GenomeNet

Database: RefSeq
Entry: NC_016114
LinkDB: NC_016114
Original site: NC_016114 
LOCUS       NC_016114            7337497 bp    DNA     linear   CON 07-FEB-2015
DEFINITION  Streptomyces pratensis ATCC 33331, complete genome.
ACCESSION   NC_016114 NZ_ACZH01000000-NZ_ACZH01000154
VERSION     NC_016114.1  GI:357409266
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00191232
            Assembly: GCF_000176115.2
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Streptomyces.
REFERENCE   1  (bases 1 to 7337497)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of chromosome of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7337497)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/06/2014 12:35:02
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 6,695
            CDS                          :: 6,525
            Pseudo Genes                 :: 82
            CRISPR Arrays                :: 4
            rRNAs                        :: 18 ( 5S, 16S, 23S )
            tRNAs                        :: 68
            ncRNA                        :: 2
            Frameshifted Genes           :: 70
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7337497
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /collected_by="Waksman and Lechevalier"
     gene            <1..760
                     /locus_tag="SFLA_RS00005"
                     /old_locus_tag="Sfla_0001"
                     /db_xref="GeneID:11367246"
     CDS             <1..760
                     /locus_tag="SFLA_RS00005"
                     /old_locus_tag="Sfla_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=2
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041825261.1"
                     /db_xref="GI:754214624"
                     /db_xref="GeneID:11367246"
                     /translation="PGSRAVRDSELTEQITEVHARSRGTYGAPRVHAVLTREGAGCGR
                     RRVARLMQAAGLQGRHRRRRQVTTVPDPRAAFRPDLIVRDFQPGRTGLDARWCGDITY
                     IPTDEGWLYLATVIDIASRRVVGWATADHLRTDLVAEALTAACRQRRPTRPVIFHSDH
                     GCQYTSQQFASLAAGFGVRLSVGRTGQCWDNALAESFFSTIKRELLGTSAWPSRATAR
                     TAIFDFIEGWYNLHRLHSSLGYLSPAEYETALAT"
     gene            1051..1626
                     /locus_tag="SFLA_RS00010"
                     /old_locus_tag="Sfla_0002"
                     /db_xref="GeneID:11368209"
     CDS             1051..1626
                     /locus_tag="SFLA_RS00010"
                     /old_locus_tag="Sfla_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009949560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152162.1"
                     /db_xref="GI:503918168"
                     /db_xref="GeneID:11368209"
                     /translation="MDRLSEVLSSEYFCVTAVRGLPQQDLLDRLEIVVQGALQEYRLD
                     NAIEHLGFDSWGVRIYAPADTEWIYLFDVNGQTGVAHMEPVLRRLSRGTEAISVWSLL
                     DSTTHVKQARDGEVIATCSTWLFEPAAGSDPDRLNTALRHVGFFLEDEPEGFDDARAA
                     LEAVETEFGLRVEAGAVKGPLPTIFVSSQLS"
     gene            complement(1655..2953)
                     /locus_tag="SFLA_RS00015"
                     /old_locus_tag="Sfla_0003"
                     /db_xref="GeneID:11368210"
     CDS             complement(1655..2953)
                     /locus_tag="SFLA_RS00015"
                     /old_locus_tag="Sfla_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152163.1"
                     /db_xref="GI:503918169"
                     /db_xref="GeneID:11368210"
                     /translation="MLRSVFVGALTVGLLALGVPAYSQSEPVNDRVSAPSNAEPERFP
                     GGRAGAEKSNCAEAAARHKAAGSTGLYGCITEVSETEARQRSAATGAAAVPLPVNDCT
                     GNENGSWWALRLSQCQIDPDVRYTLRDKDGTIVATALFAIAQQMDLSATSLEWTETDQ
                     LVMLEASPKLPALTATWTTKCAATCSPATTAVFSKQPVKVGQLLKKTYKVADVPTKKY
                     DFLDVDYTLNFDAAGATEITPPSTWDAEVRCDDQLSVGNTSGCVVPWFTPTLNISRAQ
                     YGSSADMINWAQINLSGHWGLRSSGKPLHRLQSASEQKKNRQAICGTGKFTPDPAVEQ
                     DSCDEFPFAGTYESGALNGVDHGNACAQVTSVRKNSTGDLPFDWQTVTPIGTVTGNEK
                     CVRGHIPGPLNSYAGGAYGNFVQTARLADNDGFWLKVTSS"
     gene            3345..3599
                     /locus_tag="SFLA_RS00020"
                     /db_xref="GeneID:23391288"
     CDS             3345..3599
                     /locus_tag="SFLA_RS00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014043509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030125675.1"
                     /db_xref="GI:662754780"
                     /db_xref="GeneID:23391288"
                     /translation="MIAELVAEVGPLWHERHQARLASRQRKRAVGAGAKHRMVFVDRL
                     LATLVHLRHGVTHDVLVCWFGVDRSTVGARFLRRVSRGAW"
     gene            complement(4373..4981)
                     /locus_tag="SFLA_RS00025"
                     /old_locus_tag="Sfla_0006"
                     /db_xref="GeneID:11368213"
     CDS             complement(4373..4981)
                     /locus_tag="SFLA_RS00025"
                     /old_locus_tag="Sfla_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019885919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152165.1"
                     /db_xref="GI:503918171"
                     /db_xref="GeneID:11368213"
                     /translation="MNWWHRAHATPLATAVLIVTMLLVPLLGGSALPIPSLLAGMSAG
                     IPVALVLPAIPAAFTLYALNRVPRLYDTTAVRPVARYQVGMLTAAVLLATILGLGAAY
                     AADSSMSLAAARNLLGYLGTGLIVQYLAGHVYGPLTVAFVPVTCALIGLGPGGRPFPW
                     TWPLHEASSPIAAIASLLLLTAGIAATTLLPPRGAASRPATA"
     gene            complement(4978..6225)
                     /locus_tag="SFLA_RS00030"
                     /old_locus_tag="Sfla_0007"
                     /db_xref="GeneID:11368214"
     CDS             complement(4978..6225)
                     /locus_tag="SFLA_RS00030"
                     /old_locus_tag="Sfla_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152166.1"
                     /db_xref="GI:503918172"
                     /db_xref="GeneID:11368214"
                     /translation="MRISTLLRSGPAAWAALVLVPVLVWFSAQNTESTIAYWPSISSQ
                     TTIVVGFISAACGAGAAWEAARLRQGGITVLAPARGSLSVAVLHLGPVAVLGLIAMIA
                     PFAVIVTSVASTPGLPNPAILAVSYSVVLAHIALGWFVGARMPKLLGAATMLIFGYLW
                     GFWPAALGGLPWLRHLNGQGVTECCGLDQDPSIRSLAATVTFSLAIVAAVVLSSALRH
                     RLWRPLLSLTGFTVATTVALTLAVPLDFQGTQARDTALRTCTGQNPQICLWPEQNTRR
                     ADISHWAEETTAQLSAVGVTPARQVEFGDPQPDKTNVASNIATSPLPNEAPPCALRQG
                     AAYPGDEAMIAIYAWLSLTGGVPKSDLAQRWPLEAISLAEQIRALPTQAQHAWYERNM
                     RSVHDCAVLPDLDPASYTKAATS"
     gene            complement(6229..6921)
                     /locus_tag="SFLA_RS00035"
                     /old_locus_tag="Sfla_0008"
                     /db_xref="GeneID:11368215"
     CDS             complement(6229..6921)
                     /locus_tag="SFLA_RS00035"
                     /old_locus_tag="Sfla_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_037659995.1"
                     /db_xref="GI:739808069"
                     /db_xref="GeneID:11368215"
                     /translation="MLDGLTMDLPQGCTVLLGPNGAGKSTLLSLGASSLTPVSGRVTL
                     GRLDSVRRRDRRAFRQKVGWLPQEVKAIPALTVREQAAYVGWLKGLSKREAWDRSATA
                     LDRVRLTELGQRKSHELSGGQLRRLGIAQTLVHQAEIVLLDEPTAGLDPVQRGVFRDL
                     LAELSGSVHFIVSTHQTEDLADIYETVIVFDRGRPVFRGPVSDFFSTAPAGTPHERRA
                     ESAYRGLVRGEV"
     gene            complement(<7213..>7431)
                     /locus_tag="SFLA_RS00040"
                     /db_xref="GeneID:23391289"
     CDS             complement(<7213..>7431)
                     /locus_tag="SFLA_RS00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018586829.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030125671.1"
                     /db_xref="GI:662754775"
                     /db_xref="GeneID:23391289"
                     /translation="AVVGVLGIAPAFAQGGYTSSISGWLPGKESNHWTDGNTDSVSTS
                     VKFSGCSVDNGRFTYAGLQLKKERSGLPD"
     gene            complement(8542..9117)
                     /locus_tag="SFLA_RS00045"
                     /old_locus_tag="Sfla_0010"
                     /db_xref="GeneID:11368217"
     CDS             complement(8542..9117)
                     /locus_tag="SFLA_RS00045"
                     /old_locus_tag="Sfla_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152169.1"
                     /db_xref="GI:503918175"
                     /db_xref="GeneID:11368217"
                     /translation="MAGRWMDLGALNARGLPGADALGVAIERMVTGIASSVESERGLA
                     ARLNYLTKTDAGYEAMDRAGIHVSPRTLMAWLAEERIPNKANRSRLDAAYWDLRRRNV
                     AADLKKRLNNHGRGTRVEINPVDQTRVEGRHQRDLSSRSLNVRGVWDRAVDAWMNEDV
                     DELDAVWDDIIEDLGSEYDAYSNVSSIGWAA"
     gene            complement(9117..10679)
                     /locus_tag="SFLA_RS00050"
                     /old_locus_tag="Sfla_0011"
                     /db_xref="GeneID:11368218"
     CDS             complement(9117..10679)
                     /locus_tag="SFLA_RS00050"
                     /old_locus_tag="Sfla_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014152170.1"
                     /db_xref="GI:503918176"
                     /db_xref="GeneID:11368218"
                     /translation="MTEKLSVEALLEEARLNASIPPPAERLRLREAAKLSRAQVAETC
                     DVGRSTVANWETGHSEPAPPARLPYLRLLKGLAEIYPPDSTPAPAPGPAADPAPHPAP
                     APVPAAFTAALETLRGADGRAIESDPGPCIRCGIETTYQSTDGRPLHSGAMCQPADPA
                     VSAAPAPAVTALAPVSPTPAPVPSRPERRARSAARAQADTTALIARAVQDEAERAGGD
                     EEAALKALIKRAIPDVMHLFNETRATARYDYTAYPALPDILKKPSKKDPDQIWEARPK
                     FHHPGYSLKVPGDVKVTALDVNAAYLSALKCWLPIGKLEHHAGTDGVDPKRSGVHLIT
                     PGEWAHPHLPDPIGDRDEPGALWVTNSTLRLLQRLSGPKYGLTDAPVIHESWTSGATE
                     NFLDALRKLLSAARDEAIENRDTLTLEYVKAMYSKFISTMGESIHNREMVRPDWMHII
                     HSQAYANLWGKAYKAHQAGLDVVAMMGTDELHLTGDWRKVFTEGRGVSQMKVKHGEGK
                     ATGEYTVGTVGR"
     gene            10864..13509
                     /locus_tag="SFLA_RS00055"
                     /old_locus_tag="Sfla_0012"
                     /db_xref="GeneID:11368219"
     CDS             10864..13509
                     /locus_tag="SFLA_RS00055"
                     /old_locus_tag="Sfla_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_014152171.1"
                     /db_xref="GI:503918177"
                     /db_xref="GeneID:11368219"
                     /translation="MQGISLRPHQVEAVDSIIEGLALPLDGTVPASGRRGQVHMSTGS
                     GKTITAAVAALRMVPRGVVGVLVPTLDLLTQTVEAWRAVGHSAPAVAVCSLGADPLLE
                     ALNVRCTTNPTQLALWAGAQDGPLLVFATYASLSPQGLDDDQGDEETGAAPGALERAL
                     RGSYGQTMRPFDLLVVDEAHRTSGDLGKAWAAVHDQGRVPAVRRLYMTATPRLWEASP
                     GSAGADETGGHLVASMDDETLYGPVLFEFGLMESVERGVLARFEIDVLEIRDPQSPGP
                     DASVEERRGRRLAALQEALLKHADTTGVRSFMTFHSRTLDAMSFARALPETAAELHAT
                     DPVTYPGRVGAEWLSGEHPAAHRRMVLGRFADGIDADGWVTDLGVLSSCRVLGEGVDI
                     RGKRGVGAVVFADTRSSPVDIVQVIGRGLRQNPGEGKVSRIVVPVFLEPGEDPSDMMA
                     SPSYRPLVAVLQGLRAHDERVIERMTLGTTTARGKATSVVALDPVREEGDDGNGQEHD
                     ADEDQEQQTDTAPAGTEDSTEDDAAGIGAGHESGTEDDAAEEEHPGSGVPLLRFSLPR
                     DPGTIALFLRTRILHPDSEIWLTGYNALRHWVAEHRSAEVPLDEVVELGEERITYALG
                     AWVSEQRRAFRLGTLKAWRADLLNELGMVWSVADAGFWKNLTAARAYHAVHGSLAAPK
                     DAVVEGVAVGQWLANLRKAGGLGKDEVRAAERRAALEAIDPEWHPGWSMEWQRHYATA
                     RALLAEEGGLTEVLPGVLVHGCDVGTWVLRQRDSATWEALLPEQRERLEALGLTPLPA
                     VPAKKTTAGGAGAFERGVLALEQYRARTGTVTVPRAHIETVTIDGQEHGVKLGVFLTN
                     SKTRRAKLAADKLAVLAALGLDWAA"
     gene            complement(13771..14121)
                     /locus_tag="SFLA_RS00060"
                     /old_locus_tag="Sfla_0013"
                     /db_xref="GeneID:11368220"
     CDS             complement(13771..14121)
                     /locus_tag="SFLA_RS00060"
                     /old_locus_tag="Sfla_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_014152172.1"
                     /db_xref="GI:503918178"
                     /db_xref="GeneID:11368220"
                     /translation="MRIGEVASAAGVSTRALRYYEQQQLIVSNRSAGGQRLYTPDTVE
                     RVRWIQLLYAAGLSSRTIVEFLPCVHTGIAGPEMIARLRAERDRLDDHMRDLAATRAR
                     LDSVLTAAERSRGR"
     gene            14347..14631
                     /locus_tag="SFLA_RS00065"
                     /old_locus_tag="Sfla_0014"
                     /db_xref="GeneID:11368221"
     CDS             14347..14631
                     /locus_tag="SFLA_RS00065"
                     /old_locus_tag="Sfla_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_041825541.1"
                     /db_xref="GI:754215092"
                     /db_xref="GeneID:11368221"
                     /translation="MAVYGYARAKAGEEDRLLGEIQAIIGLTRKEDGCEQYTVHTTPD
                     QPGAFAFYERWSSGAHLLAHVSQPFMQTYFTAIAGLVEGELEAHWLHPFS"
     gene            complement(14940..15647)
                     /locus_tag="SFLA_RS00070"
                     /old_locus_tag="Sfla_0015"
                     /db_xref="GeneID:11368222"
     CDS             complement(14940..15647)
                     /locus_tag="SFLA_RS00070"
                     /old_locus_tag="Sfla_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_014152174.1"
                     /db_xref="GI:503918180"
                     /db_xref="GeneID:11368222"
                     /translation="MTARGPAPRRRPRRSPARSRKRKQAHAGGEILVGVVVIGWLFSQ
                     LMHWLAAHPWVPLLLALLAGAGAFVWFRSRVQAQALLHTQVRALRYPMAALDGLQHRQ
                     FEHAIRDLMLRDGCADAVQVGGAGDNGADVKATDPYGRRWVIQCKHRRAGLAGAAVGT
                     CDLHVLNGTGRPVHKGDVIVLVTNGRFTKPATEFARSQRLHLVDRHTLATWAAGSQPL
                     WELLRALPPPRRPTTLS"
     gene            complement(15644..15997)
                     /locus_tag="SFLA_RS00075"
                     /old_locus_tag="Sfla_0016"
                     /db_xref="GeneID:11368223"
     CDS             complement(15644..15997)
                     /locus_tag="SFLA_RS00075"
                     /old_locus_tag="Sfla_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014386356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152175.1"
                     /db_xref="GI:503918181"
                     /db_xref="GeneID:11368223"
                     /translation="MPWVRLYVRRDGTKVQGHSRWAAGGRREMSTVVMVGLAVVVLGN
                     PANSDSGSGATPRPAPTAVYPVTFPKTERTSSTPRPQPTVSYPIRFPQASKAAARPRP
                     RSTVTYPIPWDRSAR"
     gene            complement(16259..17536)
                     /locus_tag="SFLA_RS00080"
                     /old_locus_tag="Sfla_0017"
                     /db_xref="GeneID:11368224"
     CDS             complement(16259..17536)
                     /locus_tag="SFLA_RS00080"
                     /old_locus_tag="Sfla_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter permease"
                     /protein_id="WP_014152176.1"
                     /db_xref="GI:503918182"
                     /db_xref="GeneID:11368224"
                     /translation="MTFAATRPGAAPVPPGGAPNGTPGGRPSRALTAVYAAGAVTALG
                     TQMTMLALPWLVLETTGSATRAGLVFAAQVLPMALLGFVGGEVIQRLGARRTMVVSDL
                     ARAPVVALVPLLQTLGALSLAALVVIVAALGALAVPYHAAQRVLAMELLSPHARSLAR
                     ANSALEGVQHGSAFAGPALAGALIPLMGTTSVIWLDAATFAFSGLLLLRFVPAGAGGA
                     KGSAAGPRGLWAGVRHLCGDWFLSRAMLSTVVFGLMLRTLMITMPVLAFVRFEGDARV
                     GGLLIAVLGAGGLVGSMAAYALAARVAPVRLACTALVCVALPLWTLLVPVPAGVLVVA
                     VGLSSAAAPLANAPLMGLLTARLPDGFGPKVLQAVVTISTLAGPLGFLAAGAVLDRAG
                     VEATLWGVAALATFGSGNLILALRRLQATGNPG"
     gene            17783..19762
                     /locus_tag="SFLA_RS00085"
                     /old_locus_tag="Sfla_0018"
                     /db_xref="GeneID:11368225"
     CDS             17783..19762
                     /locus_tag="SFLA_RS00085"
                     /old_locus_tag="Sfla_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acylaminoacyl peptidase"
                     /protein_id="WP_014152177.1"
                     /db_xref="GI:503918183"
                     /db_xref="GeneID:11368225"
                     /translation="MSSGIGTAVHVPSFAARDGRRAVETRYVDGLPQIVAWDLTTGQR
                     RQATTAPLGVETAAIEPDGHGLWWFDASAGGQGSWLRGPFGGGHPRPALDGVPAGRMY
                     GLAFDPRSGLAAVGVGVGVGVADHSEYYLGRPGEHARLVAEEPGYGAVVGLAPGGRLL
                     ATAGYPAGPAAVRLWSPASGALVDTVPGAAGDDDGGAVWALGFRPDLTTARPELLLVL
                     ERAGRYTLASWLQGEGIRTHGPGSALDFDTEITACWYGPGRTALVQQDRAGRSRLLRA
                     DLDRGTTRVLPTPEGTIIDFSCAPDRTVHCLWSRDGEPPRPLICPPESLEGSESTEHP
                     EPPEHPDHSGRSDRSGQCGHSDRSTTASHGTAPGGTTGSRRRELWTRRPYGQIHSFVA
                     TPPGRTTDHRPWPTVFLVHGGPHTHDRDAYDTRTEALVRAGFTVVRTNYRGSTGYGPR
                     WRDDFGHRVGLAQLEDLAAVRGHLIDAGVSEPGRTGLCGYSWGGYLTLLAMGVQPRLW
                     DVGLAVAPVADYTAAYRATTPALREVDDRLFGGTPEQVPHRYRAACPMTYVGRVRGPL
                     FLAASADDEKCPPEQIERYLAALRHRDVPHRIRWLGGGHDVGRAPSGHAAAWAAMVRY
                     ADDTLRASPKTAGRRTSGRTGLHHPVHHTEERPTP"
     gene            20046..21209
                     /locus_tag="SFLA_RS00090"
                     /old_locus_tag="Sfla_0020"
                     /db_xref="GeneID:11368227"
     CDS             20046..21209
                     /locus_tag="SFLA_RS00090"
                     /old_locus_tag="Sfla_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_014152179.1"
                     /db_xref="GI:503918185"
                     /db_xref="GeneID:11368227"
                     /translation="MLHSDGGLRLWIVPRYADVRAALSDHRFAQDVRRAQALADSRVE
                     GVNLGAEITHMLSSDPPDHTRLRRVVQAAFSRKRVQEMRPMVERITLELLDELDPAAA
                     RHTTRTTTATATATATATVDLIRDFAFPLPILVVCELLGLPPQDRNLYREWSTAIVTQ
                     EGDHTAFQQAVHDMGSYVLAIADQRIRRNDRPADLLTDLLAARERGELTDDEIVGMVA
                     LLLIGGHETTVNLLGTSCLALLRNPDQTAWLRADPTRMPMAVEEFLRYDSPICMATTR
                     FTTQPVDIGGVEIPQDEFVLLSLGAANRDPARFQDPDRLVLNRQDTGHLAFGGGIHRC
                     LGALLGKLETEIALTALLARFPGITLACQEHDLRWRNTMMLRGLETLPLTLNR"
     gene            complement(22230..22553)
                     /locus_tag="SFLA_RS00095"
                     /old_locus_tag="Sfla_0021"
                     /db_xref="GeneID:11368228"
     CDS             complement(22230..22553)
                     /locus_tag="SFLA_RS00095"
                     /old_locus_tag="Sfla_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152180.1"
                     /db_xref="GI:503918186"
                     /db_xref="GeneID:11368228"
                     /translation="MSAIRPWGQAKLAGGHVAAIEVLVDLLVCAVLLLASVGVIGTEP
                     TTRAEETAAWQSAGQLYFGWLVVGATSLALLRMPKALLAHVSTMLLSPIALFVLLLLL
                     SSGRG"
     gene            complement(22895..23422)
                     /locus_tag="SFLA_RS00100"
                     /db_xref="GeneID:23391290"
     CDS             complement(22895..23422)
                     /locus_tag="SFLA_RS00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019984189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825262.1"
                     /db_xref="GI:754214627"
                     /db_xref="GeneID:23391290"
                     /translation="MDGRYRPPTELAEHVTTASEARLRTVLATQMCSLAAETGLDTYP
                     EVIEALHRAGQDECHGVDDDSPLGIRLRTVFADAAAAWSLPRDDEGHLLIDLSERDAW
                     QHRANAAGALPDALSLPAREVIGSVLHQRRNPDWRAEFTEQLGEALHEHRGAPPHQRQ
                     VRTPTAHARRRRSTQ"
     gene            complement(<24644..25351)
                     /locus_tag="SFLA_RS00105"
                     /db_xref="GeneID:23391291"
     CDS             complement(<24644..25351)
                     /locus_tag="SFLA_RS00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152183.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041825542.1"
                     /db_xref="GI:754215093"
                     /db_xref="GeneID:23391291"
                     /translation="MHFFTASGGTYGSPRITLDLWAEGWQVSVNTVAEIMAELGLRGR
                     KPPRRRSLTRQGKRKAAPDLVNRRFDAVAPDVLWFGDMTEIETGEGKVYLATVIDAFS
                     RRCLGYAMGEHHDAALVGASLKMATTTRGGRREGTIFHSDRGSEYTSGTYNTLCDRLG
                     VVQSMGRVGSALDNAAAESFNSLIKVEYIHRRRFATRTEARLKIGTWIIGFYNPRRRH
                     SAAGGLPPEEFEQIITEA"
     gene            complement(25534..25875)
                     /locus_tag="SFLA_RS00110"
                     /old_locus_tag="Sfla_0025"
                     /db_xref="GeneID:11368232"
     CDS             complement(25534..25875)
                     /locus_tag="SFLA_RS00110"
                     /old_locus_tag="Sfla_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041825263.1"
                     /db_xref="GI:754214628"
                     /db_xref="GeneID:11368232"
                     /translation="MGSKKKPPYDAEFREGAVRIVVETGRPAGEVAEELGINPGTLHS
                     WVSRWRRNGTTSSDRPVRPAAASGGGRVREAERAELERLRREMTEKNKRIRELEMERD
                     VFKRCMALWVK"
     gene            complement(25955..>26340)
                     /locus_tag="SFLA_RS00115"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391292"
     gene            complement(27171..28376)
                     /locus_tag="SFLA_RS00120"
                     /old_locus_tag="Sfla_0028"
                     /db_xref="GeneID:11368235"
     CDS             complement(27171..28376)
                     /locus_tag="SFLA_RS00120"
                     /old_locus_tag="Sfla_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_014152185.1"
                     /db_xref="GI:503918191"
                     /db_xref="GeneID:11368235"
                     /translation="MPPRHQRNLSRRKLITALAGAAVAVPAAAVIAPHALATKDPAEG
                     NSKAAGALPLTIVNNSGSFANTSVRVYVVGNQDGRQVRLTPEGTLAPISLSDNGADGF
                     TDYSIPLSGGGETTLSLPYMSGRIYVALGDKLKIKAVADGNGNAALQYPAGWVTSDPN
                     YTVLHDCAEFTYNAAGMFCNTTMVDMFSVPMSIGLTGAKNQTTGSLRDGGRAQAFAAV
                     SRIPEFADLVLDDRRIVAPGHGLDSGIFAEDYFDPYIDEVWSTYTGKDLTVTTNAGTF
                     TGRVRGDRFVFDGPASVSFDRPSTRDVLFCDGKLAAPNDGTTGPVAAVLGAGFNRSTL
                     ISDPAQPTADPAAFYRSSQITNHYSAAIHAATEEGKAYGFAFDDVADFASYIQDTAPK
                     GARLTLTPF"
     gene            complement(28435..29700)
                     /locus_tag="SFLA_RS00125"
                     /old_locus_tag="Sfla_0029"
                     /db_xref="GeneID:11368236"
     CDS             complement(28435..29700)
                     /locus_tag="SFLA_RS00125"
                     /old_locus_tag="Sfla_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,3-beta-glucanase"
                     /protein_id="WP_014152186.1"
                     /db_xref="GI:503918192"
                     /db_xref="GeneID:11368236"
                     /translation="MAAHRARRWSLGGLVLLLSAVLAATFLVSTTGPATSRANAAGPQ
                     VWADEFDGSAGSAPDRSKWTLETGGSGNGNNELQYYTDDSRNASLDGRGNLVITALKN
                     SDSGLRCWYGTCQYTSARLNTAKTFTQAYGRYEARIKIPRGQGIWPAFWMLGDDLGSV
                     GWPNSGEIDIMENVGHEPGTVHGTIHGPGYSGGGGITASHTLPNGKAFADDFHTFAVD
                     WSPNAITWSVDGQIYQTRKPDDVNGKKWVFDHPFFIVLNLAVGGNWPGSPDGATSFPQ
                     TMTVDYVRVSASDSSDGGSRTGAIKGIGGMCVDVAGASGADRTPIQLHNCTGVDAQKW
                     TLGSDGTVRALGKCLDVQGGSTAPGAVVQLYACNGTKAQQWAHTTARDLTNIGADKCL
                     DAKGNSSADGTRLQTWTCTGAANQKWTVR"
     gene            30420..30998
                     /locus_tag="SFLA_RS00130"
                     /old_locus_tag="Sfla_0031"
                     /db_xref="GeneID:11368238"
     CDS             30420..30998
                     /locus_tag="SFLA_RS00130"
                     /old_locus_tag="Sfla_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152187.1"
                     /db_xref="GI:503918193"
                     /db_xref="GeneID:11368238"
                     /translation="MSAPIVIHHPSPAGGRQVTICGRIAGLAYDDHDLLEFLRRAGLP
                     DAKQLLDRNGWSSEAGGRTRTWQRSGALVLERDARDLSLPHVLTRGPESSSLAGIGRG
                     SPVLTGHGGWAAARGEVRTGRTGRCRGGSRPPGPEVRRLITGTIAPHAAPDPHDKRVR
                     HIVAQLNSVEPNLDLIARGKGGHDAAETTPES"
     gene            31173..32807
                     /locus_tag="SFLA_RS00135"
                     /old_locus_tag="Sfla_0032"
                     /db_xref="GeneID:11369358"
     CDS             31173..32807
