAIATADRCTRKLHWLRNASAYPPVRGHLSTR
                     HNGKFAADGGSTRWTARWHYWPRDTRPGPIGVAARPATRCDHVVGGAVGGQREERNGG
                     YLSPCAPSTVSARSAGRRPSPAGRSADLGRPVSRAPPVDNACRARADQAQGLRRGLVD
                     RGIHDHHCGGRGDRSAPTTGSLASSPTGARGAGHRQVFATVTQHRVRVLPVIDGTDLV
                     DMVALVDAARALDAPGADRLVDALSLG"
     misc_feature    complement(152085..>152297)
                     /locus_tag="Sfla_6601"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cl15354"
                     /db_xref="CDD:265675"
     gene            complement(152716..152919)
                     /locus_tag="Sfla_6602"
                     /db_xref="GeneID:11353779"
     CDS             complement(152716..152919)
                     /locus_tag="Sfla_6602"
                     /inference="similar to AA sequence:KEGG:SCAB_8771"
                     /note="KEGG: scb:SCAB_8771 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909510.1"
                     /db_xref="GI:357409223"
                     /db_xref="GeneID:11353779"
                     /translation="MSTHHPKHETTHDNEPRETAGDELLREAEGAATSVEDDAEGDSS
                     DGEAADALSPSKDAQEDVRHRDS"
     gene            complement(152993..153319)
                     /locus_tag="Sfla_6603"
                     /db_xref="GeneID:11353780"
     CDS             complement(152993..153319)
                     /locus_tag="Sfla_6603"
                     /inference="similar to AA sequence:KEGG:SGR_6448"
                     /note="KEGG: sgr:SGR_6448 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909511.1"
                     /db_xref="GI:357409224"
                     /db_xref="GeneID:11353780"
                     /translation="MPQGSSRKRERQYEHIKEGAEKRGTSEGRAKEIAARTVNKERAR
                     SGESKTASKTSTQDKKSASQRGGERSHTGPQGPTKDQLYAEAKKRNIDGRSSMNKQQL
                     AKALGR"
     gene            complement(153487..153903)
                     /locus_tag="Sfla_6604"
                     /db_xref="GeneID:11353781"
     CDS             complement(153487..153903)
                     /locus_tag="Sfla_6604"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: sma:SAV_7554 IS1647-like transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909512.1"
                     /db_xref="GI:357409225"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:11353781"
                     /translation="MHVLSDANGLTLLVGVSAANVHDSLALKPTVEGHQTRHDPHRGR
                     NFKPQRLHADKAYDVPHLRRWLWGKHIGVRIARKGIDSSERLGRRRWVIERTMSWLTG
                     YRRLNHRYERKPGNYLAFLGLAAAPCCYKRFLKLTM"
     misc_feature    complement(153526..>153897)
                     /locus_tag="Sfla_6604"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(153526..153753)
                     /locus_tag="Sfla_6604"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            153969..155201
                     /locus_tag="Sfla_6605"
                     /db_xref="GeneID:11353782"
     CDS             153969..155201
                     /locus_tag="Sfla_6605"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: scb:SCAB_60181 putative transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic region"
                     /protein_id="YP_004909513.1"
                     /db_xref="GI:357409226"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001598"
                     /db_xref="GeneID:11353782"
                     /translation="MFEIRKDRAKALGGRRRLVREREEYFLLVDQGYGNTEACRLVGI
                     NERTGREWRNGRTAKDRFRAPARPASAPVVPSRFLTQADRLHVADRLREKATVRAIAA
                     ELGRSPSTISREIRRNGIPLRGDTSRWAYRPYAAQARSDARRPRPKPGRIGQNSRLRD
                     YIQERLTRRWSPEQIAAQLPRDFPDDLEMRVTHETIYQALYVQGRGELRRELVHALRT
                     GRTRRKPHRHAARRQPRFATPMVMISERPAEVADRAIPGHWEGDLIVGPGHRSAIGTL
                     VERSTRYLMLLHLPNGAHKAEHFHQVLARTIQTLPSQFKRSLTWDQGTEMAGHGAFTM
                     ATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGSDLSSHSLEHLAAVAAELNGRPRK
                     TLGWETPAERLAKLLAAS"
     misc_feature    154047..154325
                     /locus_tag="Sfla_6605"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    154194..154322
                     /locus_tag="Sfla_6605"
                     /note="Helix-turn-helix domain; Region: HTH_38; pfam13936"
                     /db_xref="CDD:258198"
     misc_feature    154203..155192
                     /locus_tag="Sfla_6605"
                     /note="Transposase and inactivated derivatives, IS30
                     family [DNA replication, recombination, and repair];
                     Region: Tra8; COG2826"
                     /db_xref="CDD:225382"
     misc_feature    154347..154568
                     /locus_tag="Sfla_6605"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    154725..155063
                     /locus_tag="Sfla_6605"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            155255..155671
                     /locus_tag="Sfla_6606"
                     /db_xref="GeneID:11353783"
     CDS             155255..155671
                     /locus_tag="Sfla_6606"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: sma:SAV_7554 IS1647-like transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909514.1"
                     /db_xref="GI:357409227"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:11353783"
                     /translation="MHVLSDANGLPLLVGISAANTHDSLALKPMVEGHQTRHAPHRGR
                     NFKPQRLHADKAYDVPHLRRWLWGKHIGVRIARKGVESSERLGRRRWVIERTMSWLSG
                     YRRLNHRYERQPRNYLACLGLTAALCCYKRLLRLAT"
     misc_feature    155258..155638
                     /locus_tag="Sfla_6606"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    155405..155635
                     /locus_tag="Sfla_6606"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            155773..156057
                     /locus_tag="Sfla_6607"
                     /db_xref="GeneID:11353784"
     CDS             155773..156057
                     /locus_tag="Sfla_6607"
                     /inference="similar to AA sequence:KEGG:Micau_4065"
                     /note="KEGG: mau:Micau_4065 cobalamin synthesis CobW
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909515.1"
                     /db_xref="GI:357409228"
                     /db_xref="GeneID:11353784"
                     /translation="MHTCSEGTDPPYGAMVDLVRGIQARTRPELRRRVGVRTPAPPLH
                     PFRLIEQPFRVREPRLPQKLHDVLVVVREPGDLTLDGDPPPARPWARAGE"
     gene            156214..156693
                     /locus_tag="Sfla_6608"
                     /pseudo
                     /db_xref="GeneID:11353785"
     gene            complement(156840..157502)
                     /locus_tag="Sfla_6609"
                     /db_xref="GeneID:11353786"
     CDS             complement(156840..157502)
                     /locus_tag="Sfla_6609"
                     /inference="similar to AA sequence:KEGG:Sros_4794"
                     /note="KEGG: sro:Sros_4794 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909516.1"
                     /db_xref="GI:357409229"
                     /db_xref="GeneID:11353786"
                     /translation="MDTDADAGSLDWARAWMCATFTRGLAPEEVFARYGADPDQARLL
                     GCEAASDLPSGESGGGMVSLLRAGSIGGWAFCVEEDGGIGFGEESLAELSRGTETYSV
                     ATTEGIDVFQYWRDGECVEYFEPGMEHSRSEPLGPWWDRVEEALAAHKGEGAGMAPVV
                     ALVLNHLGITLDDAALAGPWPSLTLADDDAPAARLGHTYAGEGPVPPGTVLDFGPSSG
                     LS"
     gene            complement(158122..158565)
                     /locus_tag="Sfla_6610"
                     /db_xref="GeneID:11353787"
     CDS             complement(158122..158565)
                     /locus_tag="Sfla_6610"
                     /inference="similar to AA sequence:KEGG:SCP1.266c"
                     /note="KEGG: sco:SCP1.266c hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909517.1"
                     /db_xref="GI:357409230"
                     /db_xref="GeneID:11353787"
                     /translation="MRDIAVQVNSDFDGRLKWRSRYLVHRARRRGRTGLLLQVDLRDP
                     PRSMSLKWCLVSVTESGRQLCSVDRTSIRKVRFIPLPPGPHPLHLEVTRHRKRRSTQA
                     QQNVVLGQGDILLVTCDPVQPNVFYRRSPVVDTWSAQILQADPNA"
     gene            complement(158645..158905)
                     /locus_tag="Sfla_6611"
                     /db_xref="GeneID:11353788"
     CDS             complement(158645..158905)
                     /locus_tag="Sfla_6611"
                     /inference="similar to AA sequence:KEGG:Acry_2684"
                     /note="KEGG: acr:Acry_2684 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909518.1"
                     /db_xref="GI:357409231"
                     /db_xref="GeneID:11353788"
                     /translation="MSPSGWRRLAKAHGVRRRVVIVGGHVIRRPFLLLALAGLVFLIT
                     WFGRDLPLLYGMAPLGAVLIGGSMGRYRPDSTAAESNKEPLP"
     gene            159355..159864
                     /locus_tag="Sfla_6612"
                     /db_xref="GeneID:11353789"
     CDS             159355..159864
                     /locus_tag="Sfla_6612"
                     /inference="protein motif:PFAM:PF00023"
                     /note="KEGG: npu:Npun_R0083 hypothetical protein;
                     PFAM: Ankyrin;
                     SMART: Ankyrin"
                     /codon_start=1
                     /transl_table=11
                     /product="Ankyrin"
                     /protein_id="YP_004909519.1"
                     /db_xref="GI:357409232"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="GeneID:11353789"
                     /translation="MVRRTALDLAVHAGHAETVRVLLAAGADLRQRAGEYGELTPLCL
                     AAVLGHAAVVEILLAAGAPTGAQGEMGYVPLVLAATATEQGHPQTVDVLLRHGVDING
                     VMKDKTSLEWAADFGQLQMVHQLLARGAIPTVKALSSARAGRERSPEIADKYTLIVDA
                     LHAAGIDED"
     misc_feature    159364..159732
                     /locus_tag="Sfla_6612"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    159373..159657
                     /locus_tag="Sfla_6612"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:257303"
     gene            159870..160013
                     /locus_tag="Sfla_6613"
                     /pseudo
                     /db_xref="GeneID:11353790"
     gene            complement(160000..160296)
                     /locus_tag="Sfla_6614"
                     /db_xref="GeneID:11353791"
     CDS             complement(160000..160296)
                     /locus_tag="Sfla_6614"
                     /inference="similar to AA sequence:KEGG:SORBI_02g026635"
                     /note="KEGG: sbi:SORBI_02g026635 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909520.1"
                     /db_xref="GI:357409233"
                     /db_xref="GeneID:11353791"
                     /translation="MKVVHDGVNRVPIERSLVVDPVLKHALRHLRFVKSRQLSNADFV