                     /locus_tag="SFLA_RS00135"
                     /old_locus_tag="Sfla_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008734319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_030639038.1"
                     /db_xref="GI:664101359"
                     /db_xref="GeneID:11369358"
                     /translation="MVRCLENEGVEVVFGVPGEENIRFTNALARSEKIRYVLTRHEQA
                     ASFMAEMHGRLTGSAGVMSATLGPGAINLMLGVADAMTNSTPVVAITAQVGKERNYKE
                     SHQFVDLVSMFAPVTKWSADVPATQAIPEMVRRAFKTAESERPGAVYLAVPEDVDGAT
                     DGSDLRPLRRDVVQPEAPSPKQIERAVELLREARRPVLLAGHGAARGGAGESLTAFAT
                     ALDVSTATTFHGKGVLPDDHPCATGTFGFMRRDYTNFGFEEADVVIAVGYELQEFDPS
                     RINPDGDKKIIHIHRFPAEVDDSYSVDVGIIGDISASLDALATALDGLRWTIDDEDTT
                     ATRALLAKELAQGAADERYPLAPQRIIADTRAALGRDDIVLVDTGALKMWMARLYPTY
                     APNTCIISNGLSTMGFSLPGALAVQLARPQTKVLAAVGDGSFLMHSQEIETAVRENIP
                     LTVLIWEDNGYGLIKWKMDLEVGENSNTDFGNPDIVQYARSFGAKGYHIESAGDLLPT
                     LREALADPGVSIINCPVDYAENMNLIEHLGHLDSAL"
     gene            complement(32863..33078)
                     /locus_tag="SFLA_RS00140"
                     /db_xref="GeneID:23391293"
     CDS             complement(32863..33078)
                     /locus_tag="SFLA_RS00140"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825264.1"
                     /db_xref="GI:754214630"
                     /db_xref="GeneID:23391293"
                     /translation="MTDVTSPHECVVCRTHYALPDITDCPAHDGPICSLDRQCGDVCR
                     KEPTAGPVLLPVPQLRPSSGRGAAREA"
     gene            complement(33071..33262)
                     /locus_tag="SFLA_RS00145"
                     /db_xref="GeneID:23391294"
     CDS             complement(33071..33262)
                     /locus_tag="SFLA_RS00145"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825265.1"
                     /db_xref="GI:754214632"
                     /db_xref="GeneID:23391294"
                     /translation="MLVASAVSITAFLGAFGPYAQAFSTFLACGLSLVLCPLIGWLTK
                     GRFHLERTNTVNGPGAGRD"
     gene            <33374..>33819
                     /locus_tag="SFLA_RS00150"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391295"
     gene            33787..33969
                     /locus_tag="SFLA_RS00155"
                     /db_xref="GeneID:23391296"
     CDS             33787..33969
                     /locus_tag="SFLA_RS00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_037659933.1"
                     /db_xref="GI:739808007"
                     /db_xref="GeneID:23391296"
                     /translation="MIVTSNKPFGRWGEVFGNNTVATAMIGRLVHHAEVISLKGDSYG
                     MRGATSDGVPAANTRE"
     gene            complement(34304..35818)
                     /locus_tag="SFLA_RS00160"
                     /old_locus_tag="Sfla_0035"
                     /db_xref="GeneID:11369361"
     CDS             complement(34304..35818)
                     /locus_tag="SFLA_RS00160"
                     /old_locus_tag="Sfla_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_014152189.1"
                     /db_xref="GI:503918195"
                     /db_xref="GeneID:11369361"
                     /translation="MRARNIGASAAAALALVAARDLVQKKHALLRNFPVVGHARYLLE
                     RIGPELRQYVVTSNDEERPFSRDQRSWIYASAKEENNYFGFGTDNDVEHVQGHAYVKQ
                     RTFAGRLPDLRDAQAPLPSAKVLGGPRGRAKAFRPASVVNISAMSFGSLSGAAVTALN
                     KGAALAGTMHNTGEGGLSPYHLNGGELVLQIGTSYFGCRNEDGTFNLDKLKSVVASGP
                     VKAIEIKLSQGAKPGLGGMLPGVKVTDEIAGIRGIPAGKDCASPSRHTAFHDVDSMLD
                     FVELLATETGLPVGIKSAIGEMGFWEELATLMERGDRGVDFVTIDGGEGGTGAAPLIF
                     ADSVSLPFRMGFSRVYSVFAERGLTDDITFIGSGKLGLPENAVVAFALGVDMVNVGRE
                     AMLSIGCIQAQKCHTDACPTGIATQDPWLTRGIDAPSKAIRAAMYLRTLRRELLRVSG
                     AVGVAHPSLITPTDIDILNGDYEARTLASVYDYKDGWGSLGPKLADEIAELLTA"
     gene            complement(<36627..>36953)
                     /locus_tag="SFLA_RS00165"
                     /db_xref="GeneID:23391297"
     CDS             complement(<36627..>36953)
                     /locus_tag="SFLA_RS00165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019074440.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease HaeIII"
                     /protein_id="WP_038273327.1"
                     /db_xref="GI:740441415"
                     /db_xref="GeneID:23391297"
                     /translation="LVAVELPLDRAPHEELVTAVLAWKEPNLTPRDYEQIVLQLTGHA
                     HAVAADVQRHAAALPKNDGRGALAEGILREAAGHLSQPIQGTARCAQNRARLVRALYE
                     RLDRLQA"
     gene            36868..37101
                     /locus_tag="SFLA_RS00170"
                     /db_xref="GeneID:23391298"
     CDS             36868..37101
                     /locus_tag="SFLA_RS00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011039482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015580289.1"
                     /db_xref="GI:505393187"
                     /db_xref="GeneID:23391298"
                     /translation="MRFGSFHARTAVTSSSCGARSSGSSTATRLTGADQFRLLGLCRL
                     YAEGSTLRSLRQADVPIGTRQRAVLETAAANLA"
     gene            37789..38761
                     /locus_tag="SFLA_RS00175"
                     /note="5,10-methylene tetrahydromethanopterin reductase;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391299"
     gene            38883..39929
                     /locus_tag="SFLA_RS00180"
                     /old_locus_tag="Sfla_0038"
                     /db_xref="GeneID:11369364"
     CDS             38883..39929
                     /locus_tag="SFLA_RS00180"
                     /old_locus_tag="Sfla_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014152190.1"
                     /db_xref="GI:503918196"
                     /db_xref="GeneID:11369364"
                     /translation="MTGSTERRLVVPERPVSPGHEGEFEARALRAETSARFAGAVAAM
                     ESGRLLFPLPGSGRTAERFAALKAVAEDDLCLARLVEGHVDAVAILAELDGPAAEPGS
                     RWGVWAAEPPGEGLSATRQPDGGWTISGLKQYCSGAHSCTHALVTARVKDGRRLFAVS
                     LSDTSYEPLEGTWRALGMAGSDTPDVRFHEAPAEPVGAVEDYVNRPGFQHGGIGVAAC
                     WLGGARAVARPLYAAAARGSDPHTTAHLGAVDIDVHAAELTLNAAATAIDTDPLDSKG
                     EARQLSLRVRGLVEAVCGRTLDHVGRATGAGPLCHDQRHARNVADLTVYIRQHHAERN
                     LAELGALLSEGEGL"
     gene            39926..40696
                     /locus_tag="SFLA_RS00185"
                     /old_locus_tag="Sfla_0039"
                     /db_xref="GeneID:11369365"
     CDS             39926..40696
                     /locus_tag="SFLA_RS00185"
                     /old_locus_tag="Sfla_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="WP_014152191.1"
                     /db_xref="GI:503918197"
                     /db_xref="GeneID:11369365"
                     /translation="MSTRSDDPPPYANPIQAPGTAEGLWAAWSGWDAMHEFPLPAAGS
                     VVVVAAHPDDEVLGFGGTLARLSDLGHQMTVVAVTDGEGSHPHSRVLRPHELAAIRSE
                     ETRAALGRLGAGHADVVQLHIPDSQVARYEDDLCKALAPLCRGAALVAAPWSGDMHSD
                     HEAAGRATRAAAQAVGASFVEYPIWLWHWAQPGDPRVPWSRAAQLPLNLEVQARKRHA
                     VDAFASQILPLGPGAQDAAILPPEEIAHHLRPREVVFQ"
     gene            40693..41310
                     /locus_tag="SFLA_RS00190"
                     /old_locus_tag="Sfla_0040"
                     /db_xref="GeneID:11369366"
     CDS             40693..41310
                     /locus_tag="SFLA_RS00190"
                     /old_locus_tag="Sfla_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014152192.1"
                     /db_xref="GI:503918198"
                     /db_xref="GeneID:11369366"
                     /translation="MSTPAEYFEGMYAGRSDPWHLQERWYEHRKYALTVGSLPRPRFR
                     RAFEPACSVGQLTRLLAQRCDEVVAADRVESAVATARRRTADLSHVAVSRLTVPQEWP
                     EGTFDLIVLSELLYYFDGRRLDELLSRATASLDAGGTLVTVHWNHPVQEHLYTGAQLA
                     ERLSREPGLVLDVDHTEEDFVLQTFSRVLPGEDPPLSPAGFEGLL"
     gene            <42322..42567
                     /locus_tag="SFLA_RS00195"
                     /db_xref="GeneID:23391300"
     CDS             <42322..42567
                     /locus_tag="SFLA_RS00195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020423009.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037815829.1"
                     /db_xref="GI:739965561"
                     /db_xref="GeneID:23391300"
                     /translation="AADTPEPLDDPVIALIKRGQAEGAFDPDVTPAWIQRVLWSLVYT
                     GYQDAEACGLPRHGIVSAVIRTLENGIRTPNPEHRQV"
     gene            42820..43599
                     /locus_tag="SFLA_RS00200"
                     /old_locus_tag="Sfla_0043"
                     /db_xref="GeneID:11369369"
     CDS             42820..43599
                     /locus_tag="SFLA_RS00200"
                     /old_locus_tag="Sfla_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_030125788.1"
                     /db_xref="GI:662754956"
                     /db_xref="GeneID:11369369"
                     /translation="MDFPRALRELRTRRHLSQLDLALRAGTTQRHLSFIESRRSDPGR
                     NMVVRLAEALELSLRERNELLLAAGYAPAYPESSLDDQALAPVRAAIDHILRGHLPYP
                     ALVVDGAGDLIAANTAFDLITEGAAAELVGPGRNIYRLALHPEGLAPRIRNLAEWARH
                     ILARLGHLEELHAELVGYVPELERCAGLLGFAVPLRLQSSYGELNLMTTVTTFATAVD
                     VTLSELKLEAFLPADPATAGALTAAARAAASAEAGQAPGNM"
     gene            complement(43578..44000)
                     /locus_tag="SFLA_RS00205"
                     /old_locus_tag="Sfla_0044"
                     /db_xref="GeneID:11369370"
     CDS             complement(43578..44000)
                     /locus_tag="SFLA_RS00205"
                     /old_locus_tag="Sfla_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152195.1"
                     /db_xref="GI:503918201"
                     /db_xref="GeneID:11369370"
                     /translation="MIEIDPQYLAHRYMAQWTVADGVERRVAIEQLWSEDATHTLQPP
                     AEIREIAAQLGFANTTLEAQGYDAIETRVARSYERFVETGGLTFRARADAVRLHGVVK
                     FGWETVSTETGDVVGGGMEILVLDDDGRIKADYMFPGA"
     gene            complement(44667..44999)
                     /locus_tag="SFLA_RS00210"
                     /old_locus_tag="Sfla_0045"
                     /db_xref="GeneID:11369371"
     CDS             complement(44667..44999)
                     /locus_tag="SFLA_RS00210"
                     /old_locus_tag="Sfla_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152196.1"
                     /db_xref="GI:503918202"
                     /db_xref="GeneID:11369371"
                     /translation="MHVTTLIDATTAWIIPDGEIDQGALPKLHAVLEALPQDVTELVW
                     DLQSTPFMDMAGLHLLVDPQPPTHPRHITVTGMHPQPLHLLHTAAQVFPTLGFTELLP
                     DARAHEAA"
     gene            48194..49543
                     /locus_tag="SFLA_RS00215"
                     /old_locus_tag="Sfla_0049"
                     /db_xref="GeneID:11369375"
     CDS             48194..49543
                     /locus_tag="SFLA_RS00215"
                     /old_locus_tag="Sfla_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152197.1"
                     /db_xref="GI:503918203"
                     /db_xref="GeneID:11369375"
                     /translation="MSEGALGARLSAAIGRGDADAVRGLLECGADPNTAFVDGLSAMC
                     AAISAFDTEVVSALVEGAADPSLVQPDGSTPLERAVDAGSPEAVMALLSDDVVLRLST
                     AAREGLLDSARRWYSNGVVEELRRLTGACGPVGSVRMPDDGYNYVDQVSSGGRTVRAG
                     HGSILTALEWSFRVPTPVDAIIDRAVRTDEDHVDWWTACWTLSRQRNQETWSAVVAHR
                     FHPDRAHRRFVTLYLQLLNWAVGETPFRSQESGDLLAVWALEEADGAVLARVLDTYTD
                     HEHPLLESVGLQLCSHPDPRVREQVPYALVEEFVVASAAARAALAALVHDPVPEVRMA
                     ACRVGRRYSGLLPDITLSLLALATDPDPSVRLAAAEQLALSSDRSATVADTLADLLDE
                     EDQLIRLEAAYGLVLRDDPRTAEAIDRVGELGPGFEHDHRASALWAWRWQRNRPTAR"
     gene            complement(49804..51156)
                     /locus_tag="SFLA_RS00220"
                     /old_locus_tag="Sfla_0050"
                     /db_xref="GeneID:11369376"
     CDS             complement(49804..51156)
                     /locus_tag="SFLA_RS00220"
                     /old_locus_tag="Sfla_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_041825266.1"
                     /db_xref="GI:754214634"
                     /db_xref="GeneID:11369376"
                     /translation="MPPGPGTLAHSRALRFWLDPANLDQAGPVVRTRTGPATAYQVND
                     PALLRKVGSDENTFRFWGPDPSLRDFTENGVVGIEGAAHRERRTVMRPAFTASRLTAL
                     GPEVQARTLSLLADLPADRPLDMRVEMSRLACGLLVSCILNSELAPGTLSKIAAARST
                     LSGGIFWRYALAPWPWVPVPRRRASSRALTELDEAVHEVRDRHRPDPDGQDLVSLLEA
                     AAPGNPHVVLRDIRALLIAGMETSASTLSWACYELGRYPHYQQALQDEADAAPDTSRL
                     QADQLPLATAFVQEVTRLHGIPFLVRRTRHETCQGGVRIPAGAVVTLPLGALRRDRNR
                     YPDPDVFDPQRWLPNAEPPSAPAALLAYGLGPRYCPGAAAADAMLPVALATLASSRTL
                     RPARPGRRIGVSLELTPTPKGLTMYATPREPRTADTRPTPGANIDSRSGVVSTTDAQA
                     "
     gene            complement(51336..51767)
                     /locus_tag="SFLA_RS00225"
                     /old_locus_tag="Sfla_0051"
                     /db_xref="GeneID:11369377"
     CDS             complement(51336..51767)
                     /locus_tag="SFLA_RS00225"
                     /old_locus_tag="Sfla_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011422605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825267.1"
                     /db_xref="GI:754214635"
                     /db_xref="GeneID:11369377"
                     /translation="MVGAVERDALSVTAAASGGAAGLIALNTAYPTFAQAVMTQVLTQ
                     GGHTVVTAVVGKVAGKGGGKMAAKLTKPLLQMKAHATALKFSLMLGSKAVTGIVPFLG
                     AVAGGAINAHFVNKFADAAETYYRAKLAYPGGPAGDVRVPV"
     gene            complement(51737..52069)
                     /locus_tag="SFLA_RS00230"
                     /old_locus_tag="Sfla_0052"
                     /db_xref="GeneID:11369378"
     CDS             complement(51737..52069)
                     /locus_tag="SFLA_RS00230"
                     /old_locus_tag="Sfla_0052"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152200.1"
                     /db_xref="GI:503918206"
                     /db_xref="GeneID:11369378"
                     /translation="MAADITAEMFLKAFNSVGGDSSAAARAVTNYKTLSGWRASQIAQ
                     AAAAGAAAMAIPVAHIATLAADFAVLLRKMAVCAWGIGHKLCAVVEAEEDLAIILGLW
                     SGRWNGTP"
     gene            52276..52464
                     /locus_tag="SFLA_RS00235"
                     /old_locus_tag="Sfla_0053"
                     /db_xref="GeneID:11369379"
     CDS             52276..52464
                     /locus_tag="SFLA_RS00235"
                     /old_locus_tag="Sfla_0053"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="WP_014152201.1"
                     /db_xref="GI:503918207"
                     /db_xref="GeneID:11369379"
                     /translation="MDLFHLSDALLSHLTDLVPYVQFVAAAGGAVAAVRRAARAGRRR
                     LNARRAPNTGTSRPTVAD"
     gene            <53005..55070
                     /locus_tag="SFLA_RS00240"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391301"
     gene            complement(55492..56715)
                     /locus_tag="SFLA_RS00245"
                     /old_locus_tag="Sfla_0056"
                     /db_xref="GeneID:11369382"
     CDS             complement(55492..56715)
                     /locus_tag="SFLA_RS00245"
                     /old_locus_tag="Sfla_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013223331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152202.1"
                     /db_xref="GI:503918208"
                     /db_xref="GeneID:11369382"
                     /translation="MNYEYEMSYALPDSVEGLLQRGRGLGAVRALRAPRESAAFVYDG
                     IRRDWLWDQSDERSVYLARLVCDLDLSPMPVVNMLAGDEEACLRACGVLELLALAGSV
                     EAKDGLRAYVRKGEHWVRVLERMSVGWPPEWWEDLGDVARVRMSAEAELPWHSEPWTR
                     FGIAVQSQPLVPRPSLNGLSTAELLRLLSGSHTGDHTKIDALRALNARKPAEELIPLV
                     PWLGMSNDLRPLPMLGRAVRRLGTLAVPAAHSWAQAERPWLALLGTEILADHPGPEAL
                     PGLVNELAEQWAAQDWCGPGQTARRLARFGPDAAGAVPYLRRFWLHTPHSYERTAYLQ
                     ALAAISGDDGLEHIYTESLWDCQKTTRLLGITSAPTIPETLDRLAVLRDDPMETTEVR
                     AAAGTRLAAPDGRLS"
     gene            complement(57162..58904)
                     /locus_tag="SFLA_RS00250"
                     /old_locus_tag="Sfla_0058"
                     /db_xref="GeneID:11369384"
     CDS             complement(57162..58904)
                     /locus_tag="SFLA_RS00250"
                     /old_locus_tag="Sfla_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_014152203.1"
                     /db_xref="GI:503918209"
                     /db_xref="GeneID:11369384"
                     /translation="MDLGRGTWRRLTAVALVMAVAAGCTRQGESAGGGNDEDLLRNHD
                     WTRMPGTIARNDILRISALDRHIVEQDSSGGQPNPPLNLAGPHLRSDGDFTVTARMSG
                     VGDGGGDSWLRLYGQVPVIYDEWRQERPSLRVGVTAGGRVKVQIWDGEGDEPVTSKEF
                     DCGCSGTVTVAVSSIGDTFRLKADGRRLGTVQDPGVFAEGTVWFGLEADASTHERREG
                     WRLTQLIARAESGDSLRVIKAPQLRQEQSDDSLRARAAEVGRPFDVGTALAENPLLTD
                     SRYRSLAGSQFSMLTPENAFKPQFLHPRRGVYDFRDADLLVRFARANDMKVHAHTLVW
                     HEALPDWMRENDDPEEVRRTMLRHIATVAGHFKGKVAEWDVVNEPMSDDEKSYTNGDL
                     GLRSEQSPWFEAMGEEYIDEAFRAAHRADPQARLFLNEYGVEEEGERWDALYDLVTRL
                     KERGVPIDGVGFQNHEYAPGDRIDPETFRSHVRDLAELGVQARVSEMDVPVGEDEEDG
                     RQIQADEMAGKLRVCLEEPNCTSFSTWGFTDRYGSTADTKIYPPRTADSLPWDAALRP
                     KPAYERLLDAFDEA"
     gene            complement(59406..60488)
                     /locus_tag="SFLA_RS00255"
                     /old_locus_tag="Sfla_0059"
                     /db_xref="GeneID:11369385"
     CDS             complement(59406..60488)
                     /locus_tag="SFLA_RS00255"
                     /old_locus_tag="Sfla_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_014152204.1"
                     /db_xref="GI:503918210"
                     /db_xref="GeneID:11369385"
                     /translation="MNYSRTRELDVVVIGAGQAGLSAAYHLRRIGLLPGENFVVLDHA
                     PRPGGAWQFRWPSLTYGKVHGMHSLPGMELTGADDDRPSSEVIGAYFEAYERRFDLQV
                     HRPVEVSAVREGQEGRLLVETSKGTYASRALISATGTWDRPFWPRYPGQETFKGRQLH
                     TADYPGPEEFAGLKVVVVGGGASGTQHLMEIAEVAAETYWVTRRPPVFREGPFGMKQG
                     RAAVAMVEERVRRGLPPQSVVSVTGLPLNDAVRRAREQGVLDRLPMFERITPCGVAWA
                     DGRSVEADVILWATGFRAAVDHLAPLRLREPGGGIRVEDTRAVRDGRVHLVGYGPSAS
                     TIGANRAGRAAARSVSRLLESHGVPA"
     gene            60574..60996
                     /locus_tag="SFLA_RS00260"
                     /old_locus_tag="Sfla_0060"
                     /db_xref="GeneID:11369386"
     CDS             60574..60996
                     /locus_tag="SFLA_RS00260"
                     /old_locus_tag="Sfla_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152205.1"
                     /db_xref="GI:503918211"
                     /db_xref="GeneID:11369386"
                     /translation="MPDTFTTHVLNVTTGRTETVLDLTDDCTQFLARASHGRDGLLNI
                     FVPHATAGIAILETGAGSDDDLLTALQTLLPADDRWRHRHGTPGHGRDHVLPALVPPH
                     ATLPVLRGRLELGTWQSVCLVDTNVDNRDRQVRLSFLG"
     gene            63260..64144
                     /locus_tag="SFLA_RS00265"
                     /old_locus_tag="Sfla_0062"
                     /db_xref="GeneID:11369388"
     CDS             63260..64144
                     /locus_tag="SFLA_RS00265"
                     /old_locus_tag="Sfla_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152207.1"
                     /db_xref="GI:503918213"
                     /db_xref="GeneID:11369388"
                     /translation="MTTGEAHVDKSRWPKDVPDSGLTKGLALPLESYMVPYSDQVVID
                     SALRDLQTECMSTYGFTVNLPRPGVHPPASSNSMNIERRYGITDRAEAEKYGYLLSPE
                     QQKYTAQQAPDLPGIQVEVLTGHTRPEPVEAPVGSDVGYSGVGENTKPARAEYKGRKL
                     HKDGCAGWSKRQLELNESDAGFVTQLASTGLSETRPHKSVEQAVKRWSACMKDKGRKA
                     SDPYRAMEQGLVETDTQDSIALALDDIDCKEQTRLIEVWFKEESAVQKRLIKENKDQL
                     DVVKTRTRDVLTAAKAVK"
     gene            64209..68672
                     /locus_tag="SFLA_RS00270"
                     /old_locus_tag="Sfla_0063"
                     /db_xref="GeneID:11369389"
     CDS             64209..68672
                     /locus_tag="SFLA_RS00270"
                     /old_locus_tag="Sfla_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152208.1"
                     /db_xref="GI:503918214"
                     /db_xref="GeneID:11369389"
                     /translation="MVATALAIPLGLPAQAEEPKPPADAAQGWSDATRSQEEFSPEPS
                     AIPVKDRVRILGEDYEKSSDTAVTTSGDGTGFHVLAGKEEDGYQLRTVASLFEDGFAS
                     DTWIGNHCVTGSGRYAAVSYAPRMFTNKPELMVRGAFTAVVDLESGKVTKLPFQSSLA
                     YFSPGCGQGDQAVFTQLTHDGDEKQQTRLISVDAATGKQRQPVTLAGQVTSAIPTAEG
                     IVAAHGNKVVRINGRTEKPLATTRAVPFQITADAEGGITYIDRELDKDASRTPTSWAE
                     HLAPTAVARGKEAEPVTVATGRLNAWDLTRSARGEVFVTGNATSKTLPARIHNPGKLP
                     TGAAISSNAQAALTTTWSDGKTTLVNPEDAAKPRPARTTLRMLDSGTSVTLDLRPGVN
                     RVSKVSEGHALSPALPGGGPLASGPYGSEATGQAGEDKAGEGISTQSFRTQALTAQSD
                     SPSEGTGERYCAVARNDAKKQAFQPTPRQVEWAVNQAVVGELNFYRSSNWKNTGTGGY
                     QPQGLFPATVLAGDPNGTLDNEDPDVTDKWHIPAQVMLGITAQESNMWQATRFAVPGV
                     TSNSLIGNYYGVDYAPDGEQLDPWKINWADADCGYGITQATDGMRLAGKTKPGETALS
                     TLAQEAVALDYTANVAAGVRILSEKWNQTYSAGMKINGGHPKWIENWFFALWAYNSGF
                     YDSVDSAGHWGVGWTNNPANPLWKANRVPFLQSATNNAGDDYSHAAHPQDWPYQEKVI
                     GWAARPISAMFAPGDFQAGYRPAWWTTNGDRANAKPPVDLFCDSSNSCVSSKIGDNDS
                     NDPGMGACSLDAGNSDTNPHWLHCWWHEEITKEQWKDCERLAECGNGVHRFSTSYGEQ
                     ADAGSYPPNCSIGSLPTNALVVDDLPDGVTPAGVDTARGCGAVKSSGTFNFTFVPWDT
                     KMDLTDDDTDNPTTVTTYPGKIDTHQIGAGYGNHFWFAHTRSPESYPANANRMKVTGA
                     WKLNAPLTNTTRQAKVFAHIPDHGAQTSNAVYRIQTVDGEEEVSVSQTANESNKWVDL
                     GAYDFGDQAPEVRLDNFNGGDGSADIAFDAVAFVPGTYNGQKMTGNMTVDLTAPDPAP
                     VEPGDEIAEDFYPGVALLSSGAASPTPKAARSSASCSIVSVSITRKRTNACIHDEVTT
                     TFFTDGAPSGRSYFDYYNTIYLDARSDEFSQVTTMVLKSMTGALNTVTMDYQAKCRGY
                     CTVTSVNWSGSKVFAKGDTVVRTITTRFKWTPSAGTTKNVITPYWTFGGSGNGVPMPV
                     PTEVEKSKLDIRCDNSITNAGTGCVFPGYTPTYVMNSKKFPGAAAHIDLMWRKTKINW
                     GNHNGGKPLTYLGNKMATDDPTKTQQARNRQLICERRWKTYKDTGLFSDMWSADAGKP
                     ITDKKSCDEFTFANSLQSGGNVNGPNPVSYSGAECVQTYLRRNPDDSMSLNLRPDAPA
                     PTWKEPCGRSSMSNWVNTQSMQPFGTFISNERLMEDDDYWLDLDGFTAPTP"
     gene            complement(68876..69445)
                     /locus_tag="SFLA_RS00275"
                     /old_locus_tag="Sfla_0064"
                     /db_xref="GeneID:11369390"
     CDS             complement(68876..69445)
                     /locus_tag="SFLA_RS00275"
                     /old_locus_tag="Sfla_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152209.1"
                     /db_xref="GI:503918215"
                     /db_xref="GeneID:11369390"
                     /translation="MTIEESWSRVMGLLEQHAPGDHADLPGPATENMLVAAEERMGVV
                     LPQDLRAWLLQNNLDLPEEDVDEDVECSGYAGFPDEGSFFLGIRSIESLYTNRSRPGG
                     FDPPDQPDNPFWRNEWIPFLSDQDGWAGKFIDTRDGRIGRWFVGEITVTGEYESLAQY
                     FDSLAEMLTKIADGDHPVCKVDEGRLLWL"
     gene            70156..71007
                     /locus_tag="SFLA_RS00280"
                     /old_locus_tag="Sfla_0065"
                     /db_xref="GeneID:11369391"
     CDS             70156..71007
                     /locus_tag="SFLA_RS00280"
                     /old_locus_tag="Sfla_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825268.1"
                     /db_xref="GI:754214637"
                     /db_xref="GeneID:11369391"
                     /translation="MSERRRPVFSEPEVQRTSARTVLMAAVLTGVSAVVVSLITGLGS
                     SLQGLVADTLFGEDKPAATARPVSKASSAVAVAVLPGESSAFLVSGQRVSEADRAVLT
                     GPYDQAALGRLFRKAGAVSLIKTAYKLSVTNTSSSPVTVVDIVPVITRRTPALDATMI
                     EPLGGVAEDTIPAELDLGERNPGFTQEGKPYFTGKSQVLEPGDGFVMAVESKLLSKEY
                     VEYQLRVDYIDGKGKKQSLQVNEDPDVVHPVFRVSGPIDDDAEYTDHWRPAESGRAWT
                     LTVPAGD"