                     EFADWRERIAEALDALAGVLVFKEDRSRARAEATAAREEAAEVRRRGEIGASER"
     gene            complement(160444..160716)
                     /locus_tag="Sfla_6615"
                     /db_xref="GeneID:11353792"
     CDS             complement(160444..160716)
                     /locus_tag="Sfla_6615"
                     /inference="similar to AA sequence:KEGG:SGR_308"
                     /note="KEGG: sgr:SGR_308 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909521.1"
                     /db_xref="GI:357409234"
                     /db_xref="GeneID:11353792"
                     /translation="MSEPTQPRIHGSDHDSADPYTTLPGHEYVELTGGPIDGQLLNVT
                     GLTADERTAGAYLITPHSTHGPGGRASYGPTFTRPDGPWVWEGNVP"
     gene            complement(160829..161248)
                     /locus_tag="Sfla_6616"
                     /db_xref="GeneID:11353793"
     CDS             complement(160829..161248)
                     /locus_tag="Sfla_6616"
                     /inference="protein motif:PFAM:PF03625"
                     /note="PFAM: protein of unknown function DUF302;
                     KEGG: sco:SCO0165 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909522.1"
                     /db_xref="GI:357409235"
                     /db_xref="InterPro:IPR005180"
                     /db_xref="InterPro:IPR016796"
                     /db_xref="GeneID:11353793"
                     /translation="MPYDRTVTVNAPFDQVQRDVRNALADQGFGILTEIDVQATLKAK
                     LDHDMEPYLILGACNPPLAHRALETDHTIGLLLPCNVVVRSDVDRVIVQAVDPSTMVT
                     LTGLDAMAPVAEEATRRLDAALASVEAAGRESQDQVA"
     misc_feature    complement(160874..161245)
                     /locus_tag="Sfla_6616"
                     /note="Domain of unknown function DUF302; Region: DUF302;
                     cl01364"
                     /db_xref="CDD:260900"
     gene            161410..162767
                     /locus_tag="Sfla_6617"
                     /pseudo
                     /db_xref="GeneID:11353794"
     gene            162810..163175
                     /locus_tag="Sfla_6618"
                     /db_xref="GeneID:11353795"
     CDS             162810..163175
                     /locus_tag="Sfla_6618"
                     /inference="protein motif:PFAM:PF00581"
                     /note="KEGG: scb:SCAB_76851 hypothetical protein;
                     PFAM: Rhodanese domain protein;
                     SMART: Rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese domain protein"
                     /protein_id="YP_004909523.1"
                     /db_xref="GI:357409236"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:11353795"
                     /translation="MFLFNRKASRLSVDQARTRTGGEQPEAVLLDVREKPEWKDGHAP
                     DAVSAPLSGLVGGAPLPAPAQGQALVVICRSGHRSQRAAKLLAERGADAVDVEGGMNA
                     WAAAGYPVVDERGNSGSIS"
     misc_feature    162876..163121
                     /locus_tag="Sfla_6618"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    163026..163028
                     /locus_tag="Sfla_6618"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            163172..163915
                     /locus_tag="Sfla_6619"
                     /db_xref="GeneID:11353796"
     CDS             163172..163915
                     /locus_tag="Sfla_6619"
                     /inference="protein motif:PFAM:PF01925"
                     /note="PFAM: protein of unknown function DUF81;
                     KEGG: scb:SCAB_76861 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909524.1"
                     /db_xref="GI:357409237"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="GeneID:11353796"
                     /translation="MSVLILALIAGAVIGLALGALGGGGSVLAVPALIYLLGFSPASA
                     TTASLIIVTATSATALYAHARDGNVAWKVGTLFAAAGIVPAFLAGAAAGYLPAAVLTG
                     AFSVVAALAALRMLRPAMSEPPERVRPVKAVGTGVGLGAVTGFLGVGGGFLAVPALVG
                     VLGLRMKQAVGTSLLVITVNSLAALTARTGTGGDLRWEVIAPFTGAAILGAWDGKRLA
                     SKITGQALQRVFAFVLLAVAALMLIDVIL"
     sig_peptide     163172..163261
                     /locus_tag="Sfla_6619"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.947 at
                     residue 30"
     misc_feature    163247..163894
                     /locus_tag="Sfla_6619"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            complement(163940..164227)
                     /locus_tag="Sfla_6620"
                     /db_xref="GeneID:11353797"
     CDS             complement(163940..164227)
                     /locus_tag="Sfla_6620"
                     /inference="protein motif:PFAM:PF02583"
                     /note="PFAM: protein of unknown function DUF156;
                     KEGG: sgr:SGR_1262 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909525.1"
                     /db_xref="GI:357409238"
                     /db_xref="InterPro:IPR003735"
                     /db_xref="GeneID:11353797"
                     /translation="MELDLAGAELKAVLNRLRRAQGQIAGVIRMIEEGRDCEEVVTQL
                     AAASRALDRAGFAIIATGLQQCLTDTENGMRSGEDPDEMRGRLEKLFLSLA"
     misc_feature    complement(163949..164197)
                     /locus_tag="Sfla_6620"
                     /note="Transcriptional regulators CsoR (copper-sensitive
                     operon repressor), RcnR, and FrmR, and related domains;
                     this domain superfamily was previously known as DUF156;
                     Region: CsoR-like_DUF156; cd10148"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(163952..163972,163976..163984,
                     163988..163993,164027..164029,164036..164044,
                     164048..164056,164060..164065,164072..164077,
                     164084..164089,164093..164098,164102..164110,
                     164114..164122,164126..164137,164144..164149,
                     164153..164158,164165..164167,164174..164179,
                     164186..164191))
                     /locus_tag="Sfla_6620"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(163952..163963,163970..163972,
                     164042..164044,164054..164056,164063..164065,
                     164072..164077,164084..164089,164093..164098,
                     164102..164110,164114..164122,164126..164137,
                     164144..164149,164153..164158,164165..164167,
                     164174..164179,164186..164191))
                     /locus_tag="Sfla_6620"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(163970..163972,164042..164044,
                     164120..164122))
                     /locus_tag="Sfla_6620"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(164030..164032,164042..164044,
                     164117..164119))
                     /locus_tag="Sfla_6620"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(163964..163969,163976..163984,
                     163988..163993,164027..164032,164036..164041,
                     164048..164053,164060..164062))
                     /locus_tag="Sfla_6620"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     gene            164307..164882
                     /locus_tag="Sfla_6621"
                     /db_xref="GeneID:11353798"
     CDS             164307..164882
                     /locus_tag="Sfla_6621"
                     /inference="protein motif:PFAM:PF00581"
                     /note="KEGG: scb:SCAB_76871 putative membrane transport
                     protein;
                     PFAM: Rhodanese domain protein; Protein of unknown
                     function DUF2892;
                     SMART: Rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese domain protein"
                     /protein_id="YP_004909526.1"
                     /db_xref="GI:357409239"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR021309"
                     /db_xref="GeneID:11353798"
                     /translation="MPTPTTLATSEARTRLHELTVIDVRTPGEYAGGHLPGALNIPLD
                     QIQRALPDIRHAAERGDVLVVCASGARSENACRILADNHIATATLSGGTGAWAADGHD
                     LHRPQGATRAAWGMERQVRLTAGTVVLIGLLLGLLIHPAFQILSAAIAAGLAFSALTD
                     TCGMAAMLAKLPHNRPHAADLDNTLAELRNR"
     misc_feature    164337..164597
                     /locus_tag="Sfla_6621"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    164502..164504
                     /locus_tag="Sfla_6621"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    164649..164810
                     /locus_tag="Sfla_6621"
                     /note="Protein of unknown function (DUF2892); Region:
                     DUF2892; pfam11127"
                     /db_xref="CDD:256306"
     gene            complement(164926..165797)
                     /locus_tag="Sfla_6622"
                     /pseudo
                     /db_xref="GeneID:11353799"
     gene            complement(165815..166462)
                     /locus_tag="Sfla_6623"
                     /pseudo
                     /db_xref="GeneID:11353800"
     gene            complement(166621..167115)
                     /locus_tag="Sfla_6624"
                     /db_xref="GeneID:11353801"
     CDS             complement(166621..167115)
                     /locus_tag="Sfla_6624"
                     /inference="similar to AA sequence:KEGG:SCO5992"
                     /note="manually curated;
                     KEGG: sco:SCO5992 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909527.1"
                     /db_xref="GI:357409240"
                     /db_xref="GeneID:11353801"
                     /translation="MSSSPRSWSRAGATLRTWRARQWAVVGLGALATALVVGVPTAVV
                     PSPLFSRSVPVQWWNYPALFATAALAGITLGTYVHQPYQREQSGVRDGSRLGVVGSVL
                     TFFAVGCPVCNKLVLVLLGASGAISYWAPLQPLLAVLSLGLLAEAALRRLSFQSVCPV
                     PASA"
     sig_peptide     complement(166987..167115)
                     /locus_tag="Sfla_6624"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.733) with cleavage site probability 0.415 at
                     residue 43"
     gene            167859..168233
                     /locus_tag="Sfla_6625"
                     /db_xref="GeneID:11353802"
     CDS             167859..168233
                     /locus_tag="Sfla_6625"
                     /inference="similar to AA sequence:KEGG:Amir_4608"
                     /note="KEGG: ami:Amir_4608 transcriptional regulator, LacI
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909528.1"
                     /db_xref="GI:357409241"
                     /db_xref="GeneID:11353802"
                     /translation="MRKIMCVAVSVMVWGCLGQAPASASGTAEDGPVGIGVMGEGLKV
                     REVRALLDGWQDGARARVSLWQGGAYVRTVRGWKATSARETRGHRFEYAAWKINKSFP
                     HRSQLCVEFTGHDRMPCVTIKR"
     sig_peptide     167859..167933
                     /locus_tag="Sfla_6625"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.924 at
                     residue 25"