     gene            complement(<71080..>71458)
                     /locus_tag="SFLA_RS00285"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391302"
     gene            complement(71488..71907)
                     /locus_tag="SFLA_RS00290"
                     /old_locus_tag="Sfla_0067"
                     /db_xref="GeneID:11369393"
     CDS             complement(71488..71907)
                     /locus_tag="SFLA_RS00290"
                     /old_locus_tag="Sfla_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152211.1"
                     /db_xref="GI:503918217"
                     /db_xref="GeneID:11369393"
                     /translation="MTRALRCAGITFAALATLTACGGRPEPCPALDLIPRVGVSWRAE
                     SLPYDAATTYRLCAAQDCTTGALQAYGDQAHVSLDLPESFDDRTPQVTLRLSDDSGTP
                     VLNAARTVTLQQAEDGCEQALTGTLQLTADGELKDVR"
     gene            complement(72217..73017)
                     /locus_tag="SFLA_RS00295"
                     /old_locus_tag="Sfla_0069"
                     /db_xref="GeneID:11369395"
     CDS             complement(72217..73017)
                     /locus_tag="SFLA_RS00295"
                     /old_locus_tag="Sfla_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825269.1"
                     /db_xref="GI:754214638"
                     /db_xref="GeneID:11369395"
                     /translation="MEKNLDFPDLLRLIDERSTAFRAVVAAAPGLDAQVPTCPGWTLF
                     DLVKHLGGGDRFWAAIVGAGSADAPPAEAVAARAALEVPREREALIAWLDASTQLLLG
                     ALRAAGPESGCWTWWPASQSPQTAGGTARHRVQETAVHTYDAQLAGGVPQPLPVELAL
                     DGVEEFLFTVCATPSAWPHKPTAFDFHSVEGRSWRLTVDGDGARITRIPTPAAATGED
                     SDVAGASVHGTASELVLYLYDRIQADSLHVDGDVGLLDLLRAWEPEEK"
     gene            complement(73232..73858)
                     /locus_tag="SFLA_RS00300"
                     /old_locus_tag="Sfla_0070"
                     /db_xref="GeneID:11369396"
     CDS             complement(73232..73858)
                     /locus_tag="SFLA_RS00300"
                     /old_locus_tag="Sfla_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152214.1"
                     /db_xref="GI:503918220"
                     /db_xref="GeneID:11369396"
                     /translation="MRDGIRWLVDLEHWMSSVVFARGISAQEPAVRMGGDRDAATEPI
                     TDAEAWGLGEWYRPGEHGDGVVRVGEQEGWAFALEYGDSTGGDRLAEISQKGIEAVHY
                     VPMQEHPPATVFHARDGVEVCGFGLREEVWRWGREPDLLLPDLISGHVLQPDGKTRGA
                     PETEHYTDAYRRTLGVIEQRFGLSLSPAYLKEARLPAYAVRGTPDMHV"
     gene            74140..75126
                     /locus_tag="SFLA_RS00305"
                     /old_locus_tag="Sfla_0071"
                     /db_xref="GeneID:11369397"
     CDS             74140..75126
                     /locus_tag="SFLA_RS00305"
                     /old_locus_tag="Sfla_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014152215.1"
                     /db_xref="GI:503918221"
                     /db_xref="GeneID:11369397"
                     /translation="MADVAQAAGVSSATVSYVISGKRPVAEHTRRVVEKAIADLGFSV
                     NTVARSLRTGRSSIVALVVPDLSNPFFAQLAASLQEELRVLGLHVMVCDTKADREEER
                     AFLREAVQQRFAGVVITPFRLVAKDFLVLSEAGIPAVVSADLPFGDNDLVTPDARAAI
                     RAALTEVTEAGRRHIAMVAGPRDATGGDPRLNLLRSLAAQFGTALPGRLVVRGEHTRE
                     AGAVGFERLMRIRPRPDAVFCANDVVAIGAMDKAEELGIDIPGDVALIGHDDASFASL
                     VRPRLTTVRYPAADVGKAAARLLIERLDGRSVRRTVHVKAEFISRGTVRTGP"
     gene            75467..76834
                     /locus_tag="SFLA_RS00310"
                     /old_locus_tag="Sfla_0072"
                     /db_xref="GeneID:11369398"
     CDS             75467..76834
                     /locus_tag="SFLA_RS00310"
                     /old_locus_tag="Sfla_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014152216.1"
                     /db_xref="GI:503918222"
                     /db_xref="GeneID:11369398"
                     /translation="MAVHKRVSIVRRGLIGGMALTLTALTACGGGGSEDGAGSAAGAA
                     CEPSSGKVTLDYWSWVPGMQKAVDVWNGENPDIQVTLKTTPSGNAGTYQNLSNALKAD
                     KAPDLGQIEYDSLASFRLKGGLTDIAKCAGVTEAEPKFVDWTWSQVDFGADGKDGVWA
                     VPQDTGPMALFYRKDIFDKLGLTAPTTWEEYAADARKIKSAKKGQYITHFSQTDPNWF
                     TGLLWQNKATMFERDGENWKVSVDRPESRQVADYWQKLIDEKLVATDLQGFSPALYKA
                     WNDDEVVTWISAAWGYSTIRDNAKSTAGKWAVAPMPQWEKGRKQAGNWGGSTTAVLAG
                     SKHPAEAAKFALWLNSDAKALEILNREGGLYPAAKDGLTMPALQQPVDFYGKQEIFDV
                     FAEASADVDTEFTWGPTMTDTYRFLSDGTAKATGGGSTLGDVLKDTDAQSADSLRKQS
                     LKVTD"
     gene            76899..77825
                     /locus_tag="SFLA_RS00315"
                     /old_locus_tag="Sfla_0073"
                     /db_xref="GeneID:11369399"
     CDS             76899..77825
                     /locus_tag="SFLA_RS00315"
                     /old_locus_tag="Sfla_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014152217.1"
                     /db_xref="GI:503918223"
                     /db_xref="GeneID:11369399"
                     /translation="MTPTRTVASSRTPVTAAPRRRHTAPLAFLAPFLIPFVLFTLVPV
                     GYAFWQSLHKTERTGGTFGRTETVFAGFQQYADVMSEPFFMESLLRVALFALVQIPVM
                     IALALTLALLLDSAVARLKRFFRLVYFVPYGIPGVVAALMWAFLYDPRLSPVVDVLRS
                     VHLDVDLLGPDAILWSIGNVVTWTYTGYNMLIMYAALQAVPADLSEAARVDGAGPWTI
                     ALRIKVPVIRPALVLTGVFSLIGTFQLFTEPQVFRAISTSVTSTYTPNLAAYSLAAGD
                     HYSEAAALSVLLAVATFALSFLFLRFTARRQG"
     gene            77822..78718
                     /locus_tag="SFLA_RS00320"
                     /old_locus_tag="Sfla_0074"
                     /db_xref="GeneID:11369400"
     CDS             77822..78718
                     /locus_tag="SFLA_RS00320"
                     /old_locus_tag="Sfla_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014152218.1"
                     /db_xref="GI:503918224"
                     /db_xref="GeneID:11369400"
                     /translation="MTLLTRTEGAHAPSPVRPRRAPRLSTVPVFVFMVLVAGYMLLPV
                     YWLLVSATKSQSDLVDTPGLLPAEWHLGDNLSALLTQQDGVYVRWLVNSLAYAGAGAA
                     VGTLLAAMAGYALAVYEFKGREAVFSVILGGVLVPATALALPLFLLFAEVDATNTFWS
                     VFLPSIVSPFGVYLSRIFAAASIPGEVVEAARIDGAGEWTIFRSIALRMMSPALVTVF
                     LFQFVVIWNNFLLPLIMLQDERLYPVTLGLFTWQSQTSRAPELQTLTLVGALVSVVPI
                     VITFLLLQRYWRAGLAAGAVKS"
     gene            78715..80763
                     /locus_tag="SFLA_RS00325"
                     /old_locus_tag="Sfla_0075"
                     /db_xref="GeneID:11369401"
     CDS             78715..80763
                     /locus_tag="SFLA_RS00325"
                     /old_locus_tag="Sfla_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_014152219.1"
                     /db_xref="GI:503918225"
                     /db_xref="GeneID:11369401"
                     /translation="MTDPWYALAERLGGIAYGGDYNPEQWPQDVWQEDVRLMREAGVN
                     LVTVGVFSWSRFEPRPGTYDWNLLDTVLDLLHAHGIAVDLATPTAAPPPWFSKAHPTS
                     LPRTASGTRLTHGSRQAFCPSSPDYARAADAIVTALATRYACHPAVVMWHVHNEWGNH
                     NALCYCDASAAAFRTWLRDRYGTLDELNELWGTDFWGQRYGDWEEIDPPRETTAFRNP
                     GQELDYRRFSSDALLARHRAETALLRELAPGIPVTTNLLGTLEKKIDGHSFARHSDIV
                     SIDHYLVAADPANHIDLALNADLARGMAGGRPWLLMEHSTSAVNWQPVNVPKGPGEMR
                     RNSLTHLARGADGIMFFQWRQSRAGAEKWHSAMLPHGGTAARTWGEVTGLGAEIAGLA
                     EVRGTRVRASVALLFDWHAWWALELEARPSERLRYLDTVRQWYAALWDLGVTCDLVAP
                     DADLASYAAVVAPSLYLVSAANAEALHTYVRGGGHAVFGPFSGAVDAYDRMHPGAHPG
                     AFRDLLGLVVDEYVPLREDESVLLSDGSRTRLWTERVESRGCTVRLRFADGPVPGGPA
                     VTRNSYGDGAGWYAAATLPAPALRGLLDAVCREAGAAPAASVPAGVEAVRRAADDRSY
                     LFLINHTGEDVSVPLDGRTRLDGSVPPGPVVVPAGDVVVLREGGTAEQPARPHREEDR
                     "
     gene            80763..82922
                     /locus_tag="SFLA_RS00330"
                     /old_locus_tag="Sfla_0076"
                     /db_xref="GeneID:11369402"
     CDS             80763..82922
                     /locus_tag="SFLA_RS00330"
                     /old_locus_tag="Sfla_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="WP_014152220.1"
                     /db_xref="GI:503918226"
                     /db_xref="GeneID:11369402"
                     /translation="MPHIEIDRPSGTVLLRASDTSYVLRVDTAAGTVRTLHWGASLSL
                     DDARALLEPDPATDSFRSPLDGTEELAVDGQVRFAPPALDVRYGDGTSAVEPVVDGYD
                     VRRDGDSSELSVRLRDHGRPLAWTLHYRVRQDCPVIERWTVFRHTGPGPTEPGEEPAL
                     SLVRHSAAQWNLPVLPAYRMSSVHGQWAGEFQLRRTPLAVGETTVSSRRGHTGHQSNP
                     WLALDAGDATEETGEVWTVALATAGSWRMTAVRSAEGRCGVLGGSGHEGVEITLAPGA
                     SWTTPVSTGLYAPGGFGGASRAYHSYVRRYVLPAPDEPRPVLYNSWEATAFDVTFDGQ
                     RELADLAARVGAELFVVDDGWFGARDSDRAGLGDWTPRPGAFPDGLRPLADHVHGLGM
                     RFGLWVEPEMVNPDSDLFRAHPEWVLHLPDRTAHTLRNQLVLDFSRPEVTDWALTWLL
                     RTVDAFAVDFLKWDFNRSFTEAGSSGRHPDARRVFVGHALGAHEVMDRLRAARPALRI
                     ETCSGGGGRVDLASLARTDQAWTSDNTDAVDRLSIQYGFSQLYPAQVMGAWVTDSPNP
                     ITLRTVPLRFRLHSAMAGALGIGGDLTRWPEAELDETAAYVALYKTVRSTVQTGRQYR
                     LGSPADSYHAVQYVARDSDESVVFQWRAGPEERAVLPRLRLRGLVPEAVYRVDDDSEI
                     TRAGTVRSGAALMAHGLSAQLPQGGYASRMLTLRREG"
     gene            complement(83019..83228)
                     /locus_tag="SFLA_RS00335"
                     /db_xref="GeneID:23391303"
     CDS             complement(83019..83228)
                     /locus_tag="SFLA_RS00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249895.1"
                     /db_xref="GI:702733115"
                     /db_xref="GeneID:23391303"
                     /translation="MVGYLCEQCTHVWNRPVEGDLEVHDVVRVDLPGATLYGTVRQVE
                     EDRVQVRVQDGQRLLWAERWRLILY"
     gene            83591..83842
                     /locus_tag="SFLA_RS00340"
                     /old_locus_tag="Sfla_0078"
                     /db_xref="GeneID:11369483"
     CDS             83591..83842
                     /locus_tag="SFLA_RS00340"
                     /old_locus_tag="Sfla_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic synthesis protein MbtH"
                     /protein_id="WP_014152222.1"
                     /db_xref="GI:503918228"
                     /db_xref="GeneID:11369483"
                     /translation="MSDHTESVYRVVLNDEEQYSIWQADRELPAGWRAEGTEGTKQEC
                     LEHIGRVWTDMRPASLRRRMESDAAGAAGGQGGRQSIPV"
     gene            83875..85014
                     /locus_tag="SFLA_RS00345"
                     /old_locus_tag="Sfla_0079"
                     /db_xref="GeneID:11369484"
     CDS             83875..85014
                     /locus_tag="SFLA_RS00345"
                     /old_locus_tag="Sfla_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_014152223.1"
                     /db_xref="GI:503918229"
                     /db_xref="GeneID:11369484"
                     /translation="MNSVSQPRYRPAPVARADQEAIPPDATDPSGPAPTAYGADRTGA
                     LSAVGGTPLVELTRLLPGARFRVWAKLESVSPGGSIKDRSAYTMLSHAVATGAVVPGT
                     GTVVESSSGNLGVGMAQMCRAMDLRFICVVDPRTNPQNIAIMRALGAEVHTVDEGDPV
                     TGEFQPVRIARVRELVAAVPGAYWPNQYANPRNAWAHRITMTEIVEDLGQAPDYLFCT
                     ISSSGTLRGCGDLIRDHRLPTRVITVDAEGSAIFRPPTARRLIPGHGAAVRPPLYRGG
                     LADEVVHVSDLDSLVGCRRLALREGLLLGGSSGAVATALERLSGRIPDGSSCVLLMPD
                     RGERYLNTIYDDGWVKAQFGEVTHLWKDEVADVADTSEMTEVAPC"
     gene            85008..86030
                     /locus_tag="SFLA_RS00350"
                     /old_locus_tag="Sfla_0080"
                     /db_xref="GeneID:11369485"
     CDS             85008..86030
                     /locus_tag="SFLA_RS00350"
                     /old_locus_tag="Sfla_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_014152224.1"
                     /db_xref="GI:503918230"
                     /db_xref="GeneID:11369485"
                     /translation="MLTLGNGDVRRLLDGREREVLDAVREAYLRHADEETSLPHSVFL
                     RFPDDTRNRIIGLPAYLGGPEPLAGMKWIASFPGNVADGLERASAAIIVNSMRTGQPV
                     ALVEGSTISARRTAASAALAAASLPAEDGQETGVALIGCGVINFEVLRFLLVVRPELT
                     DVTVFDLDAGRAEEFRERCASEFGGAGRVVRVADSAEEALGTHRLVSLATTATVPHLD
                     LRACRPGTLVLHVSLRDVTVEGVLDAVNVVDDPDHVCRAATSVHLAETRSGSRSFIDS
                     TLGELLRKTDAGHRDPRRITLFSPFGLGVLDLALAGLVLRRARAAGVGTEITGFLPEP
                     RATGSG"
     gene            86375..86995
                     /locus_tag="SFLA_RS00355"
                     /old_locus_tag="Sfla_0081"
                     /db_xref="GeneID:11369486"
     CDS             86375..86995
                     /locus_tag="SFLA_RS00355"
                     /old_locus_tag="Sfla_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_014152225.1"
                     /db_xref="GI:503918231"
                     /db_xref="GeneID:11369486"
                     /translation="MRNPVRVSVIALDPVLEAGTLSALDGFAEVRPVVGGQRPDVTVV
                     VVDRVAEPVLDLLRRTRAAEHRPEVVLVATELGPVEALHAIATGARGLLRRRETSGPR
                     LAHAVLAAAGGDCAVPPDLLDGLLEQRAEGADPGVADSWGAAGLSERERAVLRLVADG
                     HETSAIADELCYSVRTVTTVLHNVTQRFRLKNRAHAVAYVLRAGLL"
     gene            87031..87672
                     /locus_tag="SFLA_RS00360"
                     /old_locus_tag="Sfla_0082"
                     /db_xref="GeneID:11369487"
     CDS             87031..87672
                     /locus_tag="SFLA_RS00360"
                     /old_locus_tag="Sfla_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_033249894.1"
                     /db_xref="GI:702733112"
                     /db_xref="GeneID:11369487"
                     /translation="MPASYGPAPVRVHVRAANDGLRRSWHQRLTRAGIPLAEDSQPGP
                     GVVLLAAGRTVDEAVDSCSPPDDPDRRGFLVAAQLVSPDSVLRAVRVGARTILRTADA
                     HPEQLVAAVHSAHHGDGRVPYGVLVRLLGTAQRPVAPAPGVPRAQQAVAPLTPRQTVV
                     LTLVAEGHGNAVIARALSCSEHTVKNVIYELMARLQVRNRAHAVARAVRAGLI"
     gene            complement(87748..88173)
                     /locus_tag="SFLA_RS00365"
                     /old_locus_tag="Sfla_0083"
                     /db_xref="GeneID:11369488"
     CDS             complement(87748..88173)
                     /locus_tag="SFLA_RS00365"
                     /old_locus_tag="Sfla_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate decarboxylase"
                     /protein_id="WP_014152227.1"
                     /db_xref="GI:503918233"
                     /db_xref="GeneID:11369488"
                     /translation="MFRTMFKSKIHRATVTQADLHYVGSLTIDEDLMDAADLLPGEQV
                     QIVDITNGARLETYVISGERGSGVIGINGAAARLVQPGDLVIIISYASVADAEAKALV
                     PCVVHVDQHNRQVSLTGSDLAEPVPGSGTVRGDLLRPGN"
     gene            complement(88225..89595)
                     /locus_tag="SFLA_RS00370"
                     /old_locus_tag="Sfla_0084"
                     /db_xref="GeneID:11369489"
     CDS             complement(88225..89595)
                     /locus_tag="SFLA_RS00370"
                     /old_locus_tag="Sfla_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014152228.1"
                     /db_xref="GI:503918234"
                     /db_xref="GeneID:11369489"
                     /translation="MSRVAEDAGVVPAPPPLRRNRDFMLLWSGSAVAIIGSTASTVAY
                     PLLVLAVTGSPSAAGVVGFVVLLPALLFQLPAGVLVDSWNRRRVMIWCDGLRAAGAAT
                     VVLALLAGELRLAHVMVVGFVEGTLTVLNGLASTAAVPNVVHRSQLSAALAGNEARGR
                     AATMIGTPLGGILFGLGRAVPFVLETLAYLVSLATLLGIRKEFQTARPGEPAPAGNGP
                     GGDAATGSRRDRALRQAGRMAEGLTWLWRRPLLRTTALLVAGSNLLFRALFLVMIVLL
                     AEEGAGPAAIGLLIGVAGGCGMLGSLVAGWFGRTLRLNALVIGANWVWALLMCVLAFS
                     GGLWPAAIAYTAMWFVGPIWNVAVGSYQLTVTPDDLRGRVLSASSLLANGALPLGALV
                     GGLLLDAFGVRAAATVLAGWMVLMALAATLARPVRRATMTAINDPAGPAPAESAAVPT
                     TAADSH"
     gene            89951..90811
                     /locus_tag="SFLA_RS00375"
                     /old_locus_tag="Sfla_0085"
                     /db_xref="GeneID:11369490"
     CDS             89951..90811
                     /locus_tag="SFLA_RS00375"
                     /old_locus_tag="Sfla_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SyrP"
                     /protein_id="WP_041668396.1"
                     /db_xref="GI:753980969"
                     /db_xref="GeneID:11369490"
                     /translation="MRARLREHGAVLLRGFGHDGVDGFEQTVRTIGGEPLTYAERSSP
                     RSTIKGQVYTSTDYPPSEEIFLHNENSYQATWPLTLFFSCVTPPDTLGSTPLADTRRV
                     LAAIAPEVREEFAARGWMVVRNFTDGFGVPWQHAFNTEDRAQVEAYCARNGVVAEWTA
                     GGLRTRARREAVHNHPVTGERVWFNHLTFFHVTTLGPDLCAALREMYDEPDLPTNTYY
                     GDGAPVPDEVVSHLRDCYRAEQRRFDWQQGDVLVVDNMLAAHAREPFTGPRKIAVAMA
                     EPSSGPVERG"
     gene            90873..97388
                     /locus_tag="SFLA_RS00380"
                     /old_locus_tag="Sfla_0086"
                     /db_xref="GeneID:11369491"
     CDS             90873..97388
                     /locus_tag="SFLA_RS00380"
                     /old_locus_tag="Sfla_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_014152230.1"
                     /db_xref="GI:503918236"
                     /db_xref="GeneID:11369491"
                     /translation="MAPVDGGYPLSFAQEQLWLLDQLRSGDAAEYLMHETFRIRGPLD
                     TGALTAALTETAARHEVLRTRYADEDGVAVQVIDEPEPVKPEFADLGDVPADRREQSL
                     REFGASWAGTPIDLRRDHSWRVAVVRLAPEDWALLLTFHHIAFDGWSWGLLADELREL
                     YGVFASDRDPTPEPLEPVELQYADYAEWQREWWSAQPELMDQQLRYWRQQLAGAAPLE
                     LPTDRPRPPRWDASGDTVAFTVPASLATRFSALAKEQGTTVFMAGLAAYQLLLARYSG
                     AEDIAVGVSLANRDDARLERLIGLFLNTVVLRTDLGGAPDFRELLSRVKHTTLDAYSH
                     QEVPFERVVAALAPERDAGRNPVFQAGFALHNAHRRPFALPGMRVTRVDGGTRSSAFD
                     LSLHLTERPDGSMGGEFIYPTALFDRDRIERMAENFLHLLDQAVTTPGTPVERLELTA
                     PAERATLTTWGQGTPRPAGEDRSGHGLVRLVLDRAAATPRATAVADDGGHLDYAGLAE
                     RVTQLAGRLHTEGVRPGDPVAVSLHRGPELVTAILAVLAVGGVHVPLAPDLPDVRRDF
                     LLTDSGAELVLTEEALRDLFRDSPRVRALDGEWSAARTAPGGPPETFPYPAGPDDAAC
                     LVYTSGSTGTPKGVVVTHGGLRNRVLWSVEAYAMTAADRLLQKTTIGFDASLWEFLSP
                     LVSGGTVVMAPADAHRDPSVMAAAMARHRVTLLQLVPSVLRLLVQEPALSDCTALRLV
                     SSAGEPLTTELCERLRAVVPGVGISNTYGPTECSIDSTAHRWTGEGLPGSGTVSIGAP
                     LPGVGVSVVDRADVLVPVGVPGELCVRGAGLARGYRGRPGQTAERFGVDPYAAVPGGR
                     WYRTGDLVRWRTDGTLEFLGRTDDQVKIHGVRVEPAEIEALLLTHPGAAASAVVARVG
                     AHGERELTAYAVPSAPGGADARLRAELLAHLAARLPAAVVPSRLVLLDALPLTASGKV
                     DRRALPGPEEAAQPPAATATDRTAPRTATERAVTEAMAAVLEVPEPGPDDDFFALGGH
                     SLLAIRLVLGLRRAFGIEMTVAELFADRTPAALAARIDRAVGAADAAEAAQDRDGAGI
                     VPVPRDGELPLSFGQRRMWFLDRLEPGSEEYLIPLALRLRGPLDTAAFRGALDEVARV
                     HEVLRTRYADRDGDPVQLVDPPGPVAFRLVDLTGTGDGTKDLAARARELLEEALCAPF
                     DLSAEHPLRVSVIRAAPEDHWVALAAHHIAFDAWSTKVFLRDLDTAYTALAAGRPTPL
                     RPGPVQYADFAAWQRGREDGPENGRHLEHWLERLDGLTPVELPSDRPRTATRDAAGDT
                     VVVDVPESVARAVTELANRHGATPFMTLLGAFQVLLHRYTGRTDIAVGVPVAARTREE
                     TEGLLGLFVNSLVIRTDLGGDPAFSGLLARVKEVCLEAFAHQDVPFEQLVEELGTERD
                     LSRNPLFQVMFEHQHMGGLTTTLGGLRAEPLKAGPRTAKFDLTLTVKERPDGRMHCWF
                     EYASALFDRATVERMSAHYLRLLESLTAAPDTAVAALELMPEAERRQLLGSWPDPYAA
                     RLPEIVPEAERDLTVPELFVRQAARTPDATALVFGAEELDYAALEARSARFARRLRAL
                     GAGPETVVASCQERGIDAVVTLLGVLRAGAVYVPLDPRHPRRRLSRTVEDSGARFVVT
                     TTEHADSLTGDGHQVLTVDTLDGAADPAEALPDVPAAPDNLAYMIYTSGSTGRPKGVM
                     IDHRAYAHHCRIAADAYGIGPGERVVQLSSLTFDVSMEQIAAPLLTGAAVVIADPLFW
                     SPAELPARLAEHGVTVMETTPAYYREVMTYDTSVLTGLKLINLSSDVVTVADARQWSA
                     SGLPGRFVCCYGPTEATVTCLLHTGAAGHDGERGTASMPLGRPFAGTGAYVLDARLRP
                     VPVGVPGELCVGGVRLARGYHGRPELTAGQFVPDPFGGAGERLYRTGDLVRYRPDGTL
                     EFLGRIDQQVKVRGLRIELGEIEAALTGHPGVGAAAVTAPEITPGDRQLAAYVTGRDD
                     SPAPDPDVLREYLRERLPDYMVPALWTALDTLPMTSSQKIDRKSLPAPATRTERAFVS
                     PRDPAEETVAAIWAEALGLEQVGAEDDFFALGGHSLLATRVLARIQESFAVDIPLRRL
                     FENTTVATLAAAVTEAVEAAIAQLSDAEVAELLSPEGAR"
     gene            97385..104602
                     /locus_tag="SFLA_RS00385"
                     /old_locus_tag="Sfla_0087"
                     /db_xref="GeneID:11369492"
     CDS             97385..104602
                     /locus_tag="SFLA_RS00385"
                     /old_locus_tag="Sfla_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_014152231.1"
                     /db_xref="GI:503918237"
                     /db_xref="GeneID:11369492"
                     /translation="MTHQTLDPAALRARLLRQRLRGAAATAPSDGITRAPRGGPLPLS
                     FAQQRLWVLDQLSPGSTAYLMTAALRLSGPLDTGALRGALDALVARHEVLRTRYPVVG
                     GDPVQVIDAPAPVDLAEEDLTGLDPQDRAGRLAALGTSGRQPVDLADGPVVRAVLARC
                     AAEEHTLFVTVHHIAADGWSEDLLVRELTERLRQPAGPEPSAPALQYADFAVWQRARL
                     GEDRLEDGLGYWRRRLAGVAPLELPTDRPRPAVRDDTGAVAPFTVPAEVAARLSRLAR
                     ERGATPFMATLAAFKVLLSRYTGSTDIAVGTPVSGRDRAEAQQMLGLFLNTLVLRTDL
                     SGDPGFGEVLTRLREGALDDYGHQEVPFERLVNALAPERDPSRTPLFSAMFLWEGADG
                     QDSRETGGAGRLAVERLAVGERTAKFDLTLSVTEQPDGSLSGGLNYATALFDAATAAR
                     MASHFTRLLDAAVADPEAPVGGLELMSGPELHEVVHRWNDTAVPFPAGTLHGLFEAQA
                     AATPDAVAVTDEDGTLGYAELNHRADAVAAALRARGAGPGTVTGVCLERSRGLLVALL
                     GVLKAGSAYLPLEPELPLERRQYMLADSGARILLTDTGAGPAGVPEDVTVLPLARGGL
                     LPEGVPGRDGAAPGPGDAAYVIYTSGSTGRPKGVLVEHRAIVNRLHWMQREFGLDATD
                     RVLQKTPMGFDVSVWEFFWPVATGATLVMARPGGHRDPVYLARTIAEESVTTLHFVPS
                     MLRAFLAGPVPALPSLRRVVCSGEALPGDLVTASVNRLGIAPHNLYGPTEAAVDVTST
                     PCVPGQRVTIGKPIANTRAYIVDAALRPVPVGVPGELLLGGVQLARGYLSRAALTADR
                     FVPDPFGGAEGGRLYRTGDLARYLPDGSIDYLGRLDHQVKVRGQRVELGEIEEVLHEH
                     PAVAAAAVTVHEQSLVAYLTGRPGEASPDSGAIRVWLRERLPDAMVPGHWMVLDALPL
                     TASGKTDRKALPAPDRSRDSRAGEYTAPRGPVERAIAEELAVALDLDQVGVHDRFFDL
                     GGDSIRAIRAVGALRGRGLELSVQHLFTHPTVAGLATVATETAGTGQGHQLVAPFVQL
                     DPADRERLPDGLADAYPLGEVQAGMVYELLADPEANTYQNVSSFHFTDDGPFSLPALR
                     ESIRRLVDRHEILRTSFRLSGFSAPLQLVHRQAEAEVGFTDLRGLAPAEQRAAMAKFR
                     TAEQREPFDLERAPLLRYHVHRTGEGTWTLTHTECHAILDGWSHHSVIQEIRADYDRI
                     REDAGCAVTPPPQARYADFIALERQALGSAEDRAFWQGRISGFPRLELPAPTALAESG
                     GPAHEVRVSWAGLDPALRGLAARTGTSLKTVLYTAHLTLLGLISGQRRFFAGAVCNGR
                     PELPDGDEVRGMYLNTVPFAVDLDAPSWEELLRAVFAEEAAVWPHRRYPLPAMQREWG
                     TGTPLVDVVFGYLDFHVLDQSGSAPEAVTDSSPNEFTFDVWTFPGELRMTCRPGWAGR
                     DRLEAMATAFVEVLRAMAERPESAPGAFSAAALARPTVAPAHVPPPPEVTLAELIARH
                     SRPGDVALIDGDSTVTYGELEARANQFAHLLRARGVRAEDPVAVCLERGPETVIALLG
                     VVKAGGCYVPVDPEYPEERIGYMLADSGAGLLVTHAALADRLSGLLTGGIRTVLLDAG
                     RGELETHPHTAPEAGTSPDNTAYLIYTSGSTGRPKGVQITHRNVVRLVHGENHAEIGP
                     RDTVLVVSPLAFDASAFELWGTLANGGRLAFAPPGTPTTAGVAEVLRERRVTVAFLTT
                     SLFHLMVESCPEALTGLRALLAGGDVLSPDRVRTALGHGLRVSNMYGPTECTTFATGQ
                     HALTVEQTDRPLPIGTPIAHTTTLVTDEDLNPVPYGVTGELLLGGPGVARGYLGRPDL
                     TADRFVPDPTGARPGGRLYRTGDLVRQDPDGVLHFLGRRDHQVKVRGHRIELGEVEAG
                     LNRLPGVHEAAAAVRPGPDGDKQLVGYVVPAEHTAFDPSALRTALRQRVPGFLVPSAW
                     VRLDELPLNANGKLERTALPEPGGVDTGGETVAPRTAAERAMAEVWAEVLNLEQVGAH
                     DDFFLLGGHSLLILRAIALLRERHGLELTVRAFVEHHTLDAIAAAAERGETGDASRSA
                     LMWLRKEGGQAPLFCVHPGGGSAHWYQRLVPHLAEDLPVAALEWPGLQSGPGRPVPTA
                     SEMAQRYVTEIRRARPHGPYRLLGWCGGSGITAEMADRLRGDGEEVTFILLDPGLDSH
                     ERQGLWEEFRLIESCTAKLEELAAAGPEEDTGALRDEILRLLNHLVDDADPETGIVLP
                     ERNGAGVWLPSARIWREVMEMTLTYRHRYFPGTLHLIISDELARGEHEVALGQTYEEY
                     LNRWRELNADVEAHRVPGDHFGVMRLPHVTSLAATLAALLD"
     gene            complement(104844..107150)
                     /locus_tag="SFLA_RS00390"
                     /old_locus_tag="Sfla_0088"
                     /db_xref="GeneID:11369493"
     CDS             complement(104844..107150)
                     /locus_tag="SFLA_RS00390"