     gene            complement(168324..168623)
                     /locus_tag="Sfla_6626"
                     /db_xref="GeneID:11353803"
     CDS             complement(168324..168623)
                     /locus_tag="Sfla_6626"
                     /inference="similar to AA sequence:KEGG:RB10413"
                     /note="KEGG: rba:RB10413 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909529.1"
                     /db_xref="GI:357409242"
                     /db_xref="GeneID:11353803"
                     /translation="MSFIQTGKIELRSDNAIETTGGNTSTFTRVTFPTPFPSGTEVVV
                     FPLTQTFNGPETPGIRIHEVTTTGFLIRMNEVYAGSAKSDGKHTTETIGWLASTV"
     gene            complement(168883..169197)
                     /locus_tag="Sfla_6627"
                     /db_xref="GeneID:11353804"
     CDS             complement(168883..169197)
                     /locus_tag="Sfla_6627"
                     /inference="similar to AA sequence:KEGG:Tbis_0438"
                     /note="KEGG: tbi:Tbis_0438 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909530.1"
                     /db_xref="GI:357409243"
                     /db_xref="GeneID:11353804"
                     /translation="MTNHCCEAMSRHVNVRCDQHDDPFACPDALIKFSAKFQEYGLII
                     HDGGTSSSTIDFCPWCGRRLPESQRDRWFDELESRGIDPWEDEVPAEFQDDRWLAALP
                     RD"
     gene            169263..170137
                     /locus_tag="Sfla_6628"
                     /pseudo
                     /db_xref="GeneID:11353805"
     gene            complement(170372..172969)
                     /locus_tag="Sfla_6629"
                     /db_xref="GeneID:11353806"
     CDS             complement(170372..172969)
                     /locus_tag="Sfla_6629"
                     /inference="protein motif:PFAM:PF04851"
                     /note="KEGG: sma:SAP1p95 putative helicase;
                     PFAM: type III restriction protein res subunit; helicase
                     domain protein; helicase-associated;
                     SMART: DEAD-like helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction protein res subunit"
                     /protein_id="YP_004909531.1"
                     /db_xref="GI:357409244"
                     /db_xref="GO:0003676"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004386"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005114"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:11353806"
                     /translation="MQGISLRPHQVEAVDSIIEGLALPLDGSVPASGQRGQVHMSTGS
                     GKTITAAVAALRLVPRGVVGVLVPTLDLLTQTVEAWRAVGHTAPAVAVCSLGADPLLE
                     ALDVRCTTNPTQLALWTGGEGPLLVFATYASLSPQGLDDDQGDEETGAAPGALERALR
                     GTYGQTMRPFDLLVVDEAHRTSGDLGKAWAAVHDQERVPAARRLYMTATPRLWEASPG
                     SAGADETGGRLVASMDDETLYGPVLFEFGLMESVERGVLARFEIDVLEIRDPQAPGPD
                     ASVEERRGRRLAALQEALLKHADTTGVRSFMTFHSRTLDAMSFARALPETAAELHATD
                     PVTYPGRVGAEWLSGEHPAAHRRAVLGRFADGVDADGWVTEVSVLSSCRVLGEGVDIR
                     GKRGVGAVVFADTRSSPVDIVQVIGRGLRQDPGEGKVSRIVVPVFLEPGEDPSDMMAS
                     PGYRSLVAVLQGLRAHDERVIERMTLGTTTARGKATSVVALDPVREEGNDGDGQEHDA
                     DEDQEEQTDTAPAGTEDSTEDDADEEQHAGSNVPLLRFSLPRDPGTIALFLRTRVLHP
                     DSEIWLTGYNALRHWTREHGSAEVPLDASVELGQERITYALGAWVSEQRRAFRLGTLK
                     AWRADLLNELGMVWSVADAGFWRNLTAARAYHAVHGTLAAPKDAVVEGVAVGQWLANL
                     RKAGGLGKDEVRAGERRAALEAIDPEWHPGWSVEWQRHYATARALLGKEGGLTEVLPG
                     VLVHGCDVGTWVLRQRDAATWETLLPEQRERLEALGLVPLPAVPAKKTTAGGAGAFER
                     GVLALEQYRARTGTVTVPRAHIETVTIDGQEHGVKLGVFLTNSKTRRAKLPAEKLAAL
                     AALGLDWAT"
     misc_feature    complement(171596..172960)
                     /locus_tag="Sfla_6629"
                     /note="DNA phosphorothioation system restriction enzyme;
                     Region: dnd_restrict_1; TIGR04095"
                     /db_xref="CDD:234468"
     misc_feature    complement(172340..172858)
                     /locus_tag="Sfla_6629"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(172829..172843)
                     /locus_tag="Sfla_6629"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(172433..172444)
                     /locus_tag="Sfla_6629"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(171707..171931)
                     /locus_tag="Sfla_6629"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    complement(171059..171259)
                     /locus_tag="Sfla_6629"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     misc_feature    complement(170846..171037)
                     /locus_tag="Sfla_6629"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     misc_feature    complement(170636..170821)
                     /locus_tag="Sfla_6629"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     gene            173156..174751
                     /locus_tag="Sfla_6630"
                     /db_xref="GeneID:11353807"
     CDS             173156..174751
                     /locus_tag="Sfla_6630"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: scb:SCAB_0311 putative telomere-binding
                     protein;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004909532.1"
                     /db_xref="GI:357409245"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353807"
                     /translation="MTEKLSVEALLEEARLNASIPPPAERLRLREAAKLSRAQVAETC