                     /old_locus_tag="Sfla_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lantibiotic dehydratase"
                     /protein_id="WP_014152232.1"
                     /db_xref="GI:503918238"
                     /db_xref="GeneID:11369493"
                     /translation="MSDDGAPLLGRRWRLWEQFSLRGPGFPVGGVLDLAPVDLSVYAD
                     KFAGGVLSGPDWVEFEGVFGEVAARTAVRLQEVAGSSDFTAAVAWQNRTVLRTGLRPF
                     LGWVPSASNRSSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGRVDRSVGGVEIDAG
                     EGLTESSSVFFSSWSIDALARTLSADDRLMAWIPPRRMPYIRADSDDGPVRIPGRTPQ
                     QAPPRLVALLRLADGRRPPAELARALRMTPAEVTAGLAELVRRRWVTWRLDVPSGPRP
                     DRELRAILERVGDPELRRGALEPLEVLERGRERVEAAGRDAGALCEALAALEEDFTRI
                     TDTASQRAKGTHTAPNRSLVYSDTRRSATARVGSEVLDAMAPLDPLMTSAAWLMARLG
                     ARVEERATEVYEKLAAASGGDRVNLADFWFGCMPILHGAAVTDAQEVLEEFQRRWARI
                     IPVPDGARQVRTTHAAIASQVAEAFPPVPAAWTAARYLSPDVLIVAHDTESVGRGDFE
                     LVLGELHLASNTVGASLFVSQHPEPAELLRITGQDHPGPRLLPLLPKEHKSRLSVRVR
                     NVLVRPEDYYIALLELTADPHRDRTVLSADAHVTRRGDRLVALLPDGGEFAVTDVFGH
                     VLTTLAMDMFRLFPDADHVPRVAVDKLVVSRESWRFTGGDLEFAEEKSEARRYVRARN
                     WRDGRGLPRYVFVVSPTEPRPFYVDFDAPVYVNILAKAARRLARKDPQAKLTVTEMLP
                     SPEHAWLTDDQGNAYTSELRFVAVDQHH"
     gene            complement(107143..107388)
                     /locus_tag="SFLA_RS00395"
                     /db_xref="GeneID:23391304"
     CDS             complement(107143..107388)
                     /locus_tag="SFLA_RS00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="WP_033250053.1"
                     /db_xref="GI:702733860"
                     /db_xref="GeneID:23391304"
                     /translation="MTELITGLYQEALSNEGLDEKADFFESGGDSLTAFQITGRIQEA
                     LGTEIAVALVFAYPTPEELAEIVAEELADTPAGVAHE"
     gene            complement(107499..108515)
                     /locus_tag="SFLA_RS00400"
                     /old_locus_tag="Sfla_0090"
                     /db_xref="GeneID:11369495"
     CDS             complement(107499..108515)
                     /locus_tag="SFLA_RS00400"
                     /old_locus_tag="Sfla_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-5'-phosphate-dependent protein subunit
                     beta"
                     /protein_id="WP_014152233.1"
                     /db_xref="GI:503918239"
                     /db_xref="GeneID:11369495"
                     /translation="MTAAGTRLGPADVRAAAVRIRGPVRRTPLLAADALPALFGPGQR
                     GLLLKAEHLQHGGSFKARGAANAMLGQDSVTVVAGSSGNHGIAVAALARRIGAEATVV
                     MAAGAGRAKADAIRRLGARVLTVDGGVAARDQRARELAEDTGALLVPSSDDELVVAGQ
                     GTVVLEILEEAPDIDLLFVPVGGGGLLAGSCLAAALAARPPRVIGVEPRQACRYAVSL
                     EAGSPVEVPASQTVADGLRGQRPGEITFPIIQRRVDELVAVEDGEILRAMELLHRAGL
                     PAEPSGSVALAGALRRGFHGRTAVVVSGGNSPSALAAMGVGGAAEAGPAAPPSPVPPL
                     SVLQ"
     gene            complement(108512..110065)
                     /locus_tag="SFLA_RS00405"
                     /old_locus_tag="Sfla_0091"
                     /db_xref="GeneID:11369496"
     CDS             complement(108512..110065)
                     /locus_tag="SFLA_RS00405"
                     /old_locus_tag="Sfla_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_014152234.1"
                     /db_xref="GI:503918240"
                     /db_xref="GeneID:11369496"
                     /translation="MVSFLDTVRAHAVRTPEATALRAPGRTISYRGLDAWIDRLAHVL
                     TDRGIVRERVCAIALEPGPESVVAVAAVLRAGGAFLTLDVTQPPARLAAMVRSGGATA
                     LLTRGTVRGHAGLMAQGTVIDLDELGEPDSWDGSHRVRAAGTPAVRPEVSGRQLAYVS
                     HTSGSTGTPNAVLIERAGLDSYLHFVARDYGLGPHTVALQVAPLGYDASIRDTFAPLV
                     AGGTVVLAERSTLLRADSFAEILRREGVDTLLSVTPSFLTFLAQQDRAEERLGGLRTV
                     VASGESLLPFLSSGSRRLLPGSLVNQYGPTECTMTATRYAVPPEPDTTTDLIGTAIDG
                     MTVTLTGPDGRETPPGEVGEITLGGIGVARGYRGRPELTADRFRPDPGGPPGARAYGT
                     GDLARVGQHGVLEYLGRSDRQVKIRGYRVDPAEIEGVLLSHPRVTGAVVTAEPDERGK
                     TFLQAHVTGSLDAVTNAELRRHLARTLPPHMMPRGFQRIERLPTTRTGKTDRAALLAR
                     APQSAGRTP"
     gene            complement(110059..112410)
                     /locus_tag="SFLA_RS00410"
                     /old_locus_tag="Sfla_0092"
                     /db_xref="GeneID:11369497"
     CDS             complement(110059..112410)
                     /locus_tag="SFLA_RS00410"
                     /old_locus_tag="Sfla_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lantibiotic dehydratase"
                     /protein_id="WP_014152235.1"
                     /db_xref="GI:503918241"
                     /db_xref="GeneID:11369497"
                     /translation="MDAEKQAEDQEAVYLPGGRWRLWEQFSLRGPGFPVGGVLDLAPV
                     DLSVYADKFAGGVLSGPDWVEFEGVFGEVAARTAVRLQEVAGSSDFTAAVAWQNRTVL
                     RTGLRPFLGWVPSASNRSSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGRVDRSVG
                     GVEIDAGEGLTESSSVFFSSWSIDALARTLSADGRLMAWIPPRRIPFARLERRDGGGV
                     VQLPARPEQPVPAELLPLLELVDGRRTLGDLARELSLPADRAEERLRELVRRRWVTWR
                     LEVPSGARPDRELRAVLERVGDPELRRGALEPLEVLERGRERVEAAGRDASALCEALA
                     ALEEDFTRITDTASQRAKGTRTAPNRSLVYSDTRRSATARLSTAVLDELTPLSLCLTA
                     VGWLTSRYAESMRARIRESFDRVRGDRPTTDLASLWFACLPAPHAASMPEADRIGAEL
                     RDRWARIIDAPEGARRVQLSSSDIADRVREEFDGPRDGWSLSRYVSPDVLIMAKDAAS
                     VERGDFELVLGELHIAMNTVAASLFVNQHPAVEELIAETDRDFPGPRLMPMLPKELPL
                     KWSARSRPALDRPEDYFVAVAEHTSDPHRDRTVLSAEVTVTDRDGRLTAVLPDGSEFD
                     VLDVFSHALTNRVMDRFALRIDADHVPRVAVDKLVVSRESWRFTGGDLEFAEEKSEAR
                     RYVRARNWRGERGLPRYVFVVSPTEPRPFYVDFDAPVYVNILAKAARRLARKDPQAKL
                     TVTEMLPSPEHAWLTDDQGNAYTSELRFVAVDQEHRQGGVPSW"
     gene            complement(112417..113361)
                     /locus_tag="SFLA_RS00415"
                     /old_locus_tag="Sfla_0093"
                     /db_xref="GeneID:11369498"
     CDS             complement(112417..113361)
                     /locus_tag="SFLA_RS00415"
                     /old_locus_tag="Sfla_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018487430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_014152236.1"
                     /db_xref="GI:503918242"
                     /db_xref="GeneID:11369498"
                     /translation="MPQAERRHLISIDDLSDEELRHIALRGAEFSAGSADDARPLADT
                     VVGVLFRKTSTRTRTAFSAGALRLGARLITYGPGDLQENTGETVEDSAAVLSRMIDVL
                     VARTAGPEHELRAYAAQRRMAVVNAMSQGEHPTQALADLTTLLRRFGRIEDLHVIYVG
                     EGNNTASALALALSRFPGTRLTLRTPPGYGVAPEYLERAAVSAKRSGARIEERHDMAD
                     LPAADVVYTTRWQTTGTVKPTADWREVFAPFQVTEKTMASSPDAVFMHDLPAHRGEEV
                     TADVLDGPASIAFDQAENKYHSARAVLEWCAADRSSER"
     gene            complement(113394..114692)
                     /locus_tag="SFLA_RS00420"
                     /old_locus_tag="Sfla_0094"
                     /db_xref="GeneID:11369499"
     CDS             complement(113394..114692)
                     /locus_tag="SFLA_RS00420"
                     /old_locus_tag="Sfla_0094"
                     /EC_number="2.6.1.76"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152237.1"
                     /note="catalyzes the reversible formation of
                     diaminobutyrate and 2-oxoglutarate from glutamate and
                     L-aspartic beta-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminobutyrate--2-oxoglutarate
                     aminotransferase"
                     /protein_id="WP_030638606.1"
                     /db_xref="GI:664100882"
                     /db_xref="GeneID:11369499"
                     /translation="MTLAFTPPTTAPPEGPDVAVFERYESHVRSYCRKFPVVFERAKG
                     ARLYAEDGRVFTDFFCGAGSLNYGHNPGPIKERIADYLASDGMMHGLDMYTVAKRSFL
                     VALTEHILRPRGLEYTAQFSGPTGADAVEAALKLARKATGRRGIFAFSGGYHGMTRGS
                     LAVTGNGRARRAGGVHGQDEVTFIPYEDGPQGPFDSIAFIERLLADSSSGVELPAAVI
                     VEPLQMEGGVYQASADWLRRLRVVTERHGILLICDEIQSGCGRTGTFFAFEESGIVPD
                     IVTVSKSISGYGLPLALTLFRPGLDVWEPGEHTGTFRGNQLAFVAATAAAELWSDPDF
                     LDRLPVPARRLAEFGAELVAAEPEIVIRGRGMVLGIDLGRKGGGKRAEEVQRYAFDHG
                     LIVELSGRDDEVIKVLPPLTVTPEELDHGIGVLRAALLSS"
     gene            complement(114840..118118)
                     /locus_tag="SFLA_RS00425"
                     /old_locus_tag="Sfla_0095"
                     /db_xref="GeneID:11369500"
     CDS             complement(114840..118118)
                     /locus_tag="SFLA_RS00425"
                     /old_locus_tag="Sfla_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="WP_014152238.1"
                     /db_xref="GI:503918244"
                     /db_xref="GeneID:11369500"
                     /translation="MDSADAQETGSGRPMSFAQRRLWFLDSLRPGTPADLLPLALRIR
                     GDLDDKALTGAFAAILARHEVLRTRYPAVDGEPVAVVELTAEAPWSRRDLRHLPSGQR
                     ESLLAELVAAELVRPLSLESAPPLRLTLVRLAEREHVLLIVVHHIAFDFFSWPVLTQE
                     LAAGYRARTIGPEPESEPLTFQYADAAAQQAARLAGPRAERQLAYWRERLAGLEPLEL
                     PADRPRPAVWDGAADIARFTIPSELTEKIDRVAREHRATRFMVLLAAFQAVLARLTGR
                     NDVAVGTPVSGRGRPPLDKLIGLFVNSVVLRAHLGGAPSFTELLGRVRKDTLDALTHA
                     ELPFERIVTELAQQRDLSRNPLFQISFQLLSLPEEPDHLPGLDTEMISTPASGSAFDV
                     SLDLLSHPDGRISGRMQYATALFDPDTAERIGAAFTTLLTAVVAEPDAPVARLAARLP
                     SLPGRERRRLLAQGNDTAMEVPDVPWTELFAQQVSRTPGAVAVSGPGGTLTYAELDSR
                     ANQLAHRLAAKGAGPGIPVGVLLERGPTLLAALLAVHKAGAVYLPLDPGYPAGRIGYL
                     LQDAGAGALISERELVKRLDRTGTLSRPAEEHTLLLDDPAEAARTAAAPCSAPRHHPG
                     PDELAYIFYTSGSTGHPKGVMVEHRALTHFLVAMAGRLPLRPGGTFLGITTVSFDPSL
                     MELCLPLTTGARLLLADREQARDPERMAALIATAGTALVQATPVTLRMLLDTGWRPGA
                     GLTVLSGGEKLHTELAVRLAADGARVWDLYGPTETTVWATTACLDPHGRNVDWQLRGN
                     TRLVLLDARMQPVGEGAVGEIHIGGSGLGWGYHARPAQTAGAFVPDPFADRPGARLYR
                     TGDLARRRPDGSLEILGRADHQVKIRGHRIEPGEIETALLATGAFRAVLVRAVPHPDG
                     DQRLAGYLVPKGGTAPGHEELRTVLLATLPDYMVPEAFVTLDALPRTPNGKVDRAALP
                     PVASWGRTGTTTGAPPRTDRERTVAGVWEEVLGVQAIGVDHDFFQLGGHSLLATRVAV
                     RLRAALGIDVPVRALFEHPTVAALSAALPGFPTVAAGPPAPVLGARRRARRPAAARST
                     DGRR"
     gene            complement(118551..118955)
                     /locus_tag="SFLA_RS00430"
                     /old_locus_tag="Sfla_0096"
                     /db_xref="GeneID:11369501"
     CDS             complement(118551..118955)
                     /locus_tag="SFLA_RS00430"
                     /old_locus_tag="Sfla_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_014152239.1"
                     /db_xref="GI:503918245"
                     /db_xref="GeneID:11369501"
                     /translation="MQRGEVWWVDFDERRPVVLLSDDEPSGFQVMQVVAPAGVDISGL
                     GVEVPIGAQEGLPLEGVLRFAFPRPGFTPCTWLTTVAREDLVERAGVLSSAKLSEVGA
                     ALHAARQGREWTPMAAARLREIGEARRIGGLE"
     gene            complement(119314..120048)
                     /locus_tag="SFLA_RS00435"
                     /old_locus_tag="Sfla_0097"
                     /db_xref="GeneID:11369502"
     CDS             complement(119314..120048)
                     /locus_tag="SFLA_RS00435"
                     /old_locus_tag="Sfla_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014152240.1"
                     /db_xref="GI:503918246"
                     /db_xref="GeneID:11369502"
                     /translation="MTSGPALASPWFVRPPSADASARLFCFPFSGSGASAFGAWSATA
                     GDAEICPVQFPGRENRLAHPHYASYENLAEQLVEALTPLLDTPFAFFGHCAGALPAYE
                     SVLRLAAAGLPVPRRLYVSGQPAPHEAARDRMLTLGEDELRAELVTFLRGRGIDPRPD
                     MIDMGMFVLLRDHAAAGAYRRAEPARIDCPITVLHWSEDTDVSLADLQGWRRYADSVE
                     IHVVEGGHYDFMDAPAQLLAILADGR"
     gene            complement(120045..121295)
                     /locus_tag="SFLA_RS00440"
                     /old_locus_tag="Sfla_0098"
                     /db_xref="GeneID:11369503"
     CDS             complement(120045..121295)
                     /locus_tag="SFLA_RS00440"
                     /old_locus_tag="Sfla_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_014152241.1"
                     /db_xref="GI:503918247"
                     /db_xref="GeneID:11369503"
                     /translation="MRLTPGPSRDIDLDTVDLFDLDLYGTGDPHAVWDAMRAQAPLHH
                     QTLADGREFWSVTRYEDVCRVLGDHREFTSERGTVPTHLGQDDVAAGVLLTSTDPPRH
                     TEVRRPLGSRLTARAVRSWEDSIRRSVTRFLEPALDGEVFDLAEKALLLPAIVTGPLL
                     GIPEKDWEELVQLTAMVAAPSDPHFQLGSEAATLAISHHELVGYVTEWVKDRRRSGAE
                     DDSLLHHLMSVRPGGAPLSDQEIALDGYSILLGANVTTPHTVSGTVQALIERPEQYDK
                     AQADPGLIPDLVEEGLRWTSAACNFMRYATTDVPVAGGVIPAGAAVVAWIGSANRDAA
                     LFTAPHTFDINRPNAKRQIAFGYGPHFCIGAPLARLTLRVFFEELLHRFDSLELAGEP
                     DHLRSYFIAGMTHLPVTAQKRHTP"
     gene            complement(121292..121606)
                     /locus_tag="SFLA_RS00445"
                     /old_locus_tag="Sfla_0099"
                     /db_xref="GeneID:11369504"
     CDS             complement(121292..121606)
                     /locus_tag="SFLA_RS00445"
                     /old_locus_tag="Sfla_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="WP_014152242.1"
                     /db_xref="GI:503918248"
                     /db_xref="GeneID:11369504"
                     /translation="MEPAPQLIHPPGGQEETERHHDASSGGPVPLEDEIAALWGELLD
                     RPEAGAEDEFFALGGNSLTGIQIIERLARDYGVLLSVRDFYLAQTPARVAGLIERGRS
                     ST"
     gene            complement(122502..124019)
                     /locus_tag="SFLA_RS00450"
                     /old_locus_tag="Sfla_0102"
                     /db_xref="GeneID:11369507"
     CDS             complement(122502..124019)
                     /locus_tag="SFLA_RS00450"
                     /old_locus_tag="Sfla_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_014152245.1"
                     /db_xref="GI:503918251"
                     /db_xref="GeneID:11369507"
                     /translation="MSDLDASLIRMLVDSLARHRDAVAVIDDGVAHTYAELDEVSAEI
                     AGGLAAHGIGPGDVVDVHATRSWSRCAAVLGVWRVGAGVLSIDPAMPPAWTGKLVSSA
                     GCAMVLRAEECAPVGAGVAEHTFRSIRGTRRDEVATGPLCYVIPTSGSTGDPKAVAVP
                     PVVLADLGNWHVRRWSHDRPPNTLHMSSIGFDMVYEDTVATWLAGASLVVVNDQDRLD
                     PFTLIDIIREHEVARLFQPVVGLHGLAAAACVAGVGTPSLREISVAGEQLVINEEVRK
                     FCADGDLTLVNQYGPSETHVVTQYRLTGDVAEWPDRPPIGTAVVDAELLCLVDGRLRP
                     FTVGETRELVIAGNCVGVGYAGDDVLTAKKFRDVPHRDGRVRRCYFSGDLVTFDGADF
                     HFVSRLDDQLKVNGYRVEPGEVESVIAQVAGVRRAAVVGVKVGASTQLAAYYTPASGA
                     EVCRDDLIRSCDFGLPRFMVPRHFVELEELPSTRNGKVDRAKLREMFQERSMSRG"
     gene            complement(124016..124816)
                     /locus_tag="SFLA_RS00455"
                     /old_locus_tag="Sfla_0103"
                     /db_xref="GeneID:11369508"
     CDS             complement(124016..124816)
                     /locus_tag="SFLA_RS00455"
                     /old_locus_tag="Sfla_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020629937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_014152246.1"
                     /db_xref="GI:503918252"
                     /db_xref="GeneID:11369508"
                     /translation="MLTESQITEYRSEGFLLLEDVFDTGDIAALRREVTDLYGTEHPG
                     RIFEEDGTTVRGIHGCHTTGALFSRLVRLPELLTAAEQLLESKVHVFQCKVNAKKALR
                     GEVWQWHQDYSVWGPKDGMPEPRAVNVALLLDDATEHNGPLLVVPGSHRNGAIAPWRP
                     EPEGTSRWEADLSAKLKFALDAEQMAKVTAESEIRSVVGRAGSLLFFHPCIAHGSGAN
                     MAPTDRTMAFVSYNSVDNELREVPRPRPEFVASRDYRPLELVDGGLIA"
     gene            complement(124933..125163)
                     /locus_tag="SFLA_RS00460"
                     /old_locus_tag="Sfla_0104"
                     /db_xref="GeneID:11369509"
     CDS             complement(124933..125163)
                     /locus_tag="SFLA_RS00460"
                     /old_locus_tag="Sfla_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="WP_037659731.1"
                     /db_xref="GI:739807803"
                     /db_xref="GeneID:11369509"
                     /translation="MTADRVRAIWHRELQRDDIMPDDDFFALGGDSLVMVRIQAAFID
                     ELDAEVPMDQLFLNPTVRSISAYVDSRAALAP"
     gene            complement(125202..126788)
                     /locus_tag="SFLA_RS00465"
                     /old_locus_tag="Sfla_0105"
                     /db_xref="GeneID:11369510"
     CDS             complement(125202..126788)
                     /locus_tag="SFLA_RS00465"
                     /old_locus_tag="Sfla_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_014152248.1"
                     /db_xref="GI:503918254"
                     /db_xref="GeneID:11369510"
                     /translation="MILQGKRVPLPPSPVVHRRFEEHVRATPDAVAVVWSGEQVTYAE
                     LDARANRFAHLLTARGHGPGAKVGVCLDYSIDMVVAILGTLKAGAAYVPLDPAYPAAR
                     LRLLLGQVPGLALIVASSTTAAMVESGGVEVIDLEQLADHLATLPATVPDVHVTGDDL
                     CYAVFTSGSTGTPKLTAVRHEGWFNLMNWMQLEYGLHRGSHHLVVSAFGFDLSQRALM
                     TPLFCGATQHLMASRNFDVMLAHRMLTRYDIRVVHCASSTLYLLVDWESARGGDALAR
                     LDYILFGGEALKSERLARFARRPGTTCTLLHQYGVAECTDVATSYDLAHYRPGEHDIA
                     PVGRPVHNTAIHVLDADMHEVEAGLYGEICISGAGVGAGYLGAGGPENAKFTTLDVDG
                     KPVRLYRTGDRGRIDDSGELVVAGRMDDQVKVRGTRIDPTDVERALGRLVGIREAAVV
                     AVRDDGGEVELNAFVVPSGNDLAEDDLRARLLWTLPRNMLPSRFTNIPRIPLSPHGKV
                     DRAALAEICRPRGADSGSAA"
     gene            complement(127186..127962)
                     /locus_tag="SFLA_RS00470"
                     /old_locus_tag="Sfla_0106"
                     /db_xref="GeneID:11369511"
     CDS             complement(127186..127962)
                     /locus_tag="SFLA_RS00470"
                     /old_locus_tag="Sfla_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020629943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152249.1"
                     /db_xref="GI:503918255"
                     /db_xref="GeneID:11369511"
                     /translation="MQTLTETPALVENGFARWDLAEEFGISETDASFQSLRAEFVDLP
                     PDPYATEEGRNRRYARGIFLPWSREFSWIPDTHLGESGWMNGYWQADHNPDYVGVLRK
                     LPAMSEAARNNPIIHEILSFDFAQTRWSQSDAAFPLHVGVHLIKLAVDDSGSEAISSP
                     NELHQDGEPFVFAHLVYRTNVVGGSNVIAPPKYRGKLPEDVPEGEALAEFELTKPLES
                     YGVTDEKVSHYVSPIRRGEGPETGERAVVLVDFTPMRQHI"
     gene            complement(128021..128968)
                     /locus_tag="SFLA_RS00475"
                     /old_locus_tag="Sfla_0107"
                     /db_xref="GeneID:11369512"
     CDS             complement(128021..128968)
                     /locus_tag="SFLA_RS00475"
                     /old_locus_tag="Sfla_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl beta-hydroxylase"
                     /protein_id="WP_037659729.1"
                     /db_xref="GI:739807801"
                     /db_xref="GeneID:11369512"
                     /translation="MLRDDLDIERLEADLAALSGSEFWALQRSFEDGAVGEESDVDWK
                     VLPLRAPAGDLQRTDPGGPGRDGFADTPLMAKAPYLSRILSELGTELRSVRLMALAPG
                     VSVEEHSDTPLGLPYGYVRLHIPLVTNPGAVMVLDGVEQRWQPGTLWYADFERPHALR
                     NSGDRARIHLVADVATNDRLLALFPDSFRADLPASDIAYYRPVLPLTSRELEEFGCSF
                     AVPFSFMEWGEPVVDDHESDLPAEVTAEEGVLVLRAEGHAPVELLHLGAGEFRLLGWS
                     EERLLRLDLFDDDPRVELSTRRGRRRQVVRRPALRPATV"
     gene            complement(129130..130392)
                     /locus_tag="SFLA_RS00480"
                     /old_locus_tag="Sfla_0108"
                     /db_xref="GeneID:11369513"
     CDS             complement(129130..130392)
                     /locus_tag="SFLA_RS00480"
                     /old_locus_tag="Sfla_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_041825545.1"
                     /db_xref="GI:754215098"
                     /db_xref="GeneID:11369513"
                     /translation="MKGRDFRLFWFGETVSLLGNGIAVVALPFVAVLTLHAGTFVVGL
                     LTSVAYLPWLLLGLPAGAWVDRLPRRPVMLVSDAVSFVAFVSVPIAACAHVLTIPHLL
                     AAAFICGCASVFFTTAQRAYLPTLLSDAELLSGNARLQGSESTAEVIGPGLAGMLVQA
                     FGAVAGLLANALSFLVSWISLRAIRVTEPPPSPPPEVRRRRLRTEVRDGLRFLFRDRI
                     LRTLAVFSAVSNIALTGMSSIEVAFLVRTVGAGEAVVGAVLTLCGLGGVLGVLVSHQV
                     SRRYGSARAVVICLCGAAPFTLLFPLTGPGAGLAFFVVGGVGVGAGVVAANIITDTFR
                     QRYCPPDLIGRVSASAAVISFGAIAVGGLLGGVLGELSGVRETMWMMTGMYTLATVAL
                     VCSPIRKLRDFPESDESLRAAEAEKAVP"
     gene            complement(130416..134384)
                     /locus_tag="SFLA_RS00485"
                     /old_locus_tag="Sfla_0109"
                     /db_xref="GeneID:11369514"
     CDS             complement(130416..134384)
                     /locus_tag="SFLA_RS00485"
                     /old_locus_tag="Sfla_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_014152252.1"
                     /db_xref="GI:503918258"
                     /db_xref="GeneID:11369514"
                     /translation="MAPVSYAQRRLWFLNRVNGDSGVYNCPLVVRMRGDLDRAALAAA
                     LVDLADRHEVLRTVYPAVQGEPVQHVSARPPELEVVTCQEDGLAAMLSAAVDRGFDLT
                     ADLPVRATLFAPAPREHVLALVLHHIACDEGSWQPLLTDLATAYRARAAGGPPRWEPI
                     PVTYRDYAVWQRDLLGEEDDPASLLSAQLSFWREQLAGLPAELDLPFDRSRPATADHR
                     GACVPMKLDGDLHRRLLAVAADHGCTTFMVLQAGIAVLLSRLGAGTDIPLGTAVAGRL
                     DDALEGVVGFFVNTLVLRSDVSGDPTFGELLHRVRDADVAALDHQDVPFERLVEDLNP
                     ERSLARHPLFQVMLTLSAGEAETFSLPGLTCAEEPLDWEVAKFDLSFDFREHRTPDGE
                     AAGIDGSLEYATALFDRATVDHIADALPRLMRQLVSAPRRPVGDADPLSAEHRHQALV
                     AWNDTALPVSRTSVPELFEAQAARTPRATAVVCGNTRLTFAELNSRANVLARRLRDLG
                     AGAERLVALALPRSAESVVAMLAVLKTGAAYLHVDLEYPPDRIEHMLRDAAPLAVVTD
                     TATAAAHGFGQLPVVFADRIGTPSGPVADLNCRVRPDSAAYVIYTSGSTGRPKGVVTP
                     HAALSNLYAFHRAGLIARTEAAAGRPLRSAVTASLSFDTSWEALFWMLAGHELHVVRD
                     DVRRDAVALTDYVRAVGIDVLDVTPTYAEHLLDEGLLSGTGAPLVLLLGGEAAGQSLW
                     TRIREAAGTLCLNLYGPTECTLDALWWDAADSPHPLIGRPIGNTRVFVLDERLRPVAP
                     GVPGELYVTGPGVARGYLNRPAATAERFVACPYAAEGETGTRMYRTGDLVRWDRQGRL
                     DYLGRVDDQVKVRGFRIELGEVETALAGCPGVAQAAAAVREDTVGGKRLVGYVQSAAD
                     HGFDPRELRNRLASVLPDHMIPSFFQPIDRLPMTPNGKLDRSALPPPDFARRPASRGP
                     RGPYEEVLCDLFAQVLGLSRVGAEENFFELGGHSLLAVRLLSRVRAVLGGRLTLVDLF
                     QAPTAADLADRLGAGARHDPLAPLLPLRTGGDRPALFCLHPAAGISWGYAGLLGHIDA
                     GYPVYGLQARGLTDAKACGGAWRAMVEDHVEQIRSVQPRGPYRLIGWSFGAVLAHLVA
                     TDLQADGDEVDLLVLLDGYPPDSVPGYRPLEDGSPETFTELLDSLGYDLPEGGGEPLG
                     FDAYERTVRRPGSTLEWLTREEAAALSRVFVDNDRIYQELRPRTYRGDMVFVSATEGR
                     PADAPAPESWRGHVTGTLEVHDVDCAHGEIAQAEPMSRIGAVVAQKLALLDTPRATAV
                     ER"
     gene            complement(134394..135164)
                     /locus_tag="SFLA_RS00490"
                     /old_locus_tag="Sfla_0110"
                     /db_xref="GeneID:11369515"
     CDS             complement(134394..135164)
                     /locus_tag="SFLA_RS00490"
                     /old_locus_tag="Sfla_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014152253.1"
                     /db_xref="GI:503918259"
                     /db_xref="GeneID:11369515"
                     /translation="MSGPQDTTLVPLHRTPNARRTLVGLSFFGGGTAAYQPWTGHMPA
                     DTDLVVVCYPGREGRFAEDFARDWEELATDVARSLREADLGPYILFGHSMSGWMAFDV
                     ASRLDGDEARRPRALVLSSCNAPDRGLTESELLPTPQDPDERLLEWLETHGLLPRHVR
                     EHAGLTEVALELMRADVDVRNTFVYRGAEVSVPLQVFLGADDPLISSDAAVRWNALTS
                     GAYRYDVLGGGHFYTPEIWQSLPSRIAETTFAPTGPVS"
     gene            complement(135161..135433)
                     /locus_tag="SFLA_RS00495"
                     /old_locus_tag="Sfla_0111"
                     /db_xref="GeneID:11369516"
     CDS             complement(135161..135433)
                     /locus_tag="SFLA_RS00495"
                     /old_locus_tag="Sfla_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic synthesis protein MbtH"
                     /protein_id="WP_014152254.1"
                     /db_xref="GI:503918260"
                     /db_xref="GeneID:11369516"
                     /translation="MNNPFDAEDGSYLVLANAERQHSLWPAAIDVPAGWSTVFGADTR
                     TACLAHVEKNWTDMRPAGLAAAMDEGPQPAANGTADGGPTSTGTSR"
     gene            complement(135548..136528)
                     /locus_tag="SFLA_RS00500"
                     /old_locus_tag="Sfla_0112"
                     /db_xref="GeneID:11369517"
     CDS             complement(135548..136528)
                     /locus_tag="SFLA_RS00500"
                     /old_locus_tag="Sfla_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_014152255.1"
                     /db_xref="GI:503918261"
                     /db_xref="GeneID:11369517"
                     /translation="MLTTFGLELMEEAVYRELSASPPPAAEEIADRLAAAPGLVRECL
                     DRLLELGLVRPSFEVPDGFTAVDPILSLQESLAGQHEELVRRQRRLAETHAEVVRLLM
                     SDASGRPGRGEQVERLLGMDDVQRRVDRLAGEAVREVLAFVPGGARSTPELSAARRND
                     AALLSRAVSIRAVGTDTDSYDAATLAHVRWLTGNGGRFRGCATPLPEMIVFDGSVALV
                     PLDPRNTAAGALQVADPGLVAPLVVLFEQTWSSAAPLDPGRLPADDIPNGKERALLRL
                     VAEGCTDAAAAGQLHVSHRTARRMMAVLMERLGARSRFEAGVKAARRGWL"
     gene            complement(136568..144505)
                     /locus_tag="SFLA_RS00505"
                     /old_locus_tag="Sfla_0113"
                     /db_xref="GeneID:11369518"
     CDS             complement(136568..144505)
                     /locus_tag="SFLA_RS00505"
                     /old_locus_tag="Sfla_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_014152256.1"
                     /db_xref="GI:503918262"
                     /db_xref="GeneID:11369518"
                     /translation="MNQSAVEDILPLSPLQEGLLFHALFDRQKHSPYLAQFAVDLDGP
                     VDSALLRAAAETVMRRHATLRSGFRYRKTGEPIRVVRRDVQLDWREIETGQDDTPERI
                     AELTEQDWARGIDVGGSSLIRFTLLRRTDRRHRLLVTAHHLLLDGWSFALLFQELFAV
                     YSRAGGTAGLPPVRPYRDYLAWVARQDRVGAERHWAMALEGVSEPTFVASADSPSGPP
                     PEEVAVLLPSETTALLTAYARSNHVLLNTVCQGIWAILVGSLTGRDDVVFGSTVSGRP
                     AELAGADSMIGMLINTVPVRVRLDPAASLSALFEQIQAGRAASLDHDHLGLTEIQRVT
                     GLPTALFDTNVVFDNFPMHDYKVDSPDGELEVGVTFRDSAHYPLTLAVEPGERLALRL
                     HYRPDLFTADRAAELADRLVLLLEQVAENPDRPLSALTLLSPEQHDRVVRTWNATAVE
                     LPEVTLADLWSEQVRRTPEATALVASDERLSYAELDRRVGLLAAQLAHRGAGPDRVVA
                     VALPRSVELVVAILAVVRAGAAYLPVDLDHPAGRIAAMVADAGPILALTDSENAGALP
                     GPTPKLLLDEPIAPVSARPVPPLPAHSAYVIFTSGSTGRPKGVVVPHAAIVNRLLWMQ
                     AEYRLTGADRVLQKTPAGFDVSVWEFFWPLISGATLVLAKPGGHRDPAYLAELIQRES
                     VTVTHFVPSMLQAFLREPGAAGCTGLRRIISSGEALAAETRRELFDTLGSCELHNLYG
                     PTEAAVDVTSWQCHRGDEGSTVPIGRPLANVSAYVLDGGLRPVPPGVVGELYLGGVQL
                     ARGYTGRPALTAERFVACPFAAGERMYRTGDLARWTPGGELEYVGRADAQVKIRGFRV
                     EPGEIEAVLAGHPAVVQAAVVLREDRPGDQRLVAYAVPRAPGLTDRELRRFMADSLPD
                     YMVPAAVVLVGAMPTTTNGKLDRAALPEPDRAAHTVREPRSPREEILCELFAEVLGVP
                     RVGIDDHFFDLGGHSLLALRLLSRIRSVLGEGFEIRDLFAEPTVAGLARLTGAARPAL
                     TARTGAEPVPLSYAQRRLWFLNRMERDQGTYNVPVAVRLTGVLDRDALAEALADVARR
                     HESLRTVFPEEGGEPYPVGLDSVPAIEVVEVAPPDLADAMAERVRHRFDLTAHAPVRV
                     TLFASAPHEHVLLLVVQHIAADGWSLRPLLRDLGLAYTARRAGSAPDWPPQPVRYADY
                     TLWQRELLGDAEDTTSLMARQIDYWRDHLADLPAELTLPADRPRPAVPTQSGGTVAVH
                     WEPELHSRLLELARSAGCTLFMVLQAGFAALLTRMGAGTDIPFGTPVAGRSDSALDDM
                     VGFFVNTLVLRTDTAGDPGFAELLRRVRDTDLEAFAHQDVPFERIVEVLRPERSLSQN
                     PLFQVMIQVQPADTTTPGFAGLKAEPAPVSWDVAKFDLSLELVDGRDDRGAPAGLTGY
                     LEYAEELFDRTTAEQLVTRLRRLLEQVLAEPERPVGAVDVLSDGERRLFLAAGPVPAL
                     APRPVFLPEAFRQQVARTPDARALVFEDTALTYAELDARVTRLARHLVRRGAGPDRVV
                     AVALPRSTDLVVALLAVLKAGAAFLFVDLAYPARRIAHLLEDSAAALVVTDGESAASL
                     PVREPVLVDSPALDGESAQDLEIALAADHPAYVVYTSGSTGVPKGVMVTHGGLANLLA
                     FYREEVIATAERTRGPRRCRMALTASLSFDTSVVGLLWQASGHELHLIGDDTRRDPAA
                     MARYMERCGIDALDVMPSYAEELIQQGMLDPAGTPPAVLMTGAETVGEKLWTRIREAE
                     GITVYNIYGQTETTVDSLFWTSEESDRPLVGRPIPGVDVFVLDQDLRLVPPKVIGELY
                     VGGAQLARGYMNRPALTAERFVANPFRAGQRMYRTGDLVRWTDEGALEFLGRADDQVK
                     IRGFRVELGEVEAALARHEGVAHAVAVLREDRPGDSRLVGYVLARDTALDARRLREFA
                     RQNLPDYMVPAAIVVIDELPLTPNGKLDSAALPAPVYPTEARRAPRNLREELLCGLFA
                     AVLGRDTVGIDDSFFDLGGHSLLAVRLSSRARSVLGVELPARLLFSTPTVAGLADSLG
                     DVLPARPVLRAGTRPDVLPLSYAQQRLWFLDQWEETGTSYNLPVALRLTGPLDREALG
                     QAWSDVTDRHESLRTVFADRDGRPVQSVSAPGGVRPELVHREVPEAEVEEAIRAAAYH
                     PFDLAAQPPAAAHLFTTGQEDHVLLLVFHHIICDGWSLGPLMRDLSAAYAARVLGDAP
                     QWDELPVHYADYALWQRDLLGAEDDEDSLLSRQLNHWRAQLADLPVELALPTDRPRPG
                     TSDYAGGSAEVAWGPELHRHLLALAKEHGCTLFMVLQAGFAALLSRLGAGTDIPIGTP
                     VAGRTDDALDEVVGFFVNTVVLRTDVSANPSFAELLRRVRATDLGAYEHQDVPFERLV
                     EEVNPPRSLGRHPLFQVMVQLQHAAAGPRFPGLRAAEHHIPSATAKFDLVLDVEERLD
                     KDGAPAGLDGALTYATALFDASTGERLADGLRHVLTQVARDPERTVADLDVPPVQDRR
                     SGDVAVGPASVPGAAPTATVPRTAHEEVLGELFAQVLGRDSVGLDDNFFALGGHSLLA
                     IQLISRVRSALGLELPVRELFRAPTAAGVAAYLAEARPARPALRPADAH"
     gene            complement(144523..146274)
                     /locus_tag="SFLA_RS00510"
                     /old_locus_tag="Sfla_0114"
                     /db_xref="GeneID:11369519"
     CDS             complement(144523..146274)
                     /locus_tag="SFLA_RS00510"
                     /old_locus_tag="Sfla_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_041825270.1"
                     /db_xref="GI:754214640"
                     /db_xref="GeneID:11369519"
                     /translation="MVGGTPVTRHQRVLCQLVADVLGVSGVGIGDGFVALGGDSIIAM
                     QLVGRARKAGLRITVGDVLTRRDMEALAQTATPLDQEPAPVADNGVGPVVTTPIMHWF
                     RERGGAVDTYNQFAVLRTPSGLTEPRLVSMVQALLDHHDILRLRLSVPGDGADWSLET
                     LPAGAVDAASAVRRIDVAGGPEQDWAGLVRQESDVARDRLRPGEGNVLQAVWFDAGPD
                     RRGVLALVVHHLAVDSLSWRILAADLASAWQAVEQGAAITLDPVPTSFRRWSHILAEQ
                     AHTQTAIAELPGWLDRLRPGSGRFGDPVRVPGQDVESRDRSFTESLPAEFTEALLTTV
                     PSLFNAGINDVLLAGLALALGDWHRGRGTVGDGTALLHLEGHGREEALAEVDLSRTVG
                     WFTSLFPIRLDLGEADRTDAHAVGAEVGNAVKRVKEQVRGVPDKGVRYGLLRYLNPET
                     GELLEEAAQPEFVFNYLGRFEASDDADWSVVAEYGTGLDDTGSGMPMAHSIEVNAATV
                     DRTDGPVLRATWTWADSVVSEADTRELADGWFRMLRALVAHAREPGAGGLTPSDLTLS
                     SLSQHEIEEIESDLRAF"
     gene            146517..147908
                     /locus_tag="SFLA_RS00515"
                     /old_locus_tag="Sfla_0115"
                     /db_xref="GeneID:11369520"
     CDS             146517..147908
                     /locus_tag="SFLA_RS00515"
                     /old_locus_tag="Sfla_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--scyllo-inositol aminotransferase"
                     /protein_id="WP_014152258.1"
                     /db_xref="GI:503918264"
                     /db_xref="GeneID:11369520"
                     /translation="MTIQQPARQTTDLAMFGGDRAVPRELGIRPWPMVTGQDEQAVHR
                     VLRSGRFTSASSGEQEIAGLEREWARFVGTEHCVAVSNGTAALSVALGAAGVEPGDEV
                     IVPALSFIGSATAPLHLMAVPVFVDIDPVTFNLDPAALEAAITSRTKAIVVVHLHGLP
                     ADMDRITEIAARHGITVVEDAAQAHGARYRGRSVGSIGAVNTFSLNVSKNLATCGEGG
                     LITTDDADVATRALMLRQFGELIPARGERSYVAHLLGWNCKPNAIQAAFTRSRLTQLP
                     AEMAVREENVGRLLGRLAAYPGFLVPQVPQDRTHAWHILRIRVEPAAFGLADELAGPL
                     RSVLQRALRAEGVPAVPYQLQPLPAQRVFTGRRGFGGYPWALPGVVDRPYRPGDFPAT
                     LRVLDDSFTIQKAHLHPDSGPLLDRYADAFDKVWLNREALAAIAATTDYTPHWERASE
                     IADTEWAGAFDAR"
     gene            complement(148013..148978)
                     /locus_tag="SFLA_RS00520"
                     /old_locus_tag="Sfla_0116"
                     /db_xref="GeneID:11369521"
     CDS             complement(148013..148978)
                     /locus_tag="SFLA_RS00520"
                     /old_locus_tag="Sfla_0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014152259.1"
                     /db_xref="GI:503918265"
                     /db_xref="GeneID:11369521"
                     /translation="MPVVTAEPTVPDEARAAREVYRDVLVELLGEDERYVCLDSDTGL
                     FSATSWGEGARRYLNLGIAEQNLMGVAAGLARSGRIPFVNTMATFAATRALEAVKLDI
                     AWNDLPVRIVATHGGLSAGHLGSTHHALEDLAVMRMLPNMTVLVPADGPATESLVRAG
                     AELPGPVYLRLGRGATPSIAPGAEPLRIGVAQSLRRGSDVTLIATGPHPVLTAVETAE
                     ELARDGIDVAVLNMHTVKPLDREAIVAAATGTRGIVTVEEHWAAGGLGSAVAEVVADL
                     GAACPVRRVAVADRFAAGTGGHRHLLARNGISRATVTEHVRRLLA"
     gene            complement(148966..149793)
                     /locus_tag="SFLA_RS00525"
                     /old_locus_tag="Sfla_0117"
                     /db_xref="GeneID:11369522"
     CDS             complement(148966..149793)
                     /locus_tag="SFLA_RS00525"
                     /old_locus_tag="Sfla_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014152260.1"
                     /db_xref="GI:503918266"
                     /db_xref="GeneID:11369522"
                     /translation="MSDDHARTARELIVRMCANPEGGHLGGSMSMVEILVTLYRHVLR
                     IDPDRPQAPDRDILLLSKGHGAIGLYAVLAERGFFPAELLASYGTPDSMFTAHPNPAV
                     PGVEMPTGSLGHGLSLGVGFALAARLDGSDRRCFVVLGDGELQEGSVWEAAMAAGSQK
                     LDRLVAIVDRNGLQISGDTEETMGLEPLGDRWRSFGWTVLEVDGHDPEQLRTALSRIP
                     CTPGTPTVLLARTVKGKGLPYIEGQARSHYVRLTERGYRRARAAVTRGERTETTCPS"
     gene            complement(149790..150854)
                     /locus_tag="SFLA_RS00530"
                     /old_locus_tag="Sfla_0118"
                     /db_xref="GeneID:11369523"
     CDS             complement(149790..150854)
                     /locus_tag="SFLA_RS00530"
                     /old_locus_tag="Sfla_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
                     /protein_id="WP_014152261.1"
                     /db_xref="GI:503918267"
                     /db_xref="GeneID:11369523"
                     /translation="MTIFSDTAAIDLLHGMLKIPSPSFAEAELAAHVVAAMRGAGLTA
                     RVDGVGNAVGEIRRGPGPTVMLLGHMDTVPGDVPVRLDGDRLYGRGSVDAKGPLATMI
                     CAAANSTGFRGRIVVVGAVEEETTMSRGAMEIRRTHEPPDALIIGEPSGCDTVVLGYK
                     GKLDLRYDVRCEATHPSNVVPKASELAARAWTELLDLLGPEASHARFDSPGPTLTSIS
                     GGLDAATAEFSVRIPPGFDAGGLVAALSERLGPDTLQVVNTVRACRVDRNDPVVRALS
                     VAIRAEGGSPRAKVKTGTSDMNTLAERWTVPMATYGPGDSSLDHSDREHIKLSEYLFG
                     VGVLTRALTGLGEHLTGENR"
     gene            complement(150851..151672)
                     /locus_tag="SFLA_RS00535"
                     /old_locus_tag="Sfla_0119"
                     /db_xref="GeneID:11369524"
     CDS             complement(150851..151672)
                     /locus_tag="SFLA_RS00535"
                     /old_locus_tag="Sfla_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="WP_014152262.1"
                     /db_xref="GI:503918268"
                     /db_xref="GeneID:11369524"
                     /translation="MRDILVVKCGGNAAVRSQAICADVAAVHRGGRPVILAHGGSADI
                     DGLAERLGVPSRRLVAPDGVSTRYTDERTLEVVQLALAGSAKPRLLAELRACGVDAVG
                     LTGLDAGLLVAARKSAHRAVVDGRRVVVRDDHSGRITAVNGDLVSTLLASGLLPVVSP
                     PAVAEDGRVVNTDADRAAAAVAGAVGADTLLLLTGARGVLADRHDERSVLPVCRVPRR
                     GTPPVVTGGMGIKLVAAREALLSGVRRVLIADGRRPRPVQEALAGSCTEVLLEEE"
     gene            complement(151692..152723)
                     /locus_tag="SFLA_RS00540"
                     /old_locus_tag="Sfla_0120"
                     /db_xref="GeneID:11369525"
     CDS             complement(151692..152723)
                     /locus_tag="SFLA_RS00540"
                     /old_locus_tag="Sfla_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_014152263.1"
                     /db_xref="GI:503918269"
                     /db_xref="GeneID:11369525"
                     /translation="MLRVAIVGASGYIGGELLRLLLGHPRVTVVAATSDRLAGRRIDG
                     PHPNLRGHTDLCFVGHDTLENTDFDVLFLAAPHRETMGRMAAFLELARTVIDLSGDFR
                     LRDPEVYASYYGVAHAAPQLIPEFTTGLPEWHRARLTTSDRIAVPGCMATAGILAVRP
                     LALEGLIEGTVRVDARTGSSGSGVSAGAAGAHAERSGALRVFAPSGHRHEAEIAQATD
                     RTVRMTATGVEAVRGVQVLCQVELASGVSEKEIRSVFRAAYANEPFVRVIAQRQGLYR
                     LPEPKILTGSNFCDVGFAVSADDGTALLVGALDNLVKGGAGGAVQCMNVRFGWPERTG
                     LEFFGLHPN"
     gene            complement(152711..153577)
                     /locus_tag="SFLA_RS00545"
                     /old_locus_tag="Sfla_0121"
                     /db_xref="GeneID:11369526"
     CDS             complement(152711..153577)
                     /locus_tag="SFLA_RS00545"
                     /old_locus_tag="Sfla_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-L-glutamate ligase"
                     /protein_id="WP_014152264.1"
                     /db_xref="GI:503918270"
                     /db_xref="GeneID:11369526"
                     /translation="MSPAEPFVVLASRVGASEKRILEALSRRGIAHRHIDSRTWWHPL
                     GDRGAHPIVLNREIGLARATYAAEALEAAGSIVVNSARATALCGDKWRTSAALVEAGL
                     PTPRTALGLTPEAALTALESIGYPAVVKPLQGSWGRLVSALPDRQTAETVLEYVAALP
                     SPQARIVYLQEWIAKPGRDIRVIVVGGEALAATYRRSEHWRTNVARGAVSELCPMTPD
                     IAKLAVRAAQAVEAEIAGVDLIEDGTGELLVLEVNHGVEFSGLQQALGDAVSVADRIV
                     EFLLEKSRSCSE"
     gene            complement(153574..153738)
                     /locus_tag="SFLA_RS00550"
                     /old_locus_tag="Sfla_0122"
                     /db_xref="GeneID:11369527"
     CDS             complement(153574..153738)
                     /locus_tag="SFLA_RS00550"
                     /old_locus_tag="Sfla_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020629959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysW"
                     /protein_id="WP_014152265.1"
                     /db_xref="GI:503918271"
                     /db_xref="GeneID:11369527"
                     /translation="MVTCPECESSVVPAGTPVIGEIVECGECASELEILTLDPIRAAL
                     APEIEEDWGE"
     gene            complement(153824..155332)
                     /locus_tag="SFLA_RS00555"
                     /old_locus_tag="Sfla_0123"
                     /db_xref="GeneID:11369528"
     CDS             complement(153824..155332)
                     /locus_tag="SFLA_RS00555"
                     /old_locus_tag="Sfla_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014152266.1"
                     /db_xref="GI:503918272"
                     /db_xref="GeneID:11369528"
                     /translation="MNNRLRNTVRGIGDREREVLGRTGGDTLGEIDRRMNTGPHAVVK
                     NVATGLLLSERAVAGPRQRLLSTRSEGPRESASFADLLKRHRGRSGLTQQQLADFATL
                     SVRAIRDLESGRVRRPRRESVGLLADALRLRDAERQQLHAAGGSPAHLRDALLGLPAS
                     SAPPALPEPPAPPGTLVGREAELQVLLDQVTVYGHRLVSVVGISGIGKTHLVLEAARV
                     LRAKGWRVGWHASAGGTRCCGAHPAAGPDPGGPSPRTADPTADLVAAIGERHDLVVID
                     SGDASGPGGVDVGELLRRCPGLHVVVTGLTPRYLPGERVLPLTAMAVPEEAPGHDHVR
                     LAEVESVALFLSHMRRSQPGFRLREDNAHAVVRLCRWLDGVPRALEYAAGWCLVYPPE
                     LLLARAGRDFSLLSSPAGCGCQDLLSSVARSVDIVAQSCRSVLAEVADRPHWTVGDLD
                     HLVPDPAAALHALLVHGLVRPAGAHLPGRFTALQLVRLLHLRDRPPAAARAC"
     gene            156195..157211
                     /locus_tag="SFLA_RS00560"
                     /old_locus_tag="Sfla_0125"
                     /db_xref="GeneID:11369530"
     CDS             156195..157211
                     /locus_tag="SFLA_RS00560"
                     /old_locus_tag="Sfla_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_033249789.1"
                     /db_xref="GI:702732630"
                     /db_xref="GeneID:11369530"
                     /translation="MGDTLRAEEAAVYRWLALHGRLDPASMAEETGVDATAVSGAVER
                     LVRIGLVHRGEEGDDRLWAVDPHLVAAVTTAPVERAIAEQQTRLRLFQDQFAQLAVDY
                     DEGRRSASKDLETIPGLTHVRAALNRAAEQCREDMVTVQPGGTRPPEVLQDALRRDSQ
                     MLARGVRMRTVYHHTARFNSPSQAYVATASALGGEYRTAHQLVGRMIIFDRELAFMTR
                     RNDRLGAVVVREPSVVHFLYELFEQLWSQAQPFSDAATDGLEAVAKDLDRTILRLLAS
                     GLKDETIARRLGMSLRTTRKHIADMMQALGAESRFQAGVAVSARGLLNDDGEPDGAPT
                     TALA"
     gene            complement(157242..157757)
                     /locus_tag="SFLA_RS00565"
                     /old_locus_tag="Sfla_0126"
                     /db_xref="GeneID:11369531"
     CDS             complement(157242..157757)
                     /locus_tag="SFLA_RS00565"
                     /old_locus_tag="Sfla_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152269.1"
                     /db_xref="GI:503918275"
                     /db_xref="GeneID:11369531"
                     /translation="MPERRVLGQPLRSFVDELALCVAANGGRGPALSWPEDPMTLPAL
                     LELPRPARPAPGVNSTVPGGPGAEELAAELGRRLQLRVRPSFRFLSPDSPVVENVPNG
                     AESTVTVLEGACRCVLSRVGEDPAPGPSHPLGMRLRSGGTLFVPQVHTYRLSEIHVPT
                     TLLRLDLESPD"
     gene            complement(157974..158258)
                     /locus_tag="SFLA_RS00570"
                     /old_locus_tag="Sfla_0127"
                     /db_xref="GeneID:11369532"
     CDS             complement(157974..158258)
                     /locus_tag="SFLA_RS00570"
                     /old_locus_tag="Sfla_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_037815523.1"
                     /db_xref="GI:739965254"
                     /db_xref="GeneID:11369532"
                     /translation="MIDRLREVVRVLSGREREVLAHIARGATYREIARRMDVSLHTVD
                     TYIRRIRAKTGSRNRMHLLLLALSVEGSLVSAIEDLGLSVTPKPPGRSPV"
     gene            159069..160241
                     /locus_tag="SFLA_RS00575"
                     /old_locus_tag="Sfla_0129"
                     /db_xref="GeneID:11369534"
     CDS             159069..160241
                     /locus_tag="SFLA_RS00575"
                     /old_locus_tag="Sfla_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar hydrolase"
                     /protein_id="WP_037659749.1"
                     /db_xref="GI:739807822"
                     /db_xref="GeneID:11369534"
                     /translation="MVAALALAGGSLVVTQVTAATEAAAVPTTIPLTLTNNSGRGEQV
                     HVYVIGTELSSGRQGWADASGAFHPWPAGGNPPTPAPDASIAGPANGQSKTIRMPKFS
                     GRVYFSYGQKLVFKLTTGGLVQPAVQNPSDPNANILFNWTEYTLNDAGLWINSTQVDM
                     FSAPYAVGVKRPNGTTLATGHLKPGGYKAFFDSLRSQPGGWGGLIKTRSDGTILRALA
                     PGHGIEAGALPASVMNDYVNRVWSKYSSQTLTVQPFKDQPNTKYFGRVQGNTMNFTNS
                     SGAVVTSFQKPDSDSIFGCYKLLDAPNDLVRGPISRTLCAGYNRSTLLSNPNQPDANN
                     ANFYKDAVTNHYSAKVHAQMADGKAYGFAFDDVGAHESLVHEGDPQQAYITLDPFN"
     gene            160486..161022
                     /locus_tag="SFLA_RS00580"
                     /old_locus_tag="Sfla_0130"
                     /db_xref="GeneID:11369535"
     CDS             160486..161022
                     /locus_tag="SFLA_RS00580"
                     /old_locus_tag="Sfla_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase reductase"
                     /protein_id="WP_014152273.1"
                     /db_xref="GI:503918279"
                     /db_xref="GeneID:11369535"
                     /translation="MSDTSTGKVVVNRVMSLDGFIAGPGHTMDWIFEHMTSATFPEVM
                     AATGAMLIGRGTYEVGKRMSAENTGYDGGAQFVLTHRPPDEPDPEVTFLTCDIEEAVA
                     RAHRAAGDKNLEILGADVAAQCLQRGLVDEILVYVLPVLLGDGVRFAPPGLHRIDLEP
                     LGNVQSGGVTMLRFRVRT"
     gene            complement(161153..161653)
                     /locus_tag="SFLA_RS00585"
                     /old_locus_tag="Sfla_0131"
                     /db_xref="GeneID:11369536"
     CDS             complement(161153..161653)
                     /locus_tag="SFLA_RS00585"
                     /old_locus_tag="Sfla_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152274.1"
                     /db_xref="GI:503918280"
                     /db_xref="GeneID:11369536"
                     /translation="MDTTPEAVHRRIAAALAAFVAVGAAVSGFLLNGSPTAAVWAVAG
                     GSGTALGMFMVRRRVLATLEESRGTAMELGYAEGIGDMVVVGLHAYAAAVFPMTGPGG
                     VSMAERLKRRDLAYQLTATEGLPHHVAERAAAALEAIDAGRDHERVQSALNDLMRAVH
                     EQRRRV"
     gene            complement(161714..162691)
                     /locus_tag="SFLA_RS00590"
                     /old_locus_tag="Sfla_0132"
                     /db_xref="GeneID:11369537"
     CDS             complement(161714..162691)
                     /locus_tag="SFLA_RS00590"
                     /old_locus_tag="Sfla_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152275.1"
                     /db_xref="GI:503918281"
                     /db_xref="GeneID:11369537"
                     /translation="MGNDDLRIAREAKARFGPQLLAHPDVDGVGVGRRRRAGDKTDEY
                     AVVVHLREKQPESKIPPARLLPAELRFTERSGRDVSVRVDVQQHPKPTPQTDRVRPVP
                     GGVSVGTVGAHVGSGTLGGWVWDTVTRQVVALSNAHVFGSRPGVSIIQPSSDDGGVTP
                     DDRIASVMRTGSLDAAIAEPADPSFVSASIVQGGPAVFEIAEATLDMRVQKTGRATGL
                     TFGTVDLIDFDSDYRGSHSDLWIDAEGADFSLGGDSGALYLLAPGSAAFATGRRQAVG
                     LHWGGSGQDGVGHHIRAVFDDLKLSTLPSGTGVPAVDGITEPDRSMRPG"
     gene            complement(162710..163060)
                     /locus_tag="SFLA_RS00595"
                     /old_locus_tag="Sfla_0133"
                     /db_xref="GeneID:11369538"
     CDS             complement(162710..163060)
                     /locus_tag="SFLA_RS00595"
                     /old_locus_tag="Sfla_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152276.1"
                     /db_xref="GI:503918282"
                     /db_xref="GeneID:11369538"
                     /translation="MGTYVDQAKGDGELLADVPVDTFRSHIRFIEKHNLWDEVRGALA
                     EAGVDTVAMDIRPVRVISELVAAKGSALPEEADHSGAVVTPECGCDSISGRPPVTPVG
                     GGDAGAGDAGARPQ"
     gene            163370..163834
                     /locus_tag="SFLA_RS00600"
                     /old_locus_tag="Sfla_0134"
                     /db_xref="GeneID:11369539"
     CDS             163370..163834
                     /locus_tag="SFLA_RS00600"
                     /old_locus_tag="Sfla_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152277.1"
                     /db_xref="GI:503918283"
                     /db_xref="GeneID:11369539"
                     /translation="MKLSYDEIVQMLRDRPERTRTYEVESGVIERLPSDTPACLRPMD
                     EDEVQELADYLRVAPSLLHGPFHVVDHTCSSCARTTTFLDFVKTAVDARLHSRDTLRS
                     VLTDDEAAWVTVRGQDGGRPVVCANCGNTLLGALKCGGGEYSEYSSGTYAYA"
     gene            complement(164000..165859)
                     /locus_tag="SFLA_RS00605"
                     /old_locus_tag="Sfla_0135"
                     /db_xref="GeneID:11369540"
     CDS             complement(164000..165859)
                     /locus_tag="SFLA_RS00605"
                     /old_locus_tag="Sfla_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="WP_014152278.1"
                     /db_xref="GI:503918284"
                     /db_xref="GeneID:11369540"
                     /translation="MRFLVIVPVSPSAAGSLTGSGISYRPDLHTAQDSTLAGALSEMC
                     PQVLVTDRPVAREVLRLWREAMPERPIAVVRLTESHGSLRRLPTMHGRATSAILPFSI
                     PMYTVPRQPGSDGGVDEDASVFEALAVAERFAQDREQTTEPFPVTATPSGAASGRTSV
                     LMIGGGVVNLVTARLLQAEGYEVAMVDAAPDPRAGRPWAAYGASRGGGNARMFTYTEM
                     DDYHAKSTDESACMTVFDRPPSESGWDVRGHEGEEDQQWVQDFRSVPPWLARAYNGDI
                     LGLNRRGGELWQTWMHTRPHLFDDVELRHDILRLYQDGPHLEAARHRQNAVGATVASY
                     GAAEVRERFPALAHAAPQAFAGGIVVEGFTVNVHDLMGRLLDDLEAGGARMRFDLRVE
                     EIMRDGTSAVTGVLTADGPLVYDHYVVSPGAGNEALRRQIPSLRQVHGVLGCWATVPN
                     VTPALGHSLKVARRGHVAEDANITVGRDDSGESVLMIGSGYGWTGGDPRNIDERKIED
                     IHAAVADTVETLFPDAYEKIGGRDGLRRTQRHCVRPWTASNLGIFEASAAAGGAFVVT
                     AGHNTGGFAQAPVIAEAVSHALRGVGHPMHTLYHPLRTSRVLHAMAGLGGTTH"
     gene            complement(165847..167196)