                     DVGRSTVANWETGHSEPAPPARLPYLRLLKGLAEIYPPDSTPAPAPGPTADPAPQPAP
                     APASVPAAFTAAPETLRGPDGRAIEGDPGPCIRCGIETTYQSTDGRPLHSGAMCQPAD
                     PATPAAPASAPAVSPATTAPASVSPTPVPVPSRPERRARSAARAQADTTALITRAVQD
                     EAERAGGDEEAALKALIKRAIPDVMHLFNETRATGRYDYTAYPALPDVLKKPSKKDPD
                     QIWEARPKFHHPGYSLKVPGDVKVTALDVNAAYLSALKCWLPIGKLEHSTGSDGVDPK
                     RSGVHLITPGEWAHPHLPDPIGDRDEPGALWVTNATLRLLQRLSGPKYGLTDAPVVHE
                     SWTSGATENFLDALRKLLSAARDEAIENNDTLTLEYVKAMYSKFISTMGESIHNREMV
                     RPDWMHIIHSQAYANLWGKAYKAHQAGLAVVAMMGTDELHVTGDWRKVFPEGRGVSQM
                     KVKHGEGKATGEYTVGTVGSVGR"
     misc_feature    173225..>173338
                     /locus_tag="Sfla_6630"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(173237..173239,173246..173248,173321..173323)
                     /locus_tag="Sfla_6630"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(173243..173245,173318..173320)
                     /locus_tag="Sfla_6630"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(173264..173269,173300..173302,173309..173311,
                     173321..173326)
                     /locus_tag="Sfla_6630"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            174751..175326
                     /locus_tag="Sfla_6631"
                     /db_xref="GeneID:11353808"
     CDS             174751..175326
                     /locus_tag="Sfla_6631"
                     /inference="similar to AA sequence:KEGG:SCAB_1221"
                     /note="KEGG: scb:SCAB_1221 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909533.1"
                     /db_xref="GI:357409246"
                     /db_xref="GeneID:11353808"
                     /translation="MAGRWMDLGALNARGLPGADALGVAIERMVTGIASSVESERGLA
                     ARLNYLTKTDAGYEAMDRAGIHVSPRTLMAWLAEERIPNKANRSRLDAAYWDLRRRNV
                     AADLKKRLNNHGRGTRIEINPVDQTRVEGRHQRDLSSRSINVRGVWDRAVDAWMNDDY
                     DELDAVWDDIIEDLGSEYDAYSNVSSIGWAA"
     gene            175484..175834
                     /locus_tag="Sfla_6632"
                     /db_xref="GeneID:11353809"
     CDS             175484..175834
                     /locus_tag="Sfla_6632"
                     /inference="similar to AA sequence:KEGG:SCO2354"
                     /note="KEGG: sco:SCO2354 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909534.1"
                     /db_xref="GI:357409247"
                     /db_xref="GeneID:11353809"
                     /translation="MPAFDFPQDLLDAQAALDAVQAEHDLFARTLPWSAEPLPGWKSD
                     KKLHSDYVPEKDDSPGYTPEQAERLSGYRARILELTTQIITHPYWATLSGPDRVEART
                     ALKHAHDTPAGPDA"
     gene            175837..176181
                     /locus_tag="Sfla_6633"
                     /db_xref="GeneID:11353810"
     CDS             175837..176181
                     /locus_tag="Sfla_6633"
                     /inference="similar to AA sequence:KEGG:SCAB_32531"
                     /note="KEGG: scb:SCAB_32531 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909535.1"
                     /db_xref="GI:357409248"
                     /db_xref="GeneID:11353810"
                     /translation="MPDDTPTPGAISDLEKNRALLEWLRWQVGQTERRVRELEIQEAQ
                     ERARRERARAEMAWKIQPQRSSSAALLHRGGCATYPDQVGLISREDAMVALAEPDIEP
                     CEVCRPQTGLLS"
     gene            complement(176337..177176)
                     /locus_tag="Sfla_6634"
                     /db_xref="GeneID:11353811"
     CDS             complement(176337..177176)
                     /locus_tag="Sfla_6634"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: stp:Strop_4179 transposase, IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909536.1"
                     /db_xref="GI:357409249"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11353811"
                     /translation="MTERRRYPSDLSDARWELVEPVLTAWRAERRGRGLDIGRPPNHD
                     LRSLLDAVLYVNRTGIPWRYLPHDYPHWNTVYAYFARWQEEGVFDQLNSLLRRQVRRQ
                     EGRDDEPTACVIDSQSIKTSTNVPATGQGIDAGKKIVGRKRSIVIDTVGLLLGVLVTA
                     ASVQDSTAGRTLIERIAAEHPTIRKTWVDGGYRQHLVEHAATLGIDMHIVRRDTATRG
                     FTVLPRRWTVERTLGWLMNHRRLARDYEAHPHRSEAMIHVAMINLMTRRLSAESTPTW
                     RGA"
     misc_feature    complement(<176862..177161)
                     /locus_tag="Sfla_6634"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(176901..177146)
                     /locus_tag="Sfla_6634"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    complement(176385..176861)
                     /locus_tag="Sfla_6634"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(176379..176618)
                     /locus_tag="Sfla_6634"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            177566..177991
                     /locus_tag="Sfla_6635"
                     /db_xref="GeneID:11353812"
     CDS             177566..177991
                     /locus_tag="Sfla_6635"
                     /inference="protein motif:PFAM:PF06491"
                     /note="PFAM: protein of unknown function DUF1094;
                     KEGG: dfe:Dfer_5785 protein of unknown function DUF1094"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1094"
                     /protein_id="YP_004909537.1"
                     /db_xref="GI:357409250"
                     /db_xref="InterPro:IPR009474"