                     /locus_tag="SFLA_RS00610"
                     /old_locus_tag="Sfla_0136"
                     /db_xref="GeneID:11369541"
     CDS             complement(165847..167196)
                     /locus_tag="SFLA_RS00610"
                     /old_locus_tag="Sfla_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_014152279.1"
                     /db_xref="GI:503918285"
                     /db_xref="GeneID:11369541"
                     /translation="MHTYGTQTVNSRGHLEIGGCDVLDLAKAYGTPVYVIDESAVRDR
                     CRSYLRAFRSKWPHVDVAYASKAFLVGEMVRLAAEEGLSLDVVSAGELRLALWAGASP
                     SKITFHGNYKTGEDIELAVCSRVRSLVIDCLDEIDLIDRQAREHGRVQDVDIRLNLGI
                     DIHTDPKYTTGDEASKFGLPVRRGDAASAVARVLTRDHLRLRGLHFHLGAQVLDTKYH
                     RQALNEVGEFVRTVTARTPWKPQSITVGGGMGVNYDGVSSPPPPSEWARDLLSVFGEQ
                     VAPYCAPDVVFGVEPGRSVIAEAGSTLYTVGPTKRSGDRRLVAVDGGLSDNPRPLMYQ
                     SVHNVVLASNPELRDTELHEATIFGRHCETDRLIDGVRLPDLPPGEVLAVQCTGAYTH
                     SMFNQHNRFDKPPVVFVRDGRSRLVVRRERFSDTILTEIRSAAADSSDRPGEKQCAF"
     gene            complement(167335..168576)
                     /locus_tag="SFLA_RS00615"
                     /old_locus_tag="Sfla_0137"
                     /db_xref="GeneID:11369542"
     CDS             complement(167335..168576)
                     /locus_tag="SFLA_RS00615"
                     /old_locus_tag="Sfla_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_037829353.1"
                     /db_xref="GI:739979184"
                     /db_xref="GeneID:11369542"
                     /translation="MRHATESDRTLMHATSLRAGSDPKPKLFTTPWWWRWALGTCFAR
                     ITEPMATLALISLGTFVSGYSYGAFLVSVYAFTGALTATTSGKLIDRAARPRRLVLIM
                     TSSSFLLHVALAAFGTFRLSTVLITVTTALCAALPGGIPGLSRSVLVRYADPRLRNLA
                     FSWDSIMTEAGWILGPVVIAGLALTGLPWVEVAAMAVTFLGVQLFLGPLVGGDKGTPP
                     DAATTAPGSLWSYRTAWPGLVDSVSIGMAVTGVVSALPVLLPRAGASPAWSGILVSLL
                     AATGIAGTLVYGKTAGRIPLHITVQSLLTLIGVLTTVVALAFSDSALSVAVWVGLSGF
                     FITPFNTQRSISLEASIPPALHTQGFSAQFALFGLGSAISAGMLALISGVTAALLAIA
                     GFALLISAVTHGAVRKEIFTA"
     gene            complement(168923..170113)
                     /locus_tag="SFLA_RS00620"
                     /old_locus_tag="Sfla_0138"
                     /db_xref="GeneID:11369543"
     CDS             complement(168923..170113)
                     /locus_tag="SFLA_RS00620"
                     /old_locus_tag="Sfla_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_014152281.1"
                     /db_xref="GI:503918287"
                     /db_xref="GeneID:11369543"
                     /translation="MTATEPAPPAQVPMHRLHFDVPGPPRPAELPGGAPAWLVSRYAD
                     VRQVLSDPRFGRALLYAPDAPALSDVPDLVNSPDLMFNQDGPDHLRLRRTLRRAFTPR
                     AVARWRPWIAAIVEDLLDRLEASPQPVDVVAEFTLPLPVAVISRLMGLDEPARDRMRY
                     WSEHAFSDGTHDSRQVADALAEFRAFGADLLTERRRAPGDDLISGLVAAADQEGGVPE
                     SRLVGLVCGLVVGGHDSTMTMLGNALLYLLGERPETWPRLGADEQAAGHLVDRIIHLV
                     PLGDDRGSARHAATDVEVGGVTIPAGAIVLADCGMANRDPEVFPPGTLHDLFAPLEAP
                     TLSFGAGPHYCLGAWLARTELQLALHRLAARFPGLRLAEPVDTVSWRAGTTSRSPQRL
                     SVSR"
     gene            complement(170163..171218)
                     /locus_tag="SFLA_RS00625"
                     /old_locus_tag="Sfla_0139"
                     /db_xref="GeneID:11369544"
     CDS             complement(170163..171218)
                     /locus_tag="SFLA_RS00625"
                     /old_locus_tag="Sfla_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014152282.1"
                     /db_xref="GI:503918288"
                     /db_xref="GeneID:11369544"
                     /translation="MKIAKWVVREHVEGVPDVDRIYQKVVEDVDVALAPDEMLLRTRY
                     VSVDPYLQGIALDTPLGGHMGADSIMEVVDAGPDAAHRVGDLVQGFGGWRTHVISTGA
                     AEPWQTGTFPMVFPEFRRLDPGWYDDALPLPTALSVMGGPGMTAWGTLTKYMTISPGA
                     TLVVSGASGAVGALVGQLASIEGARVVGTTSSPEKADHLTALGFDAVIVHRHGDEAGT
                     VRDALAQAAPDGVDRYFDNLGGTVTDAVFPLLNVGAQVAVCWQWATQVGNEHTGPRLL
                     PYLMFPRATVRGIFSPEWFTEENWRDLHDELGGRVRRGEVVCDHTLHHGFDSIPAAYA
                     SLYAGHAANRGKVLIEL"
     gene            complement(171215..172936)
                     /locus_tag="SFLA_RS00630"
                     /old_locus_tag="Sfla_0140"
                     /db_xref="GeneID:11369545"
     CDS             complement(171215..172936)
                     /locus_tag="SFLA_RS00630"
                     /old_locus_tag="Sfla_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase"
                     /protein_id="WP_014152283.1"
                     /db_xref="GI:503918289"
                     /db_xref="GeneID:11369545"
                     /translation="MSRDTSRSRPGGAGARETMIIIGAGLGGLSTGCYAQMNGYRTRI
                     LEMHEMPGGCCTAWERGGFTLDACVSWLLGSGPGNEMHQIWLELGALQGKEIRHFDVF
                     NIVRGTDGRAVHFYSDPDRLEAHLIALSPADARLVRTFCRQLRSFRKALAVYPFLKPV
                     GLMGRRERWRMLASFLPYFNSVRTTISVLMSDFSARFEDPLLREAFNFILYEKHPAFP
                     VLPFHFQLASHANLSAGVPEGGSLGLAESIEARYRRLGGEVSYNTKVESVIVEDDRAV
                     GVRLSDGGELRADIVVSACDGYTTAMKFLDGAYLGEDYRRLYTETIHEPGMVFPGYFT
                     LFLGLSRPFPEGDPCTTYLLDDAMAAELTGIRHPSINVQFRSRHYPELSPHGTAVVYA
                     TYFCDIAPWRALDEGPEQVTRTRGGQELHTLPVRHGRGYYAAKRRAREALVDFLDRRH
                     PGLRDAVVVRDVSSPLTQVRYTGNHDGTVLGWQPFVESGETLEKLVKKHGPGLPGLRD
                     FYQSGVWATTGGLIRAAAAGRHVMQFVCRDDGRPFTASLDLTAPPPTHRVIPVPGRPA
                     APTERKS"
     gene            complement(172933..174615)
                     /locus_tag="SFLA_RS00635"
                     /old_locus_tag="Sfla_0141"
                     /db_xref="GeneID:11369546"
     CDS             complement(172933..174615)
                     /locus_tag="SFLA_RS00635"
                     /old_locus_tag="Sfla_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_014152284.1"
                     /db_xref="GI:503918290"
                     /db_xref="GeneID:11369546"
                     /translation="MADDGRSDWTSRERAPGTPPRVIVIGAGVAGLSTGCYAQMSGAR
                     TRIFEKHVLPGGCCTAWSREGYLFDYCIEWLIGTAPGNDAHQVWSELGALDGKSVTNF
                     ELFNKVEDEHGRSVTFYNDPGRLETHLLELSPADAPHIRAFTRDLRRFIDIELYPFLT
                     APALRTVRERAGTLRTVLPAFRLFWRTAATPMHVFADRFEDPLLRKAFRNIFFQDPGG
                     FPLLPYLFNMAAAHHGNAGFPQGGSLGLARSVEERYRSLGGTVTYRARTERILVENDR
                     AVGIELRNGKRYFAEHVVSACDGHTTVYGLLGGRYTGPRIDKLYTDLLHRPGTLFPAV
                     VSAFVGLRGDLDPDEAHSTTHLLGPDDADHLPGALQDSLVVQARSRYSGGFAPPGHSV
                     LHCTYFSDYAHWKDLRTRNRKEYRRRKREVADFVRDFLERRTPGIADRIDVMEVATPA
                     TTHRYTGNLGGSILAWKAFSDADDVAARLVGKDRMRLPGLDGFSMAGQWIGMGGLIRA
                     ASTGRFAVQYLCRELGLEFRAWESKGAEPWHPGKLGHLPQLDRWSARGSEES"
     gene            complement(174605..184066)
                     /locus_tag="SFLA_RS00640"
                     /old_locus_tag="Sfla_0142"
                     /db_xref="GeneID:11369547"
     CDS             complement(174605..184066)
                     /locus_tag="SFLA_RS00640"
                     /old_locus_tag="Sfla_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide synthase"
                     /protein_id="WP_014152285.1"
                     /db_xref="GI:503918291"
                     /db_xref="GeneID:11369547"
                     /translation="MSDANNRASRAKVAIVGMGCRLPGGASDHRAFWRNLVAGKDCIT
                     PTPPDRYDVGTLGSRHRDKPGRLVGGRGGYIDGFDEFDPAFFGISPREADHMDPQQRK
                     LLEVAWEALEDGGQRPADLAGGNVAVYVGAFTLDYKILQFADLGLTSLAAHTATGTMM
                     TMVSNRISYCFDFRGPSLSVDTACSSSLVAVHLACQALNNGESDLALAGGTLLHMAPQ
                     YTVAETKGGFLSPEGRSRTFDAAADGYVRAEGVGLVALKRLDDAVRDGDRIHAVVLGS
                     GVNQDGRTNGITVPNADAQVDLILRVCAQAGITPGDLQYMEAHGTSTPVGDPIEANAL
                     ARALAVGRAPGARAYVGSVKTNIGHTESAAGIAGLIKTVLSLKNRTIPPHINLENLNP
                     AIDKAALPYEIPTRPTEWPDHEGPARAGVNSFGFGGTNAHVVLEEAPAPPPGSRTAPP
                     VARPWSILPLSARDPDALKEMAAGIRGELAGDDGPAVALDDLGHTLAHRRQHLPERLS
                     VVYSTRDSLDEGLAAHERGEPHPRVVHGRAREAADRRQAWVFTGMGPQWWGMGRQLLE
                     KEPVFRDAVAACDRAMREFADWSLMEEMTADESVSRMSETWLAQPANFAVQVALAALW
                     RSHGVRPDAVVGHSTGEIAAFHAAGVYSLRDAARIVVHRSRLQQTLAGTGTMLAVSLS
                     EEEAERRVRPYCDRVSVAAVNSPTAITLAGDEEALTLLAEELRAEQQFAKFLAVEVPY
                     HSVGMERIRDELLAALDPLEPHPAQVPLYLTGMEGTARGTELHAAYWWRNVRDRVRFR
                     SAVDRIAADGHHVFLEIGPHPVLGHAIRECLGTTGTSGLVLPSIRRQEDESERFAASL
                     GSLHTLGVPVDWKLLQPAGRPVTLPRHPFRRDRHWTEPRTVAQVRLGHRDHPLLGRRT
                     DATEPTWQARLDTEDLPYLADHRIQDTVVFPAAGYLEMAAQAVLRLTGGTTAVLADIE
                     LRKALFLPDGEDRTVEVSLSLENAAFTIASPAGDDGERAVHAGGVVRTAQRRRTTPPL
                     DAPTIRSRALRHLDGPDCYTALAALGYHYGPSFQAVEEVWIGPGEALSRIRPPRTIGD
                     DAAGHHLHPVLLDACFQTLLTPLVLEGPAPGTGIRLPLSLDEVALEPIGDQPLWAHAT
                     LLPGDGDTTLGNIALYADDGTPLGRVEGFRAADVEKAATAVARTTIDSWLTEPVWTDC
                     PPLPAHDTAAEPAAPGPGTVRNEPPGAAGLPHPGDGPAAAARDHGWLILADTGGVADA
                     FAALAAARGERCRLVRRGPAYTASADGSTYTVDPASDSGLRRLLADLDRDGGPFRGTV
                     LHLWNLDAPALAACDRDTLRDHTGAGAYSLVVLARLLAARGGGGRLHIVTRGAQPALP
                     GEGPEPLGAPAWGIGRVLRHQELIGHPGKLVDLDPRRQQGPEGDRADAEALLAEALSD
                     DEEEIALRHGGRRTSRLRPAEALTRPLPLRLRADGSYLVTGAFGALGRLLCRTLVRRG
                     ARRLVLVGRTPVPPRAAWAAVDPATAEGRAVHLLRELEALGARPVLATLDITEEDALA
                     DWLDAHRRSGAPPVRGVFHLAGQVRDTLVADLDRDTFDTVHDPKTVGAHLLHRHLRDE
                     PLDHFVLFASIASLLTTAGQTNYAAGNAFLDALAHHRRAQGLPGLSLDWGPWATGMIE
                     ELGLVDHYLHSRGMSSLSPDAGMAVLERVIGQDHAQLVVATVVDWPAFLAWYPSPPPL
                     VADLAAAASPPRDAVSGNGFLDSFRAADPQTRRALVAERFAALAATVLRTGADRIDPA
                     AGLGELGLDSLLAMELRARVHAELGVALPLVALLSGSPAGELATQLHDGLSAQASADG
                     PGGEAGAVELHTDERTYPLTQNQKALWFLKHLNPDGHAYNIGGAVQVDVALEPDLMFE
                     AVRRLIARHPALRTNFSLVDGQAVQRVSEDGPNDLALFDVQGEDWESIHATIVQEYRK
                     PYDLARDPLVRFRLFKRGPDRWIIMKAVHHIVSDAISTFTFIDELLAVYEALRRNQEP
                     RLPPVEARYLDFLNQQNAFLAGPEAAGMLDYWRSHLPAEVPLLDLPVDKPRPSVQTHN
                     GASEFFVLDAGLSARVHALARTHGVTPFMVLLSAYYLLLHRYSGQEHIVVGSPVTGRT
                     RQDFASVYGYFVNPLPLHADLSEDPTVAELLQQVRRTVLGGLDNQEYPFVLLVEQLGL
                     QHDPSRSAVFQAMFILLTHKVAAEQYGYRLEYIELPEEEGQFDVTLSAYEDEAEGRFH
                     CVLKYNTDLFLPETMRRMAAHYTRLLDRMTRAPGERPTSRLEMLGGRERAQLIEEWSR
                     PDLPLTGSDGGEPFTPVQTLIGRIAAAHPTAVAVSTPSRSGEAHRLTYAELDRRADDT
                     AARLRTLGVGEGSVVVLCLEKSPELIVVLLAVLRAGAAYLPLRPDHPADRLAHLVPAT
                     GADLVVVADDTVPERTGALTVPVLTLAALARTAPHPHGPVAATGPDSPAYVITTSGST
                     GRPKAVRVSHRNLASAYAAWRQVYRLDTDVRVHLQMAEPSFDVFTGDLVRALCSGGTL
                     VLADRDLLFDTTRLHRTMRQEQVDCAEFVPAVVRGLMDHCAREGLTLDFLRLLVVGSD
                     AWSVGEYRRLAGLCGPGTRLVNSYGLTEATIDSAWFEGPVDDLEPGAMVPIGRPLPDS
                     TLHVLDLHGEPVPPGVPGELWIGGPGVALGYAGDPEQTGERFVTRTLARDTGARPERL
                     YRTGDIARWDTRGRVHLLGRTDGQVKLRGHRIEIGEVEAHLAQWPPLARAVVTVRTDT
                     GGEAALCAYCVPEPGAALDVRALRRHLARSLPSYMIPSHYVELPALPLTANGKVDTAA
                     LPAPRAEAGDRPHEEPATLYEIGVARHWKTLLGCERVGLEDDFFELGGSSVKLIELLH
                     HLRTEFGVGVPVSRLYQGTTLHGMAATVEDVLHSTGTDELPCLTFNPGQHPALFCFPP
                     AGGHGLVYRGLATHLPDHTVIGFNYLPGDDKTARYADLIEAAQPEGACLLLGYSLGGN
                     LAFETAKELERRGRRVAHVVILDSRRILTAYEPDATGIAAFESELAEHLRRHTGSEAV
                     TQETLAHAAEYLAFCGRTPNTGTVTATVTVITDEDKAALYAAGERGTWHGSSTTATAA
                     LRGSGRHADMLDAKHLRRNAELVRSVLKGDAAHGG"
     gene            complement(184110..185051)
                     /locus_tag="SFLA_RS00645"
                     /old_locus_tag="Sfla_0143"
                     /db_xref="GeneID:11369548"
     CDS             complement(184110..185051)
                     /locus_tag="SFLA_RS00645"
                     /old_locus_tag="Sfla_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_014152286.1"
                     /db_xref="GI:503918292"
                     /db_xref="GeneID:11369548"
                     /translation="MDECEHATDGKEISVGYSVSRKGAADNSAARILRVAVYPALLLS
                     VVLVGVFAVRHQWDPARVSPLFLLGVIGYLVLLERLIPYDRNWHPEKKEWRHYGIYFL
                     LTMAGSGLAQWLVALAVGLISPADPICHLGIEIPGALLTGSLASYLVHRLGHRNPLLW
                     RLHGIHHVPEKVNVANNGVNHVLDIVLAQGLVQLALAIVGFSRPAVLVVGLFVAAQGY
                     FVHANIDVRIGPLNHVLASPEQHRLHHSTDLAEAGHYGSDLSCWDHLLGTFTWRPGRE
                     PAAVGLRDPAAFPGTGEILAALLHPWRRRPAPGPRPE"
     gene            185760..186581
                     /locus_tag="SFLA_RS00650"
                     /old_locus_tag="Sfla_0144"
                     /db_xref="GeneID:11369549"
     CDS             185760..186581
                     /locus_tag="SFLA_RS00650"
                     /old_locus_tag="Sfla_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152287.1"
                     /db_xref="GI:503918293"
                     /db_xref="GeneID:11369549"
                     /translation="MPDRPVPSCVDATKPSIARVYDAFLGGADNYEVDREVVSSVLRT
                     AREAADLAVENRRFLIRACRYLAEHAGMTQFLDCGSGLPTAENTHTVVQGVNPDSRVV
                     YVDNDPLVLAHSRALLDRDESTVIVSENIFEPETLLRNDVVRSRLDWNAPIALLHMGT
                     LHHYNDEHARPRQDIMRSYIDALPPGSYVAISHFLDPEDEYSTTARRMEEVFLHSMMG
                     SGTFSTAAEIRKLFNGLELIAPGLVRCVDWLPEGPGPERLNAAQRCIAGAVALKR"
     gene            186632..188332
                     /locus_tag="SFLA_RS00655"
                     /old_locus_tag="Sfla_0145"
                     /db_xref="GeneID:11369550"
     CDS             186632..188332
                     /locus_tag="SFLA_RS00655"
                     /old_locus_tag="Sfla_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152288.1"
                     /db_xref="GI:503918294"
                     /db_xref="GeneID:11369550"
                     /translation="MSRRRAPKGQGEGARRLWLLPDPGEDEPFIDVGKDGRGTLHVSV
                     AREGRHDDFRFVVTAHHIAVAERSALRRWAVFAVLFGELAVFHADAAPARPPATCQQV
                     IDTILGGTDSEVEHYLTRMNKRFLGGLRDSLALLSKTELTRSPDREAFEKRLWFGVEP
                     LIMSKAERARRAQETHRAAADREIAVRKIFEPYNDALLMAERDGVVQHVVELFGSNPV
                     ISEFQVGAPAHHDRYLTFGSGGEIMVRDGAVKAIFFHVQPTEAAQHGFTGLSTLIPGL
                     RQEASRSQVEDALGKPVVGRTGPSTTHSVGGGFVKVFYDTWAKKDAPNHLKLIQLTAE
                     DTYARTDPSDERCPCCAGMLVRTASASGGVDVGSTITALRHGVAAGRLRQAHRWVALQ
                     DMLSLHASGLMEHVAAHLECTICRRHMAFALHRDADPTFEYVSLNDIRRRTPEPVPPV
                     EQWGDADRIAREAQRPEQVATDGSSWILFAVGEQLFMNARCWYSAVDGSRLIRLEAAE
                     VRQYERDGEAYLSRLQKTINRTWTSEEDPWRSRDLTRGGMSNEEAIEASLATPQEEQA
                     "
     gene            complement(188449..188787)
                     /locus_tag="SFLA_RS00660"
                     /old_locus_tag="Sfla_0146"
                     /db_xref="GeneID:11369551"
     CDS             complement(188449..188787)
                     /locus_tag="SFLA_RS00660"
                     /old_locus_tag="Sfla_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="WP_014152289.1"
                     /db_xref="GI:503918295"
                     /db_xref="GeneID:11369551"
                     /translation="MPERAGKQPSARESAVTAGCVLLLVLVADVAAALLVVILLAARG
                     LDRMDAGSGVTATGVPPLDWTPGVGFGALALAVGVTALVLLRIGHRVVGAVQLTLCGL
                     LTLHTLGSWP"
     gene            complement(189631..190527)
                     /locus_tag="SFLA_RS00665"
                     /old_locus_tag="Sfla_0147"
                     /db_xref="GeneID:11369552"
     CDS             complement(189631..190527)
                     /locus_tag="SFLA_RS00665"
                     /old_locus_tag="Sfla_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="WP_014152290.1"
                     /db_xref="GI:503918296"
                     /db_xref="GeneID:11369552"
                     /translation="MERIPSPARSCARTLTFMRLPLDLDPTARDLVVLGVPYDESGWF
                     PGNRLGPGAVRSASAVAHVPGADRGPGTFDLVDCVDGGDLDLTPWISGAAPEVPYKRL
                     SHLLAGNAAVLLLGGSRSLTLAALRAVAEIHGPVALLHLAADPAGAHPQGDFLYQAID
                     ECLVDPAAVVRIGLRGAGYSGHAQGGLMLDVGRFGRLGVRGAADVARHRIARRPVYVS
                     VAVDVADPAFAPGTGIRVPGGLTSRELLGFLRCVGDLCPVGFEVTGMSPPQDRSGITT
                     ALASEIGGELIHQYARAQRILM"
     gene            190894..191901
                     /locus_tag="SFLA_RS00670"
                     /old_locus_tag="Sfla_0148"
                     /db_xref="GeneID:11369553"
     CDS             190894..191901
                     /locus_tag="SFLA_RS00670"
                     /old_locus_tag="Sfla_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_041825271.1"
                     /db_xref="GI:754214641"
                     /db_xref="GeneID:11369553"
                     /translation="MSDRRTTLVGSVTGPSAAVTGAVPSAPPPAGRRRGPFSVGVRLR
                     WLGVSGWEIVIHRGRHRRSILFDPYLSRMPFTDAQGVTEHGIPLRLDPEAVEAVASRH
                     LTGAPELILVSHGHFDHVADVPQLLARAEWQQSRVRVLCDTTVSNLLAAMGTPRRRLA
                     DAVVVGGGEHLQFDGYTVEVFRSLHSRRPDYGYFAPGHRLVPPPPPSVLGELVEGNTL
                     AYQVSVEGGPSILLMGASNFAEREITGIRPDVAAVPMTTTAAVHRYPGRLLSAVGNPR
                     MLIPCHHDDMVTPLTGPAGPLRASVSEPSVRDLESAAGPGSRVVAPRHLEAMDLVAAL
                     T"
     gene            complement(191894..193057)
                     /locus_tag="SFLA_RS00675"
                     /old_locus_tag="Sfla_0149"
                     /db_xref="GeneID:11369554"
     CDS             complement(191894..193057)
                     /locus_tag="SFLA_RS00675"
                     /old_locus_tag="Sfla_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_041825272.1"
                     /db_xref="GI:754214642"
                     /db_xref="GeneID:11369554"
                     /translation="MRTPGPAPRVGLRNALTDVAGIRVGHATRTGDGWLTGVTAVLAP
                     EDGMVAAVDVRGGGPGTRETDALDPRNLVSRIDAVVLTGGSAFGLDAASGVAAWLEER
                     GRGFRVGAGPAQVVPVVPAAALFDLGRGGVWTARPGAELGREAVDRAAAGDEGAAVPQ
                     GCVGAGTGAVAGGMKGGLGTASIVLPSGATVAALAAVNASGSLVDPVTGALHGAWTEV
                     GDEFRACGLHAPVPDTAVHTRAAERLAAARTESRRRQADEVRQLNTTLVVVATDAALT
                     RPQAQKLAGTAHDGLARTIRPVHLLTDGDTVFALSTGRLPLAGADGDGDRTGWGAHTE
                     VTAANEILAAGADVVSRAVVHAALAARTTDTPGGVFPSYLDLYGTPGDGTSLR"
     gene            193214..193900
                     /locus_tag="SFLA_RS00680"
                     /old_locus_tag="Sfla_0150"
                     /db_xref="GeneID:11369555"
     CDS             193214..193900
                     /locus_tag="SFLA_RS00680"
                     /old_locus_tag="Sfla_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014152293.1"
                     /db_xref="GI:503918299"
                     /db_xref="GeneID:11369555"
                     /translation="MTDDGTNAPDDGLPPWLTGLVRRTEGEIPPELARYAGPAPAGAR
                     GSAVLVLFGTGARGPDLLFLRRSGSLRNYPDQVCFPGGSSAPADADHIRTALRETWEE
                     TGLDPSEVRIAGTVFPLHLGHSGFSVVPVLGWWGSGSEIAGDGEEIVSVHRVPLTELS
                     DPAARLLVRLPDGHLSPAFLVRNVFVWGLTAALTAWLLRLGGWERPWDTDRIEDLPDV
                     RRRYGGGPPP"
     gene            complement(193876..194754)
                     /locus_tag="SFLA_RS00685"
                     /old_locus_tag="Sfla_0151"
                     /db_xref="GeneID:11369556"
     CDS             complement(193876..194754)
                     /locus_tag="SFLA_RS00685"
                     /old_locus_tag="Sfla_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_014152294.1"
                     /db_xref="GI:503918300"
                     /db_xref="GeneID:11369556"
                     /translation="MTAEGPEPVYETILLRRADGIAWITLNRPERLNATTEQMHHELL
                     DAFARVADDGSSRVLVLTGAGDRAFCIGSDLGFLTEVLDGEEPDSDLFAAYLERLNGV
                     VFALERMPVPTIAMVQAKARASGFEMVVACDFVLIAEEARIGDVHTPYGHMPGAGATH
                     RTVRKMGLQPAMELLMTGRWMSAAEAVEKKLALRAVPRDRLREETTVFARTLVDIPGD
                     SLRHLKAAVMGGLGRTVEEAVATETSEYLALLRSSSGPVDGFRAGQRERALRRAGPAS
                     GEVTATGPAQGGGPPP"
     gene            complement(194751..195530)
                     /locus_tag="SFLA_RS00690"
                     /old_locus_tag="Sfla_0152"
                     /db_xref="GeneID:11369557"
     CDS             complement(194751..195530)
                     /locus_tag="SFLA_RS00690"
                     /old_locus_tag="Sfla_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygenase"
                     /protein_id="WP_014152295.1"
                     /db_xref="GI:503918301"
                     /db_xref="GeneID:11369557"
                     /translation="MTASPSSSGAVEPATTTDPAADEREVFRRDGVVRWDHVLTPGQV
                     ADLRVSVERAFFDDGRPAEGVRDLSERRGRPLDLALLQKVNLWRSDEACEAQVRRPDL
                     YRRVEALLGGPVRLFRDHSFYKPAGKGERSRLVLHQDNRYWHLSPPEAVTVWMALDDA
                     TPENGCVQYVLGSHRWGRVEHTRPEEGAVLVEARSEREPVEYPVPAGSALVHHANTLH
                     GSGPNLTDGPRRAYALVFVRADVSARGEAMTGVPLAADLAR"
     gene            195969..197417
                     /locus_tag="SFLA_RS00695"
                     /old_locus_tag="Sfla_0153"
                     /db_xref="GeneID:11369558"
     CDS             195969..197417
                     /locus_tag="SFLA_RS00695"
                     /old_locus_tag="Sfla_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014152296.1"
                     /db_xref="GI:503918302"
                     /db_xref="GeneID:11369558"
                     /translation="MQVLLVNARRSSYSGESISAPQLGLLSLAATLREGTFHDTKGTD
                     VRFIDDQLFVLQRPLATPNEFLRGHHPDIVGIQVLTSSLKNGIKLGAESRRHHPNALV
                     VYGGVGATPLARKLVEDGSADVVVKGEGEVTFSHLVHEYGNNGRKNLRKVRGIVFRDD
                     DGTVVETPAAPQVMRLDKLPKPARDLADMQLYNQISRGRSGNLVTSRGCSYACAYCYS
                     KHQWGVGQRRHSADRVIEEIRELVEVHGFDRIRIEDDDFVEDVPRMQELCRSIEKSGL
                     QGKFEWEAKARPDLIDDDMARMLRDSGCFRLLVGVETLDWSLLKRLGRPVKVDVTERA
                     LSSLSKAGIGVQATLILGIPGETDEAMRSTITWLQSRLGDNRHDIVSPCFFVPFHHEV
                     EKDMAKRVDFTLETDDSDCFTGHIPVTSSDAASIDELWKLYDDMTPTRRDGKYKRIAY
                     LADLSTVQTRLGLLDGGAPQTKEPAALVPEVQ"
     gene            197414..198817
                     /locus_tag="SFLA_RS00700"
                     /old_locus_tag="Sfla_0154"
                     /db_xref="GeneID:11369559"
     CDS             197414..198817
                     /locus_tag="SFLA_RS00700"
                     /old_locus_tag="Sfla_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014152297.1"
                     /db_xref="GI:503918303"
                     /db_xref="GeneID:11369559"
                     /translation="MSAPTAALGTEVLDVPAYDGARAVMSHRPDVVRDGEGRPLARLG
                     STGRLTQFRMAEEAGRAARRLRGIDDADWFGLLRRAADRVTTKLDNGDLDVWLRALSA
                     VSGLPRRRAARGLRTAAQDLARMEEILAAQAPDGTVSAYRTGGSGLGWSWRPAGRSVL
                     VRQPGNFPTINIEWLQALATRRPVLLSTAAADPFTPVVLTEELYAAGLPEHGVSVVHG
                     DAPALRRLADQVLWPGEDVPADLPAGKVKTYHFGRSRAVIGDRLPDDAWPRLAREAFA
                     GCGRLCVNMSSLVVLGDPREAAEALAHEFAARPVLPLDDPRAAVPAFPDRAARDSLAL
                     RIEREVAAGAVDVTAAATGVPLRVELDGKAFLRPTVLLVDPGSPLFGTELPFPFTAVA
                     HVPRSKAVAACAGSLIVSVVGEADGLVRALAEEPGVDKVFAGDQFDRGYHPCDPHEGH
                     LADFLFKKKAVIPGALA"
     gene            198853..199962
                     /locus_tag="SFLA_RS00705"
                     /old_locus_tag="Sfla_0155"
                     /db_xref="GeneID:11369560"
     CDS             198853..199962
                     /locus_tag="SFLA_RS00705"
                     /old_locus_tag="Sfla_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="WP_014152298.1"
                     /db_xref="GI:503918304"
                     /db_xref="GeneID:11369560"
                     /translation="MRCPSESRLRPITDEDVRRLVRLHFDPQHGTPYWLERDRRQGTD
                     ALGKVHGLADAVALIGLLDGSDQMHFEEAARRTPLENFVPRSVLAEGGTLWAAQTGGT
                     TGPAKHGTWGSRYWDDILAFSDEFLDLHGVPRGKNWLFVGPMGPHTTGRLVVAFAERR
                     GGMCFSIDLDPRIVKIFGEEGMTAAYDRYVDHIWAQIAEVARSQDIGVLFCTSRLLEM
                     LPERLGTEALAGVEAIVHAGTTLDPETHRQLREDFFPGVPVVGMYGTSTTGISWQKPF
                     EAEDEHRVVYVPCQPHVSLDVVDGQGDDVPFGEEGRVRVWRLTDDALLPGFWERDRAR
                     RVRPYGVAAERYPWPWVGDPYSPEFTEGRRVEGVY"
     gene            199964..201343
                     /locus_tag="SFLA_RS00710"
                     /old_locus_tag="Sfla_0156"
                     /db_xref="GeneID:11369561"
     CDS             199964..201343
                     /locus_tag="SFLA_RS00710"
                     /old_locus_tag="Sfla_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="WP_014152299.1"
                     /db_xref="GI:503918305"
                     /db_xref="GeneID:11369561"
                     /translation="MAGFILSSGPDGSIDVGLLGEGRAMDVLVRRDGTDVLVVQGDRL
                     TGEDPPQHASLADLAAWTERAHSRYCAVLVREGRATLWSDVGATCPLHWARAGRTLLV
                     GTSAGALLPRLGRPVVLGDAERSLLPGGRFAGVTPVPANSAVTLVVDAYGEDPVSVHR
                     VAHLPDLATVTDADQAVRTVRTVLGASVARLAAGADEIAVSLSGGVDSSTVAALAVLE
                     AGSSAVRTYTVGTPYGDEFAQAAWLADRLGTKHEEVHFGPEQLAGMLPGMIRALETWD
                     LLTLQIAAPACFLQGHIATDRSQVLLSGYGADLLFAGLGGTGGEDAVEGAVVAQTRAT
                     GRSNEFHPAFADARHTAVRHPYWTREVMAAALDIRGRLKVRDGEAKWVLRSAAADVLP
                     AEVAWRPKRGIHEGTAMSHMFAAALGSDDPSVQAGRLYEIATEVFRSGGPGTGPGEAG
                     QDRRLGGMG"
     gene            201340..202743
                     /locus_tag="SFLA_RS00715"
                     /old_locus_tag="Sfla_0157"
                     /db_xref="GeneID:11369562"
     CDS             201340..202743
                     /locus_tag="SFLA_RS00715"
                     /old_locus_tag="Sfla_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014152300.1"
                     /db_xref="GI:503918306"
                     /db_xref="GeneID:11369562"
                     /translation="MRVLLIWPRNERALLSDRLSCCEPLPLEYLGGALRGHHDVTIHD
                     LRLDAPLADYAATHEPPDLVGVAIPYTTSVRVSREVSREARRLWPDVPIVLGGHHPTV
                     SAEWLDGFAADWVVAGEGGAPLNRLAADLEAGRTPQTGVGLAPYDSRTGLERDRRPRP
                     AALNDLPMPDRSLLAHHRQDYFHSIYRPVSLIRFTAGCPYTCKFCSLWRMTDRRYLVK
                     DIDRVLAEIDDIEGQNLYVVDDEAFIQPARMLELADAIDKAGFRKRFHMYIRTDTALR
                     RPDVIARWAEIGLDSVLVGAESMTDDELSGYRKGTDADQTRRALDLFHTNQVKVRANF
                     IVQPNWVGEDFARLGRTIEELQVDMPSFSVLTPLPGTDLYDESRDQHISDDPELFDCY
                     HSLFPTKLPLEDFYHRLADLLAGASARPAPGVASGQDPSVFYYSDNSAFDEMLSGIRL
                     AAGPGRDREPERVPSTG"
     gene            202831..204873
                     /locus_tag="SFLA_RS00720"
                     /old_locus_tag="Sfla_0158"
                     /db_xref="GeneID:11369563"
     CDS             202831..204873
                     /locus_tag="SFLA_RS00720"
                     /old_locus_tag="Sfla_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014152301.1"
                     /db_xref="GI:503918307"
                     /db_xref="GeneID:11369563"
                     /translation="MSTESSRRRKVYFIGLNAVPFLPLVAGLLRTYAEQDERIAASYD
                     FQEPLFLVAPVQEMADGITEPDVLALSCYVWNFRRQMKVAKILKERYPDMLVVAGGPH
                     VPDRVGDFFTQHPYVDVLAHGEGEVAFRELLSARLQDAPVYTGVPGVTVNERNAPVAG
                     PPAKRLPRRIETPSPYLNGVMDGAVKTCRERGLRFYALWETNRGCPYSCAFCDWGSAT
                     MSALRMFEEERVQHEIEWFARNDVEDLFICDANFGIMPRDLEIAHALAEARTEAGSPK
                     QIRVNFAKNSNDRVFDISKAWHDADLLMGTTLSMQSTDMDVLEAIDRKNIGLDNYRKL
                     QQRYAVENIHTYTELILGLPLETARTFREGIGSLLEAGNHEDIRVYEFGILPNAPINT
                     PEKIAGYGLRTVPKRLYVERPGTPDDEAETMDMVMETSAMPRDEWVESFAFVQAVQFL
                     HNGCYTRYLSVYLRQEHGIGYTAFYEGLQNHFTDRPTSFIGSLYLRMRSLYQDYIDIP
                     TLPLANLVASQPDLATHLAPYGRRRGWTIDNWGWLRVATEFDRFHDELVDYLRTLGLD
                     PDQDARLRDVLRFQRDVMLRPDYDAQHGKTAEYDHDWPGYFGGGPLRTQRVRVEYTDQ
                     QFGANGRFRPAPGDLKAFALAAIGPSYPVSRIGHYRHRIESAEVTPLAEPAFSEQL"
     gene            204870..206336
                     /locus_tag="SFLA_RS00725"
                     /old_locus_tag="Sfla_0159"
                     /db_xref="GeneID:11369645"
     CDS             204870..206336
                     /locus_tag="SFLA_RS00725"
                     /old_locus_tag="Sfla_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014152302.1"
                     /db_xref="GI:503918308"
                     /db_xref="GeneID:11369645"
                     /translation="MTAGPGAAGSAAPPHRAALAVLAGACGLFALLQLGVATLLPQIQ
                     EAFGVSGSEAAWVVTGHLLVGCVATPVVSRFGDLYGRRAVMLCVLAVVAVASVVSALT
                     GSFTVLLVARLVQGVAGGLFPLCVGLLREGFPQRSLSGPSGLLSASFGTGGGVGIVLA
                     GMFGGGLPAVRWLFAAAALLAVVLLVAGASVLPETPRRPATRIDIPGLLLLGTVSTCL
                     LLALTRYGQEGLGSVTGAALLAAAAAGCALLLRVERRSPEPVLDMRLMSRRPLLCLNL
                     VSLLTGLVMFQIGVLAPALVAAPRDTGYGLGAGGAVLTLVMLPMQLGALSGGLLSGWL
                     RESGRLTARAVMGTSTALFAAGAVVFAVLPSGAGGLALGTALNGLATGLLGGAMAELL
                     VQASPTGATAVTVGLNGVLRNLGGAFGVQVSSMVLAVAGGASSHPSATAYHALFTGSA
                     VLALVAVGAAVAFPRSPAPRQDVPVPPGHTSRPIRPTT"
     gene            206446..207828
                     /locus_tag="SFLA_RS00730"
                     /old_locus_tag="Sfla_0160"
                     /db_xref="GeneID:11369646"
     CDS             206446..207828
                     /locus_tag="SFLA_RS00730"
                     /old_locus_tag="Sfla_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014152303.1"
                     /db_xref="GI:503918309"
                     /db_xref="GeneID:11369646"
                     /translation="MFDLRRSDVVLLQAVVDHGSLHAVERDGWMTQSSASRRLVKLER
                     RLRTALVSRGATGTEPTEAGHALLHVGRRLLASIDFAIATTHHGAGAASRLPVVEFAV
                     GSEWAYGLDGHLAGRFPDVVFDIVPDDSHRIWQRFERYAADAALGWETARRPMARRGD
                     VLIRTIAEEPQQIALPSGHPLAEQGILDLRGLTGADWVAVVGGDSGDDQGWALSRLTP
                     VPSVSFTVRSQGAALDLVRRGYGIALVSPSSLGGSPARGVVLRPLRQKFVRRLRLAVD
                     PLAIPEPLAEDLCASLRRRYVLRTTAHGSVPAVTQQDPDRGTPADPADAGCAVPPPVL
                     LSELHWSSPGRCGGFEPEHLHLLRVIGRTGSLNQAASALLVTQPALTRRIRRLEASCG
                     LPLVHSTARGTSLSATARRLLACTGPAEHRLDALANHLRQSGPAAGMPPAEGAAGPVP
                     SPVRPRKAPR"
     gene            complement(207803..208492)
                     /locus_tag="SFLA_RS00735"
                     /old_locus_tag="Sfla_0161"
                     /db_xref="GeneID:11369647"
     CDS             complement(207803..208492)
                     /locus_tag="SFLA_RS00735"
                     /old_locus_tag="Sfla_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_037815530.1"
                     /db_xref="GI:739965261"
                     /db_xref="GeneID:11369647"
                     /translation="MAEISGIVVDWGGVVTRSFAEGIAVWAADEGVDAAEFHAALGRL
                     LGPAAVPGPVARQFHLVERGELPVSEFEGTLAALVRRSDGSHPVTEGLVERMFAPFTD
                     EPAMVGLLRALRDAGLKVALLSNSWGHTYDRRGWEGLFDTVVISCEVGLRKPEPEIFR
                     HTARLLDRRLEECVMVDDLGRNVRAARELGMAGVHHRTARETARALIPLLPPAGRQAV
                     LDHLSAAPSGA"
     gene            208724..209515
                     /locus_tag="SFLA_RS00740"
                     /old_locus_tag="Sfla_0162"
                     /db_xref="GeneID:11369648"
     CDS             208724..209515
                     /locus_tag="SFLA_RS00740"
                     /old_locus_tag="Sfla_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014152305.1"
                     /db_xref="GI:503918311"
                     /db_xref="GeneID:11369648"
                     /translation="MRLGRPVEDIVRELDENGFAPLDDLVPESVLEVMRRGCDDLIGR
                     TRQMRHSSQGWQLEAEGDGGGWAARATGREGIPGKVRVVGYAHEHSPEIAKVPGLLGL
                     NENLVEPLHGLRGDFYNSYLWAKPSEVGSEKPWHQDALFLKEEFYEAYEDVFTIWIAV
                     DDAREDNGCLRFLPGSHRGSVLQEPRGINREDLFASPHEPSLDIETLWPELTPVTLPR
                     RPGSAVIFSAFTAHTSSANVTEDQRRAVSYVYSLPRRPGTTGAGR"
     gene            209512..210528
                     /locus_tag="SFLA_RS00745"
                     /old_locus_tag="Sfla_0163"
                     /db_xref="GeneID:11369649"
     CDS             209512..210528
                     /locus_tag="SFLA_RS00745"
                     /old_locus_tag="Sfla_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_014152306.1"
                     /db_xref="GI:503918312"
                     /db_xref="GeneID:11369649"
                     /translation="MTAAAPGESLGTASRVHRTPELRPLDPAVHTDIVWELARARDLA
                     ALGHEETTHRWIAGRLTAPGVDPARDARLCLGSGGEVTGAAWAGRTSGVAGWVVELVL
                     GPRATAADGRGLLDFAVARCREGLGGPDGSERASLSCFTSEGEHTTRAALRDHGFGSP
                     RGYDRMSVALDGTPVPVPAVPGAVVRPLREEADLRAFHRAKNQAYAAEEAGKEEDSFD
                     AWSRWYRSDPGVAPEQCALLELDGDVVGFVNVTDRMLESRGVAYVRQLGIDPSVRGRG
                     LGAVLLGWALDEARRRGRTGMVLTVDRENVRARALYRRLGWRVESRWDDVRRTVTLPR
                     GGHD"
     gene            complement(210557..211348)
                     /locus_tag="SFLA_RS00750"
                     /old_locus_tag="Sfla_0164"
                     /db_xref="GeneID:11369650"
     CDS             complement(210557..211348)
                     /locus_tag="SFLA_RS00750"
                     /old_locus_tag="Sfla_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_014152307.1"
                     /db_xref="GI:503918313"
                     /db_xref="GeneID:11369650"
                     /translation="MSVPIQPSQKNQKSVGCSHVGDGVVLVEFSGAHEQNPFSRARMQ
                     ELTALMHDLDQDASVRSVVLHGGSGRSFGVGGDFNEVSAFTGGDEVSDWIDDITDLYT
                     AIAGISKPVVAAIDGYAIGIGLQIALCCDYRVAADTARLVMPELRVGIACNFGGFMLR
                     YTVGTSVMQRMLFTCEEWPADRALEDGLLHEVRPSEDVLDRALELARTIAGYTPAAVQ
                     GTRPRVNAPFVEGLERVRTEAKESHRRAFSAGEAQARMRRIIGKD"
     gene            211550..212611
                     /locus_tag="SFLA_RS00755"
                     /old_locus_tag="Sfla_0165"
                     /db_xref="GeneID:11369651"
     CDS             211550..212611
                     /locus_tag="SFLA_RS00755"
                     /old_locus_tag="Sfla_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152308.1"
                     /db_xref="GI:503918314"
                     /db_xref="GeneID:11369651"
                     /translation="MREKDRQVPLTIVLGTGRCGSTMLSDLVNEHPGALSLSEFFACL
                     DPGVFPVGTLDGPAFWKLLGTPRLKPNVLMTHGVTVPEYRYPIGSGRYAAGEVPAISL
                     MTLPPLTGDPDGLYDRIRAEVISWPPAPVSHQYLRLFSWWAFSSGRDVVVERSGASLR
                     FLPELLTQFPAARFVHMYRDGPDSAMSMSRHPLFRLGVMIGDMRAELGVDPYRNPDPR
                     HTELLPARLRPFAPYSLDAAALAGTDIPLVRFGDMWSRATGALRHLAGLPAERLLHLS
                     YDAVMTDPEPQLTTFGHFAGLAEPEVWAARVAGKVDRKRAGAASRLSAGQAEELRLAC
                     VPGTRRLTGLLDGTAAAAR"
     gene            212780..213229
                     /locus_tag="SFLA_RS00760"
                     /old_locus_tag="Sfla_0166"
                     /db_xref="GeneID:11369652"
     CDS             212780..213229
                     /locus_tag="SFLA_RS00760"
                     /old_locus_tag="Sfla_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_014152309.1"
                     /db_xref="GI:503918315"
                     /db_xref="GeneID:11369652"
                     /translation="MASYRTVLVGTDGSESSFAAVASAARLAVACRAELVIVCAYSPM
                     RGPDLDVAKDQLGAEAYQVVGSAPAEDTLRVARDRARDEGLEDARSVAVEDRPVAALE
                     RIAQEYAADLIVVGNRGLRSLAGRLLGSVPADIARKAGLDVLIVHTT"
     gene            213256..214392
                     /locus_tag="SFLA_RS00765"
                     /old_locus_tag="Sfla_0167"
                     /db_xref="GeneID:11369653"
     CDS             213256..214392
                     /locus_tag="SFLA_RS00765"
                     /old_locus_tag="Sfla_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase"
                     /protein_id="WP_041825547.1"
                     /db_xref="GI:754215100"
                     /db_xref="GeneID:11369653"
                     /translation="MAGPAGSDELHQTIEEMLLDGRRLWTRRDIAERSGVAPERSAQI
                     WRALGFPVADDDARVFTDADVDALRSGERLVEAGLITEESATGMARALGHHLSRLAEW
                     QMQTLWTWLSHDSGEGDSGAGAALTEHAAQLLPEMESLQRHVWRRHLAAHAGRMLAAD
                     GADILTRSARESAADTVEGAQDRGVGATSPVGCETGPPHGGAEIRHLAVGFTDMVAYT
                     RMTRGLDSAELARVLDRFESVVGDVVAEGRGRVVKTIGDEVFFVCESASAAAGIALEV
                     TARAESDRDVPHLRTGLAHGAVLSRFGDVYGAAVNIAARLTAVARPDTVLVDTAFAGE
                     LAGTTSYTLKVLRPVSVRGYSRLRPVLLRSARSGEPSAPRRSRR"
     gene            complement(214639..215034)
                     /locus_tag="SFLA_RS00770"
                     /old_locus_tag="Sfla_0168"
                     /db_xref="GeneID:11369654"
     CDS             complement(214639..215034)
                     /locus_tag="SFLA_RS00770"
                     /old_locus_tag="Sfla_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynein regulation protein LC7"
                     /protein_id="WP_014152311.1"
                     /db_xref="GI:503918317"
                     /db_xref="GeneID:11369654"
                     /translation="MSGTSHPGPLVEIMTALRERVMGVHDLVLSTGDGLLVAADAATV
                     HPESIAALSAATLSLGQRLAHEAEGGTLRDVTTRCAGRHVLIQAVGDRALLTVLGDEG
                     LDLALLHLHMPATVDQLVRILDKDAPSAS"
     gene            complement(215074..215295)
                     /locus_tag="SFLA_RS00775"
                     /old_locus_tag="Sfla_0169"
                     /db_xref="GeneID:11369655"
     CDS             complement(215074..215295)
                     /locus_tag="SFLA_RS00775"
                     /old_locus_tag="Sfla_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152312.1"
                     /db_xref="GI:503918318"
                     /db_xref="GeneID:11369655"
                     /translation="MNARRRTRAKARNLLLARRLRSHRRNRPPPPLPVRRPGSPSTLP
                     RLPDGLDAHRPDIGLLRRVYTRLIDSPEP"
     gene            complement(215292..216107)
                     /locus_tag="SFLA_RS00780"
                     /old_locus_tag="Sfla_0170"
                     /db_xref="GeneID:11369656"
     CDS             complement(215292..216107)
                     /locus_tag="SFLA_RS00780"
                     /old_locus_tag="Sfla_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152313.1"
                     /db_xref="GI:503918319"
                     /db_xref="GeneID:11369656"
                     /translation="MTTRAEGPRNVSAVLHTLYEQERDATVLVAGAPGGRIHVRQGLV
                     VSIDTPGAPGAESILLRSGRVADTEWTAVRAACRDEEGRLADELSARGLLTATEFEVL
                     CVAAVFDAAFVLALAAPQGWEVTGPVPVPVSGPGLTPRRIAAETTRRLAALNGQWMPA
                     SALAVLRVQPAEPVPSLLPSRYVTLLRAANDRRTPRDLAFALGRGTYAVMLDLARLHT
                     LGLLQETAPVTDARPSTAPRVPASGTRSPEPAPVVTLPRRTPGAHQLGGADRS"
     gene            complement(216104..216466)
                     /locus_tag="SFLA_RS00785"
                     /old_locus_tag="Sfla_0171"
                     /db_xref="GeneID:11369657"
     CDS             complement(216104..216466)
                     /locus_tag="SFLA_RS00785"
                     /old_locus_tag="Sfla_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152314.1"
                     /db_xref="GI:503918320"
                     /db_xref="GeneID:11369657"
                     /translation="MGRVSSVEDSLGHLLQVPGVTGVSLVDAVSGLSYGAAGPQNLGV
                     DECGRLAVLIDERLHSAGAEGELETVVVTGARHQLVLRVLPGFGDPLLLAVALERERA
                     NLALVLRHLDVFPAREAA"
     gene            216614..216979
                     /locus_tag="SFLA_RS00790"
                     /old_locus_tag="Sfla_0172"
                     /db_xref="GeneID:11369658"
     CDS             216614..216979
                     /locus_tag="SFLA_RS00790"
                     /old_locus_tag="Sfla_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152315.1"
                     /db_xref="GI:503918321"
                     /db_xref="GeneID:11369658"
                     /translation="MTVETALKEAMAIDGALGVALVDYESGMSLGTLGGEAGLDLEVA
                     AAGNTEVVRAKIRTLATLGMEDTIEDILITLGRQYHLVRPLASSSGSLFLYLALDRGR
                     SNLALARHSLKRIESSLDI"
     gene            complement(217109..220117)
                     /locus_tag="SFLA_RS00795"
                     /old_locus_tag="Sfla_0173"
                     /db_xref="GeneID:11369659"
     CDS             complement(217109..220117)
                     /locus_tag="SFLA_RS00795"
                     /old_locus_tag="Sfla_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152316.1"
                     /db_xref="GI:503918322"
                     /db_xref="GeneID:11369659"
                     /translation="MHPRLFPRARRHLATLLVGGFLAGGVWAGPTATAAPGDIPPQEP
                     GVTLRVFDTQVPLSGLCTLKPGQTPNHDKLMPTVDWSTVDDFGGYADNFVAEVSGYLV
                     VPADGTYDFRLTSDDGSRLTIDDQQVIDHDGLHGAEPKDGSASLTAGSHPFRVDYFER
                     GGDQRLTLAWKPPGAGDFGTIPNEALTTDAGVVRVTAPGRKECESGADTPGDGLPLTA
                     VRPDLDLTDLRPEGFEPQVTGMDWLPDGRLALSTWGGSETTTGEVYLLGNVTGDTSRD
                     KVTVEKIAEGLREPMGIKYVDGSLYVSQKHELTQLVDKDADFVTDEYRTVATWPYGGN
                     FHEFAFGLLYRDGYFYVNLSVAIDYGGATTTPQPAQGRGTTYKVSKKTGRIQAVAGGL
                     RTPNGIGWGPEGSLFTTDNQGGWLPASKLVQIKQDRFFNHYTQPSGAFDDRTPTQPVL
                     WLPQNEIANSPSTPLYLDKGRFAGQMLFGDVTYGGLQRAYLEKVKGQYQGAVFRYTQG
                     LEAGVNRITMGPDGSIYTGGLGADGNWGQEGKLKFGLQKLTPNGGNTFDIKEMRAVPG
                     GFDLEYTQPLSEATAEELASHYRAEQWRYTPTSDYGGPKIGEERLAVRSATLSGDSRT
                     VRLRLDGLKPDRVVHVRSPRPFASTSGESLWSTEAWYTLNALPGKQPPPATLYEAEEA
                     RLTGTAGVHTDHPGYSGSGFVDRYNTENRTGTTFDVTVPKAGDYDVNLRYSNGPNPFQ
                     GTKSLSLHVNGKKLRQTRLPSTGTWDTWSTQTERVRLKAGSNTLSYRYDTGDTGHVNL
                     DLITVHRHGASVSLFDGTTASQGQWQHTDGRRVAWPLTAERSMEVCCGDIRTKDAYQD
                     FRLRMEFRVPLLPDDVTGQDRGNSGVYLQDRYELQILDSFGDTTPDTNEAGAIYQKKA
                     PDINAATAPETWQTYDVTFRAARFDDSGRKTADARVTVVWNGRTVHDDIAIDGPTGAG
                     APESPSAGAIRLQDHGNAVRFRNIRIEPLS"
     gene            220476..221507
                     /locus_tag="SFLA_RS00800"
                     /old_locus_tag="Sfla_0174"
                     /db_xref="GeneID:11369660"
     CDS             220476..221507
                     /locus_tag="SFLA_RS00800"
                     /old_locus_tag="Sfla_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase"
                     /protein_id="WP_014152317.1"
                     /db_xref="GI:503918323"
                     /db_xref="GeneID:11369660"
                     /translation="MPHTSRPLRKLGFLTIGLYDEDDPGRGHESTLRLIELGERLGFD
                     SAWVRHRHLQYGISSPVAVLAAATQRTRRIELGTAVTPLGWENPLRLAEDFATVDVLS
                     GGRLNPGISVGPPMFYDRVKDALYPQTAEAEDFGYGRVERLLDLVRGEPATASGGTEG
                     FEVFSDRVQPHSPGLHRRMWYGGASLRSARWAGEHGMNLLTSSVVKAEGPGDEPADFA
                     AVQLAQIRAFRAAHPDGEAARVSQGLVVIPTDSASPEQRARYERYAEERLPRTAVPQG
                     PGRMMFAPDLVGTSEVIAERLRAHAAFREVDEVAFALPFTFEHQDYEQILTDIATRLA
                     PALGWRSGT"
     gene            221610..222356
                     /locus_tag="SFLA_RS00805"
                     /old_locus_tag="Sfla_0175"
                     /db_xref="GeneID:11369661"
     CDS             221610..222356
                     /locus_tag="SFLA_RS00805"
                     /old_locus_tag="Sfla_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="WP_014152318.1"
                     /db_xref="GI:503918324"
                     /db_xref="GeneID:11369661"
                     /translation="MIVSNGSERAPAISLTKVMERAPDLVDLYKAAGSSVRAHGLEGV
                     RAAVYLVLDRSGSMRPYYRDGTMQHLAEQVLSLSAHLDDDGVVPVVFFSTDVDGCTDL
                     TLGRHRGLMDKLHANLGHMGRTNYHWAMDEVIDHYLASGSEAPALVVFQTDGGPTSRL
                     AAERYLCKAARLPLFWQFIGFGDPEDNEFAFLHKLDTLAVPARRTVDNAGFFHAGRTP
                     RTTDDNRLYDRLLHEFPQWLDAARAARILE"
     gene            complement(222488..223504)
                     /locus_tag="SFLA_RS00810"
                     /old_locus_tag="Sfla_0176"
                     /db_xref="GeneID:11369662"
     CDS             complement(222488..223504)
                     /locus_tag="SFLA_RS00810"
                     /old_locus_tag="Sfla_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014152319.1"
                     /db_xref="GI:503918325"
                     /db_xref="GeneID:11369662"
                     /translation="MNEDVARPRQPSMADVARVAGVSAQTVSRALRGSAHVNPDTGRR
                     VLAAVEQVGYRFNSAARALSSGRSLTVGLVLLASGGYYSRSAVTAGVESAADDAGYAV
                     SIATIASLDARRMERALARLADQGVDGLVIAVPLISVTRKMEDITRDIPTVTLDGSRT
                     AGARVIGIDQREAGRIATQHLLDLGHRQIWHLSGPDEWLEARQRREGWQECLALAGIE
                     APPALEGDWSPGSGYRQGQIIAMIPEVTAVFVACDEMAFGLIRALRERGRAVPEDVSV
                     VSVDDIALASYCTPPLTAVRQDFFGHGAAAVRLLLQDDATVEPSAVEATLSVRASTAP
                     PRPR"
     gene            223554..225440
                     /locus_tag="SFLA_RS00815"
                     /old_locus_tag="Sfla_0177"
                     /db_xref="GeneID:11369663"
     CDS             223554..225440
                     /locus_tag="SFLA_RS00815"
                     /old_locus_tag="Sfla_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_014152320.1"
                     /db_xref="GI:503918326"
                     /db_xref="GeneID:11369663"
                     /translation="MSSITYPPAVTDSSTTQPSEPPSTTATACGAALSWRDGRLYRGG
                     VPHRILSGSLHYFRVHPDLWQDRIRRIADLGLNTVDTYVPWNFHQLHEDRSPRFDGWR
                     DLERFIRTVGEEGLDVVVRPGPYICAEWSNGGLPSWLTAKDLAIRSSDPAFTTAVARW
                     FDHLIPRLATLQASRGGPVVAVQVENEFGSYGDDHAYVRWCRDALVERGIGELLFTAD
                     GPTELMLDGGTLPGTLTAATLGSKPEAARRLLVSRRPEEPFLVAEFWNGWFDHWGERH
                     HVRGVESAVHTLRGIIADHGSVSIYMAHGGTNFGLWAGANESDGRLEPVVTSYDSDAP
                     IAEDGRLTPKFFAMREALGVREPVRSAARMPTLPPAHVPLVHRAGLLAALRAASTGAT
                     TTPRPASFEQLGLDAGMVLHTAHPRIPAGEHRLLFTDVRDRARVFADGILLGVVDARS
                     PELPVTGTGRLVRLEVLVENLGRINYGPGVGRHKGLLGPVLVDRRMVQGWQSAPLALQ
                     EWSSAELSDTIAAGFAASSAETAPATESTGFAVAELHVGTPADTFLALPGSGHGLVWV
                     NGFLLGRHWDIGPQVTLYCPAPLLRAGSNTVTVLELERLGKTLELRDRAELGPPEEYV
                     EEFD"
     gene            225558..226199
                     /locus_tag="SFLA_RS00820"
                     /old_locus_tag="Sfla_0178"
                     /db_xref="GeneID:11369664"
     CDS             225558..226199
                     /locus_tag="SFLA_RS00820"
                     /old_locus_tag="Sfla_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152321.1"
                     /db_xref="GI:503918327"
                     /db_xref="GeneID:11369664"
                     /translation="MIRMSDPTEREDNAVAAVPTSPQEWRDFLERYGERYLKSCADDD
                     ELVDLLDEDQLDAFDRGERVSVWLGEAPAREEALVASEERLGVRFPPSLRGFFLASDG
                     WAHLDAWVEGVHPCGRVSWMRDGDAGMRVTEIYESIPGNEDDVQLFRRSVEVARGEDF
                     WLLDPTDVGPDGEWAAYEFAPKYGNPTKFPSFAALFHSGYDEDEGEEEGEDLA"
     gene            complement(226349..227389)
                     /locus_tag="SFLA_RS00825"
                     /old_locus_tag="Sfla_0179"
                     /db_xref="GeneID:11369665"
     CDS             complement(226349..227389)
                     /locus_tag="SFLA_RS00825"
                     /old_locus_tag="Sfla_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152322.1"
                     /db_xref="GI:503918328"
                     /db_xref="GeneID:11369665"
                     /translation="MTGRTPFGRRRRGRHDQDTDRRPVGEGAEPPKPVLRRPRTGLAS
                     VALATVAALFATSCSAAGEEAPATSPSVAPLVPSEGALLGHYYGDGTVEETAARIGTT
                     PGIHLTYYGWDDDWSASEATRDDLSGNRIPLVNWEPFDVDFDDIIDGSLDATIEKQAD
                     GAKELEKPFFLDFAAEMNEEEGWGGHDPERYIAAYRHIHDVFDDRGASNVVWVWAPNV
                     TDSVDAPAAMSYYPGDRYVDWTGVDGYNWGTSEPDFAWQSFTDLFRDIYAELAVKGKP
                     IIIGETGSDETGGSKAEWIRGIVPGLKEEFRLIKALVWFDVDKERHWQINSSPAALAA
                     YRRMASDPYLAP"
     gene            227714..228646
                     /locus_tag="SFLA_RS00830"
                     /old_locus_tag="Sfla_0180"
                     /db_xref="GeneID:11369666"
     CDS             227714..228646
                     /locus_tag="SFLA_RS00830"
                     /old_locus_tag="Sfla_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152323.1"
                     /db_xref="GI:503918329"
                     /db_xref="GeneID:11369666"
                     /translation="MQRIDVTRDDGTWAGLSLDVRDRHQPDLCVHTAGPRLLVSQLSR
                     PVLLAVVEEPLQGVHFRRADGYRSFVPPLRADTARALSGSPERWAHRFARYLSDSPGS