                     /db_xref="GeneID:11353812"
                     /translation="MPYSPLLVRPMKEELTAIGFKELLTAEEVDTAMKDAEKGLTLVA
                     VNAVNGAAAGMARPGVRRALEDSSKRPDRLVTVFAEQDLEATAQMRGYFPDIPPSAPS
                     FALFKDGELVHFIPCHRIEGRDASAVATDLRAAFDEHGQ"
     misc_feature    177572..177982
                     /locus_tag="Sfla_6635"
                     /note="Disulphide isomerase; Region: Disulph_isomer;
                     cl05813"
                     /db_xref="CDD:262680"
     gene            complement(178002..178850)
                     /locus_tag="Sfla_6636"
                     /db_xref="GeneID:11353813"
     CDS             complement(178002..178850)
                     /locus_tag="Sfla_6636"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: sco:SCP1.316 putative transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004909538.1"
                     /db_xref="GI:357409251"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11353813"
                     /translation="MRGRRYPTDTTDTEWALIEPLLPVPACDTVVGGRPEKHPRREIV
                     DAIRYVVDTGCKWRALPADFPPWRTIWGFMARWAAAGIVNQIRDHLASRIRRELGKSP
                     RAVATVIDSQSVKAAETVSRATRGYDAGKKINGRKRHLVVDTRGLPLMVMVTPASLSD
                     RDAAKEILFRLRLTHPEITIVWADSAYAGKLVTWAKRHLNLTVKPVSRPKDTTGFIVL
                     PRRWVVERSLAWMMHARRHARDYERLVQHSETLITWAAITLMTRRLARKGATSGWPSK
                     AAPTAG"
     misc_feature    complement(178452..178838)
                     /locus_tag="Sfla_6636"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(178593..178820)
                     /locus_tag="Sfla_6636"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    complement(178071..178550)
                     /locus_tag="Sfla_6636"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(178065..178310)
                     /locus_tag="Sfla_6636"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(178924..179241)
                     /locus_tag="Sfla_6637"
                     /db_xref="GeneID:11353814"
     CDS             complement(178924..179241)
                     /locus_tag="Sfla_6637"
                     /inference="similar to AA sequence:KEGG:SCP1.315"
                     /note="KEGG: sco:SCP1.315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909539.1"
                     /db_xref="GI:357409252"
                     /db_xref="GeneID:11353814"
                     /translation="MSAPIVIHRPSPTGGRRVTIRGQIAGLAHDDQDVGAGSWPPLGA
                     ERAALEAYERQVVGEKLTQFRRFITGTVAPHAAAHPNDKWVRHIVAQLNSIESTLDLI
                     ASA"
     gene            179473..180486
                     /locus_tag="Sfla_6638"
                     /db_xref="GeneID:11353815"
     CDS             179473..180486
                     /locus_tag="Sfla_6638"
                     /inference="similar to AA sequence:KEGG:SCP1.329"
                     /note="KEGG: sco:SCP1.329 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909540.1"
                     /db_xref="GI:357409253"
                     /db_xref="GeneID:11353815"
                     /translation="MIRAGRRHLVRTLADLAAQQGVRTHSYLNAKHHLVDGFPAPIGS
                     AGARVRLYDAEQVDAFLTGQPIPPLPAHDDDQDLLDRRESADALGLSPRSWDKYKTTD
                     PLLTEHQVTVGGVEHWPRAIVNQYQARRTSKVQAPSGRPTRSGDQVPRDQLLPLTAPL
                     LDADPTITAVRVTEELGVHRDTAQDALLRLRADRIAHLMLTDPPLTPDQSAAALGYPA
                     GQVRRATVRAQAVVRAHRVAPYLADVAHALHQAGWTATAAVPDIQHPADDLVVAALVL
                     DGTSAPAPALVWDERHGWRTATSRRHPLTKGAVPPPPGDGIRYLAQGTTPPPDALTAA
                     LTA"
     gene            180591..181422
                     /locus_tag="Sfla_6639"
                     /pseudo
                     /db_xref="GeneID:11353816"
     gene            complement(181438..182703)
                     /locus_tag="Sfla_6640"
                     /db_xref="GeneID:11353817"
     CDS             complement(181438..182703)
                     /locus_tag="Sfla_6640"
                     /inference="similar to AA sequence:KEGG:SGR_1521"
                     /note="KEGG: sgr:SGR_1521 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909541.1"
                     /db_xref="GI:357409254"
                     /db_xref="GeneID:11353817"
                     /translation="MDRGEWFCAEGAVEELCQAGDFGRALSVMEPFVAAGWRAALYAK
                     AEILLRAGRRTEEALDLLRPEDSGWVSTTECRDLAEVLGKAGRIDEAIELLVPHLDKS
                     WLLSVLVDITDGQGRDERVLELIAPLVDRAREARGEVHRDYAFSDAQELQARVLERAG
                     RADEAIRILGQDIAGRRFLAQNTLIAYAELLARHGRLDELRELGGGQDAHTVLDIYAG
                     ALRSHGRVEEAEAVMRDAIAADDWVGYRAWLSSMLLAEGRLEDAIVVAEPGFGWYDCS
                     NLLAPLVHPLLDRPEELLYLVEHPRVVPHHGHEEFQHWWRAWALAGLGRVDEAITVAG
                     LDRPWTDPRIVKADLLKRAGRLDEAADELRALGTIKAREELCEILVLQGRADEAIAVH
                     PTVAEQRAAEPKPKPVPLGDNGYSLEPPF"
     misc_feature    complement(<181903..182427)
                     /locus_tag="Sfla_6640"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     gene            complement(183057..183854)
                     /locus_tag="Sfla_6641"
                     /db_xref="GeneID:11353818"
     CDS             complement(183057..183854)
                     /locus_tag="Sfla_6641"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: ret:RHE_PD00038 oxidoreductase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004909542.1"
                     /db_xref="GI:357409255"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:11353818"
                     /translation="MSTPSTRPLALVTGASNGIGYEIARLCAANGFDLVATGRSAKID
                     EAAERFTRDGAHVIPVRADLADTDEVETVWKAVEKTGRPLAAAVLNAGRSIGGAFLDT
                     DLDDELSLISLNVTSVVHLAKRVARHMAANSDGKILITSSLSATLPTPYETVYGPSRA
                     FTRMFALGLREELKEHGVTVTCLMPGATDSDFHARAGMNNTAFGTGAKKNSRKEVARQ
                     GFVAMMEGRAEIVGGDAATKRTAIEHRFLPETYKAARHATKAKPRQR"
     misc_feature    complement(183111..183845)
                     /locus_tag="Sfla_6641"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    complement(<183273..183827)
                     /locus_tag="Sfla_6641"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(183282..183287,183291..183302,
                     183378..183380,183390..183392,183429..183437,
                     183516..183518,183579..183587,183663..183671,
                     183735..183743,183798..183809,183813..183815))
                     /locus_tag="Sfla_6641"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(183378..183380,183390..183392,
                     183429..183431,183513..183515))
                     /locus_tag="Sfla_6641"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(183851..184756)
                     /locus_tag="Sfla_6642"
                     /db_xref="GeneID:11353819"
     CDS             complement(183851..184756)
                     /locus_tag="Sfla_6642"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: sro:Sros_3720 putative transcriptional
                     regulator, XRE family;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004909543.1"
                     /db_xref="GI:357409256"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11353819"
                     /translation="MAGNVDLTQFLRRCRDRIDPESLGLPERGAYRRVPGLRREEVAQ
                     LAGVSTDYYTRLEQGRSITPSDSVLDAIAEALRLDSAERTHLHDLVKTRPGRRARHAT
                     PSVQRARPGLLRFLESFSDHAAFILGRRGDILATNHLCRVLIADFDAMPYRERNLTRW
                     IVLAPEARALYVDWERIAAEMTAILRLDAGRHPDDTRTAQLVGELTMKSEHFRRWWDD
                     HRVLTRTHGQKRFHHPLVGELTIDYQALNPPGEDDQTLFLYMPAGDRTSQEAWRLLAD
                     WNTPAPGRPQPADDAPSPSDDRSSL"
     misc_feature    complement(184511..184669)
                     /locus_tag="Sfla_6642"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(184586..184588,184661..184663))
                     /locus_tag="Sfla_6642"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(184583..184585,184658..184660))
                     /locus_tag="Sfla_6642"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(<184511..184651)
                     /locus_tag="Sfla_6642"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(order(184580..184585,184595..184597,
                     184604..184606,184637..184642))
                     /locus_tag="Sfla_6642"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(185887..186927)
                     /locus_tag="Sfla_6643"
                     /db_xref="GeneID:11353820"
     CDS             complement(185887..186927)
                     /locus_tag="Sfla_6643"
                     /inference="similar to AA sequence:KEGG:SAV_746"
                     /note="KEGG: sma:SAV_746 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004909544.1"
                     /db_xref="GI:357409257"
                     /db_xref="GeneID:11353820"
                     /translation="MFIAGLGVMLGALWSVPSHAAGATVTGAGSVTRGVLAVDTDLTP
                     GVTIDLVRRSMTLSAGEKRHLRGRLEATSTTTGIVGLTQRIRCLNASGATVPVVAASA
                     RNHEGSDTTTYATPGHLPLYADLLFTAPAAGTYTCVLQGTAYSSLPGSYHLTAVASNT
                     WLESDDTDRSGARWWQNPACESDDSAGACTYLGGGAARPDAWVFYDDGTPVYKWQAHP
                     DAVSVSAQANLELTTCYQGTASCAASMEVYPRGKNAVVDARFELVQLDATGHACRTNS
                     VTARRTITDDAHHAVGYSFLTDVPIDPACGTRTFLLRIYVKHVSGQTVKIDGIQSGAT
                     SLTNGIAFNNFN"
     sig_peptide     complement(186865..186927)
                     /locus_tag="Sfla_6643"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.994 at
                     residue 21"
     gene            187618..188007
                     /locus_tag="Sfla_6644"
                     /db_xref="GeneID:11353821"
     CDS             187618..188007
                     /locus_tag="Sfla_6644"
                     /inference="protein motif:PFAM:PF03995"
                     /note="PFAM: proteinase inhibitor I36 SMPI;
                     KEGG: sma:SAV_743 peptidase inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="proteinase inhibitor I36 SMPI"
                     /protein_id="YP_004909545.1"
                     /db_xref="GI:357409258"
                     /db_xref="InterPro:IPR007141"
                     /db_xref="GeneID:11353821"
                     /translation="MTWKKRIAGTASVMLLAAGGMMATASPAAADGPCPANRLCIYDG
                     ANFTGNRIASGSTNSCFFPQDFTFDAIVSYDNNLPVDAKVYHYYADIDAYTVARTLVS
                     GGFSSNIGVANLGGAFGDLVCMGSARP"
     sig_peptide     187618..187710
                     /locus_tag="Sfla_6644"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.670 at
                     residue 31"
     misc_feature    187708..187986
                     /locus_tag="Sfla_6644"
                     /note="Peptidase inhibitor family I36; Region:
                     Inhibitor_I36; pfam03995"
                     /db_xref="CDD:252302"
CONTIG      join(CP002476.1:1..188552)
//
DBGET integrated database retrieval system