                     PLHEGRWLLTCESPILHGRHPTTSHAEHWSSMLVEGDPDGYIDWYLHSHSWEVLPLRP
                     MPGPGDSRVKAYRKQAREGTLPPVLLWWVSGLDCHLILDGHARLAAAIAESVEPPLLQ
                     VHRTAARDDLAAGIEDAVGAYESALARFAGLRAFHGPTVPDGAATTGPQFARQLRDLH
                     TARQPTWSWPLPGGEDQWWRIAHEVTVGNAWPPA"
     gene            228855..231446
                     /locus_tag="SFLA_RS00835"
                     /old_locus_tag="Sfla_0181"
                     /db_xref="GeneID:11369667"
     CDS             228855..231446
                     /locus_tag="SFLA_RS00835"
                     /old_locus_tag="Sfla_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 5"
                     /protein_id="WP_014152324.1"
                     /db_xref="GI:503918330"
                     /db_xref="GeneID:11369667"
                     /translation="MSAAALLFAAALAVPGTAGAQEAEPGPEQISNGDFAAGTAPWWW
                     TANAPSAVSDGRLCAQVPAGTANAWDVIVGQNDVPIVAGESYELSYSASATVPLTVQT
                     RVQEAAEPYTTVLATADPVGAEATQVTRTFTASVDLPAASVQLQIGGGERATTFCLDD
                     VSLRGGAEPPVYVPDTGSPVRVNQVGYLPHGPKSGTVVTDADDPLTWAVKTSAGTTAA
                     TGRTVPQGEDPSSRQRVHTFDFGDLTTAGDGYTVEVDGETSEPFSIRGNLYDGLRSDA
                     LAYFYHNRSGTPIEADLVGEKYARPAGHVGVAPNKGDTDVPCQPGVCDYRLDVSGGWY
                     DAGDHGKYVVNGGISVAQLMSTYERTLTAPNAESAELGDGKLRVPERDNGVPDILDEA
                     RWEMDFLIKMQVPAGEPLAGMAHHKMHDAQWTGLPMKPHLDPQQRELHPPSTAATLNL
                     AASAAQCARLYAPFDAAFASRCLRAAETAWAAAKQHPDVLADPNDGTGGGAYSDNDVS
                     DEFYWAAAELFTTTGKDTYRQAVLSSPLHGDTDAAFPAGGGISWGYTAGLGVLTLATV
                     PNGLTQAQLGEVRAVVTTGADRYAAQSRAQAYGLPYAPEDENYVWGSNSQVLNNMIVL
                     ATAHDLTGEAAYQDAVLSGADYLLGRNPLNQSYVTGYGERDSHNQHHRFWAHQNDSAL
                     PNPAPGSIAGGPNLTAIASGDPVAAQKLSGCAPAMCYIDDIGSWATNEITVNWNAPLA
                     FIASYLDDAGEGGRAAPARTCRVSYASHPWNSGSTVTVRVENTGSEPVSPWSLTWLLP
                     GDQRIGHTWSAELDQHGRTVSARPLSWNRTLAPGAAVDFGFNTSAASTVPDPESFKLN
                     GRACASG"
     gene            complement(231574..232053)
                     /locus_tag="SFLA_RS00840"
                     /old_locus_tag="Sfla_0182"
                     /db_xref="GeneID:11369668"
     CDS             complement(231574..232053)
                     /locus_tag="SFLA_RS00840"
                     /old_locus_tag="Sfla_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152325.1"
                     /db_xref="GI:503918331"
                     /db_xref="GeneID:11369668"
                     /translation="MDVLLDLLNSRPLVDGEERDALGDPAEGRRWAREHGGEGSPAEL
                     ELLRETRDVLRDVVLGRRSPVAFGPLLEGVHRTPEMTSDGLRWLLRTAPHARLAAEVV
                     LAWADTEEQLPGRLRPCANDGCRLFLLDRSRANRARWCSMAVCGNREKARRHYERTR"
     gene            232158..233036
                     /locus_tag="SFLA_RS00845"
                     /old_locus_tag="Sfla_0183"
                     /db_xref="GeneID:11369669"
     CDS             232158..233036
                     /locus_tag="SFLA_RS00845"
                     /old_locus_tag="Sfla_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014152326.1"
                     /db_xref="GI:503918332"
                     /db_xref="GeneID:11369669"
                     /translation="MSAVHHRTTVVDGHRIHYREAGHADAPAIVLLHGFPTSSFMFRE
                     LIPLLADDYHVIAPDHLGFGHSDAPRAAEFDYTFDALADITSGLLDQLGLERYALYVQ
                     DYGAPIGWRLALTHPERISALVTQNGNGYEDGFVESFWTDVWAYGAAPGPDTEPAVRT
                     ALGIDAIRWQYVHGVPDPSLVSPDTWEHDFALVSREGNDEVQLALFRDYRNNRPLYPL
                     LHEFLRTSEVPVLAVWGRNDEIFGPAGARAFARDAKDAEVHLIDGGHFLLESHLDVVA
                     GYLRGFLGRVLGHAGS"
     gene            complement(233061..233591)
                     /locus_tag="SFLA_RS00850"
                     /old_locus_tag="Sfla_0184"
                     /db_xref="GeneID:11369670"
     CDS             complement(233061..233591)
                     /locus_tag="SFLA_RS00850"
                     /old_locus_tag="Sfla_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152327.1"
                     /db_xref="GI:503918333"
                     /db_xref="GeneID:11369670"
                     /translation="MLAVVVPVAVAVGIYLVGTHHTPDYLNGLFGRYGTDAVDLKARL
                     GTALLGLALAQLGLALWMYGRLPGARPAPRPVRPGHRVLGFLAFLLSLPIAYHCLTTY
                     GIETTSARVAIHSFAGCALYGAFVAKVIVVRSRRLPGRLLPVVGGLLVLGVALLWYTA
                     ALWALDGDSVPGFPSG"
     gene            complement(233657..234148)
                     /locus_tag="SFLA_RS00855"
                     /old_locus_tag="Sfla_0185"
                     /db_xref="GeneID:11369671"
     CDS             complement(233657..234148)
                     /locus_tag="SFLA_RS00855"
                     /old_locus_tag="Sfla_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152328.1"
                     /db_xref="GI:503918334"
                     /db_xref="GeneID:11369671"
                     /translation="MKRTATAVTCAATLLLAGALTGCSENTSGEGNGPTSSSASPSAP
                     ATVDTKSAGGLGDILVDDKGNTLYLFLADKKNKSNCNGACAKAWPPLLTKGAAEVGKG
                     VDKKLLDTTKRSDGDEQVTYNGHPLYYYAGDTEPGQTNGQNLDQFGAEWYVLDTKGKQ
                     VES"
     gene            complement(234393..235022)
                     /locus_tag="SFLA_RS00860"
                     /old_locus_tag="Sfla_0186"
                     /db_xref="GeneID:11369672"
     CDS             complement(234393..235022)
                     /locus_tag="SFLA_RS00860"
                     /old_locus_tag="Sfla_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152329.1"
                     /db_xref="GI:503918335"
                     /db_xref="GeneID:11369672"
                     /translation="MVTDRQGHSRTDATVRCGAATLVLLLAGCAGGGAGGASDAKPSG
                     GVPSTTTAVAPETALSSAQLATPAPGEAGHAEVLEVYRLMAAEYEKAYRAASAEGTDL
                     ERYMAPAAAGEVEKDLARLAGQGAAMRGALGHDPEVTALAAAAQPPTATVRDCVDASG
                     WQTLDTTTGWRIPRPDDQPSRYVATARMEHRPGERWKATAYTVDEKRSC"
     gene            235311..236531
                     /locus_tag="SFLA_RS00865"
                     /old_locus_tag="Sfla_0187"
                     /db_xref="GeneID:11369673"
     CDS             235311..236531
                     /locus_tag="SFLA_RS00865"
                     /old_locus_tag="Sfla_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030125080.1"
                     /db_xref="GI:662753828"
                     /db_xref="GeneID:11369673"
                     /translation="MPDTSAFHRKRRRPALLVSAAAATAALVAGLLSLPAAPRAEAAP
                     AVFAHPGVTVSKGQLDFTRGKVDAGAQPWKGAFDQMMASRYADPNRTAKPRATVECGS
                     YSNPNYGCTDEREDAIAAYTNALAWYLTRDDRYAKKSIELMDAWSAVIKSHTNSNAPL
                     QTGWAGSSWPKAAEIIKHTYTGTWAGSGRFATMLRDVYLPKVINGSHSNGNWELSMTE
                     AAVGISVFLEDKASYDKAMATFRTRTAAYVYLASDGALPRTVPSQNLDTTAKIVGYWQ
                     GQSTFVTGLTQETCRDLTHTGYGISAIAHIAETSRIQGQDLYGTDVGERLRQALGFQS
                     RYQLGETVPSWLCGGSLNLGLGPVTEVGYNALHHRLGIPMTNTQRLTEQNRPAGSNNL
                     FVAWETLTHGDNPN"
     gene            236653..237249
                     /locus_tag="SFLA_RS00870"
                     /old_locus_tag="Sfla_0188"
                     /db_xref="GeneID:11369674"
     CDS             236653..237249
                     /locus_tag="SFLA_RS00870"
                     /old_locus_tag="Sfla_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="WP_014152331.1"
                     /db_xref="GI:503918337"
                     /db_xref="GeneID:11369674"
                     /translation="MNEETPPATVRVFVALAPPDRAKDELARELRPAYDTHPHVRWNR
                     IEDWHITLAFLGEIPTATVPLLRPPLARLASAHRPPRLALRGSGTFDDRVLWTGVDGD
                     LDELHLLAADVRTAVKGCGVAFEDRPLRPHLTLARARRGDRSSMAEIAEGVAGFDGRR
                     WPAERLHLVGSNFGRSAGPIHYRDIEAWALGGGSGPGV"
     gene            237351..239357
                     /locus_tag="SFLA_RS00875"
                     /old_locus_tag="Sfla_0189"
                     /db_xref="GeneID:11369675"
     CDS             237351..239357
                     /locus_tag="SFLA_RS00875"
                     /old_locus_tag="Sfla_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249784.1"
                     /db_xref="GI:702732613"
                     /db_xref="GeneID:11369675"
                     /translation="MVVYEQGAVCRRLARGVVPPDGRVRVTGLPRSLDPSSLRARVPE
                     ARGVRVSEARVEFEAEPLGTATDGLREEVARLRDEHAAAQGRRDHQLSLIEEVRSLHP
                     VPPPRPPEDAVRRTPVDAWLELAGFVDERLTRLHARLVELEDTLRVTGHELGIAVDRL
                     ARASTDVPSAHVGTTVSALLTFDVRGPGKPDAEVELELEYGVPGAVWAPAYRLTYRQG
                     DSTGRLVLRASVAQRTGEDWTDVSLGLATADLRRATGLPKLRSIRIGRSQPAPAPAGW
                     REPPAGLSDLFNGYDTAPGRPAPAAQPVVPSAPPPVPPPPPAPQAYGGPPAPLAAAGR
                     TGAFPERFGGDVPAPAPAARARKAEPYRPAGMPSGAPVPAAPGGAPSLPSAAPPAGPP
                     QPSGAELDYAALVLCGPDERGDRRGRLFPGALPDPVAPEHRHRAESVAGLPLPGHAVR
                     PRESAGSFDHRFDTAARTDIPSDGTWHTVTIGETSVGTHTDYLCTPSVEQTVYASLTL
                     SNSSDQALLAGPVEVTVDDDFLLTAALPTLAPGGARRVGLGPVEGIQVSRRTNLHESA
                     SGLRGSTTVLDHRVHVELANRLAGPVTVEVRERVPVTADPDVRIEERADWTEPEGGSV
                     QDHPAAGTRVWRVDIPVGGTTELDGGYEIRIPANRTVVGGNRRS"
     gene            239366..240928
                     /locus_tag="SFLA_RS00880"
                     /old_locus_tag="Sfla_0190"
                     /db_xref="GeneID:11369676"
     CDS             239366..240928
                     /locus_tag="SFLA_RS00880"
                     /old_locus_tag="Sfla_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152333.1"
                     /db_xref="GI:503918339"
                     /db_xref="GeneID:11369676"
                     /translation="MATHTNPIALPVTAVTCLEDRAHVERVVVLDLAAGVQRLRLGPV
                     SALAVDRTLHAELSAGHSATVLDVRMTRSWTPRGPVPHPEDDSAPRLRVHALVREQLD
                     LEQRRERLDARRHLLDALAADLLREIGEGAGAGDTDSARWSRELDRTDEERASCGEQL
                     RVVEARLAAVHDERGEAERAMRLTEEEPAALVGHIELTVETAAAGPVELRLSHLTPCA
                     LWRPAYRAVLVGDSLTLETDAMVWQRTGEDWPDVRLTLSTARSALATEPPSLGEDRLT
                     LTDRSAAERRTVGVELREEETHTLGATSVVGLPGVDDGGEARVLRSPARVSLPGDGRA
                     HRVPLSRFTTEARSEYACSPELSPLVTQVARFDNRAGHALLAGPVDLVRDSGFVGRGT
                     LDFSAPGAPCELAFGSRDDHRVVRRASETRETAGLTQRTVLTREVQLHLSRFSPPGEQ
                     GDRVVTVRERLPVSEVSAVDVRLRKDSCVPEPDVVDAEGIARWDVALPPDGRRTVTLV
                     YEVSVSSKVTGL"
     gene            complement(240975..241745)
                     /locus_tag="SFLA_RS00885"
                     /old_locus_tag="Sfla_0191"
                     /db_xref="GeneID:11369677"
     CDS             complement(240975..241745)
                     /locus_tag="SFLA_RS00885"
                     /old_locus_tag="Sfla_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152334.1"
                     /db_xref="GI:503918340"
                     /db_xref="GeneID:11369677"
                     /translation="MADESIQYPGLIVPAGHVEPVPRRVRATIGGSTVFDTRRALYVW
                     EWPPYPQFSIPVEDLSEGVLTDDGRTEERGAGPARRHTLTVGSEVREGAAWVWTDGAP
                     SALLGTVRFEWEALDSWFEEDEPVFVHPRSPYSRVDALRSSSSIRVELDGAVLAEAPG
                     CVKLFETGLPTRYYLDLTHVDRARLRRSDTVTRCPYKGTTSSYWSFDGDATHEDIAWA
                     YDFPTVHVDRIAGLVAFYNERVDLHVDGTKLPRPAGRA"
     gene            complement(241905..244034)
                     /locus_tag="SFLA_RS00890"
                     /old_locus_tag="Sfla_0192"
                     /db_xref="GeneID:11369678"
     CDS             complement(241905..244034)
                     /locus_tag="SFLA_RS00890"
                     /old_locus_tag="Sfla_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152335.1"
                     /db_xref="GI:503918341"
                     /db_xref="GeneID:11369678"
                     /translation="MSAEARKAAILRRSLRVTVAASVGFYLLLYVADLPAAALYALFA
                     PIAIGLLSAIPGSGRRQAFVVLRALPPALGLAALGTLLAVDTWSATGGMLVIGFLLAF
                     AAVAGPRPAGAAPGLQLFYILACFPPYAPDALGERLTGLAVGMLLLAASHALLPDPPV
                     PSYRKRLAAALATAARGVTTGEVTPQDLRDTGARMRLSRVPPSERPAGAGRTDRALEQ
                     GGRAVRRLLDQLAALPELPPPAPDHASDTLLGRVAVVCETCADSSVTGRRPPAPGALE
                     QAMRNFQSERVRTAPGPVAPARPAPEPPTAGANGRTPSLAVLRRQSRVLALAESARIV
                     EVTVDIAANGRPADPPAPRELFWYAELSTPKLWARRVLGNATLRSVLFQNAVRTALGL
                     AASRLVAGSLDLDHGFWVLLAVLTLGRTTVGATWRAARRALAGNAVGALVAGALLIGL
                     GAHTDAYAILLAPAMLVGFPLGPMLGTAYTQGLFTLVVATAFAQLAPVTWRLSEARMV
                     DVATGSVIGLLCGLLAWPAGAGREVRRAMAELLRTCGGLVPPTAEALLTPSPGSRSSP
                     RTLPSLHRFRLAKAAYAQYRSESGTASKDAEPDWHAVLIAAQHMLLGAHRLPRFGLRP
                     EIGPPNPSASRARTTAAGLRADADRIASLLTGGHPVSEPNTPPEPEGYSPASLSVDLE
                     VWMTSLGRQLAHVEASVTRRPAPDRAA"
     gene            complement(244375..244824)
                     /locus_tag="SFLA_RS00895"
                     /old_locus_tag="Sfla_0193"
                     /db_xref="GeneID:11369679"
     CDS             complement(244375..244824)
                     /locus_tag="SFLA_RS00895"
                     /old_locus_tag="Sfla_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore-associated protein"
                     /protein_id="WP_014152336.1"
                     /db_xref="GI:503918342"
                     /db_xref="GeneID:11369679"
                     /translation="MRTARNVAAVGAATALLVGGTAAFGASASAAPNVTPQGVCGKAY
                     KTVNSVPVGSLGTVYLTYNSSNGLNCVATIRTNPGSAKPMSAYIYVPATDEWAGDDGS
                     FTSYAGPGYVYGKGYCVSWGGSISNVYVSVENSNCASLKERRTTEIR"
     gene            245154..245702
                     /locus_tag="SFLA_RS00900"
                     /old_locus_tag="Sfla_0194"
                     /db_xref="GeneID:11369680"
     CDS             245154..245702
                     /locus_tag="SFLA_RS00900"
                     /old_locus_tag="Sfla_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="WP_014152337.1"
                     /db_xref="GI:503918343"
                     /db_xref="GeneID:11369680"
                     /translation="MAVWDRLKDQARTLQQTQGARGQAAGRSTGQGSGGGSRAQLVST
                     LKSQLASLKTELKSGAYRDASMAMCALVAAADGHVDPAERQHVESLILGNEVLQNFPS
                     EQLRQRFNKHVDQLTRNFQQGKADALQEIAKTAKKPAEARAVIQTGIVVAGADGDFSQ
                     AEHMILREACTALGLSPVEFQL"
     gene            complement(245963..246376)
                     /locus_tag="SFLA_RS00905"
                     /old_locus_tag="Sfla_0195"
                     /db_xref="GeneID:11369681"
     CDS             complement(245963..246376)
                     /locus_tag="SFLA_RS00905"
                     /old_locus_tag="Sfla_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="WP_014152338.1"
                     /db_xref="GI:503918344"
                     /db_xref="GeneID:11369681"
                     /translation="MRARPVLIYDGDCAFCTSSVRFAERRLRPRCEISPWQFADLDAL
                     GVTRERAEYEVLWVTPAGVVHGGVQAVARLLQDAGRGWYVPGVLLTLPPLRWIAHGVY
                     RLVASHRERMPGGTPACALPTDRRSGAREPSGPVE"
     gene            246565..247575
                     /locus_tag="SFLA_RS00910"
                     /old_locus_tag="Sfla_0196"
                     /db_xref="GeneID:11369682"
     CDS             246565..247575
                     /locus_tag="SFLA_RS00910"
                     /old_locus_tag="Sfla_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class A beta-lactamase"
                     /protein_id="WP_014152339.1"
                     /db_xref="GI:503918345"
                     /db_xref="GeneID:11369682"
                     /translation="MLRVDRLSPRAVPRSKEATATVPTPLPRRTALRTLAGLVALPVA
                     ACDPTTPAAAPPAVPSTPGGSGHRPGRAFQGLEKRFGARLGVYAIDTGTGASVTHRPD
                     ERFAYASTCKALLAGTVLGMHTLQQLERRVRYGPGDLVANSPVSERHVEAGMTLRALC
                     DAAVRHSDNTAANLLFREIGGPRRLQDALLALGDRTTRCDRYETDLSEAAPGDPRDTS
                     TPRALATDLRAYALGDVLGDEKRAVLTDWLRRNTTGDALIRAGTPAGWPVGDKTGTGG
                     YGTRNDIAVVWPPHSAPITIAVLSRRASRGAKPQDALIARAARVALTALAGQKYPVPQ
                     GR"
     gene            complement(247563..247949)
                     /locus_tag="SFLA_RS00915"
                     /old_locus_tag="Sfla_0197"
                     /db_xref="GeneID:11369683"
     CDS             complement(247563..247949)
                     /locus_tag="SFLA_RS00915"
                     /old_locus_tag="Sfla_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_014152340.1"
                     /db_xref="GI:503918346"
                     /db_xref="GeneID:11369683"
                     /translation="MVHVLSSRVLLTPRDPEVSRDFYGRTLGLSVYREFGTGPERGTV
                     YFLGGGFLEVSGRSDAPPTETLRLWMQVDDCAAAHEEVAARGAHVLCPPLQEPWGLIE
                     MWIADPDGHRIVLTEVPARHPLRYRP"
     gene            complement(248343..249278)
                     /locus_tag="SFLA_RS00920"
                     /old_locus_tag="Sfla_0198"
                     /db_xref="GeneID:11369684"
     CDS             complement(248343..249278)
                     /locus_tag="SFLA_RS00920"
                     /old_locus_tag="Sfla_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="WP_014152341.1"
                     /db_xref="GI:503918347"
                     /db_xref="GeneID:11369684"
                     /translation="MSAPELIRIVSRDSPMALAQVERVRAGLAALHPDTVTEVVPVRT
                     TGDKWLGDLSKVEGKGAFTKEVDAALLAGEADLAVHCVKDIPADRPLPAGTTFAAFLE
                     RDDIRDALVHPDGLTLEQLPEGTRIGTSSVRRTAQLASSHPHLDCVPFRGNANRRLAK
                     LAAGEADALLLAVAGLHRIGRPDVISDILAPETMCPPIGAGVLALQCREDDTATIEAV
                     GALNHPGTYREITAERMFLHVLQGHCNSPIAGYATAHRNGDLSLRACVFTPDGKTVLN
                     AHEWAGPLDPATLGTSVAVSLLRQGARELIDSIAH"
     gene            249673..250488
                     /locus_tag="SFLA_RS00925"
                     /old_locus_tag="Sfla_0199"
                     /db_xref="GeneID:11369685"
     CDS             249673..250488
                     /locus_tag="SFLA_RS00925"
                     /old_locus_tag="Sfla_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152342.1"
                     /db_xref="GI:503918348"
                     /db_xref="GeneID:11369685"
                     /translation="MSNGDTSIPKNIDVNVPSVARMYDYYLGGKDNYPADRVACEHLL
                     ERVPSTKVLAVNNRRFLRRVVHHLASEYGIRQFIDHGSGLPTQDNVHQVAQLVDPGAR
                     VVYIDNDPIVLAHGKAILEENDRTAVIQADMRDTEGILAHPEVVRLIDFDEPVAALFV
                     SVLHCIPDEDDPAGLVRRVAERLAPGSFLVVCQLVSEDAATRDFVTDYMAKSTGNQWG
                     RVRQQADVHGFLEGLDVLDPGLVEVSTWRPDSDLAPKQETEEWIEFGGVGRKW"
     gene            complement(250532..251440)
                     /locus_tag="SFLA_RS00930"
                     /old_locus_tag="Sfla_0200"
                     /db_xref="GeneID:11369686"
     CDS             complement(250532..251440)
                     /locus_tag="SFLA_RS00930"
                     /old_locus_tag="Sfla_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014152343.1"
                     /db_xref="GI:503918349"
                     /db_xref="GeneID:11369686"
                     /translation="MPGIEPLQPSPKPTLASATGASPTALRLVLGAQLRRMRGEAGIT
                     PDVAADRIRCSTAKISRMETGHSPCKERDAADLLALYGVTDPARTAEFIDLVRRAGQR
                     GWWRNYADVLPDWFEPLVGLEEAAASIRTYEGHYVPGLLQTADYAYAVVRSGHALESE
                     EITRRRVELRLRRQQLLQRRDAPKLWVLLDEAVLMRPTGGARVMREQLVHLLEMTQLP
                     HVIVQVAPFEVTAHTSPGNGITYLRFAMDGLPDVAYIEHLTNATSVNKQESTDEYRWI
                     LDSLSAQSPSPVASRDLLRQALERYS"
     gene            complement(251549..251785)
                     /locus_tag="SFLA_RS00935"
                     /old_locus_tag="Sfla_0201"
                     /db_xref="GeneID:11369687"
     CDS             complement(251549..251785)
                     /locus_tag="SFLA_RS00935"
                     /old_locus_tag="Sfla_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_014152344.1"
                     /db_xref="GI:503918350"
                     /db_xref="GeneID:11369687"
                     /translation="MQHYDNGVPANSLSGVEWRKSHHSNPSGNCVEMALLPGGEVAVR
                     NSRFPEGPALVYTGDEVRAFLAGVRDGDFDTMAG"
     gene            251988..252554
                     /locus_tag="SFLA_RS00940"
                     /old_locus_tag="Sfla_0202"
                     /db_xref="GeneID:11369688"
     CDS             251988..252554
                     /locus_tag="SFLA_RS00940"
                     /old_locus_tag="Sfla_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_014152345.1"
                     /db_xref="GI:503918351"
                     /db_xref="GeneID:11369688"
                     /translation="MHEENTPRHGAAALPPRPASGGADPHEELARDLGIDAPGFTTRG
                     LGADPESLRQARAFVRDALECWGLGSCADDVTLVAGELVSNAVCHGIQPTEEHPELPT
                     ARLGLACQDGALVCAVNDSSPEVPVLRRAEDWLERGRGLRIIDALSSSWGWSRPTVAG
                     KTVWAVIPVLLGPALHSPTSAVQASARR"
     gene            complement(252512..253144)
                     /locus_tag="SFLA_RS00945"
                     /old_locus_tag="Sfla_0203"
                     /db_xref="GeneID:11369689"
     CDS             complement(252512..253144)
                     /locus_tag="SFLA_RS00945"
                     /old_locus_tag="Sfla_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase/acylhydrolase family protein"
                     /protein_id="WP_015580142.1"
                     /db_xref="GI:505393040"
                     /db_xref="GeneID:11369689"
                     /translation="MTVSLHHSATVLFQGDSITEVGRLAERDCPLGNGYVRMAAESVR
                     SARPDSGITFLNRGVAGDGVADMRARWRGDALDLRPDVVSVLIGVNDTWRRYDSGTVT
                     SVRAYEDDYRAVLTQVRDATGAQLILVEPFLVPVRDEQWAWREDLDPRIQTVRRLAEE
                     FDAALLAADGLLNQAARAAGGPESIAGDGIHPTPLGHYLLAEAWTALVGL"
     gene            253579..253651
                     /locus_tag="SFLA_RS00950"
                     /old_locus_tag="Sfla_R0001"
                     /db_xref="GeneID:11369691"
     tRNA            253579..253651
                     /locus_tag="SFLA_RS00950"
                     /old_locus_tag="Sfla_R0001"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:253612..253614,aa:Trp,seq:cca)
                     /db_xref="GeneID:11369691"
     gene            complement(253695..254105)
                     /locus_tag="SFLA_RS00955"
                     /old_locus_tag="Sfla_0205"
                     /db_xref="GeneID:11369692"
     CDS             complement(253695..254105)
                     /locus_tag="SFLA_RS00955"
                     /old_locus_tag="Sfla_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015606625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ohr subfamily peroxiredoxin"
                     /protein_id="WP_014152348.1"
                     /db_xref="GI:503918354"
                     /db_xref="GeneID:11369692"
                     /translation="MDALYTAAATANGREGRAVSSDGQIDLALALPPALGGDGKGTNP
                     EQLFAAGYAACFASAMSSVAREMKVDTKDVSVTAEVSIGKDDSGFGLAVVMRVELPEA
                     LEGETGRRLVEATHAYCPYSKATRGNIDVELVIE"
     gene            254214..254693
                     /locus_tag="SFLA_RS00960"
                     /old_locus_tag="Sfla_0206"
                     /db_xref="GeneID:11369693"
     CDS             254214..254693
                     /locus_tag="SFLA_RS00960"
                     /old_locus_tag="Sfla_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_014152349.1"
                     /db_xref="GI:503918355"
                     /db_xref="GeneID:11369693"
                     /translation="MTPTPPPAPAPSEPADSELLKLDHQVCFSLQAASRAFGGVYREA
                     LRDLGLTYPQYLAMMVLWEHGSLPVKTIGERLHLDSGTLSPLLKRLESAGLVRRERSP
                     QDERSVTVHLTDAGSELRGRALSVPRTILRATGLSVQEILALQETLGRLTASLGKAG"
     gene            254803..255633
                     /locus_tag="SFLA_RS00965"
                     /old_locus_tag="Sfla_0207"
                     /db_xref="GeneID:11369694"
     CDS             254803..255633
                     /locus_tag="SFLA_RS00965"
                     /old_locus_tag="Sfla_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ser/Thr phosphatase"
                     /protein_id="WP_014152350.1"
                     /db_xref="GI:503918356"
                     /db_xref="GeneID:11369694"
                     /translation="MNRRRTPRSASAEDLLSTLQHLTARARQEVQLHQARVELAQALQ
                     RDMLPATLPSFPGLRTAARYAPARDGLDIGGDWYDGFLLPDGALGLAIGDVQGHDVEA
                     AAFMGQIRIAMRAIASSTSDPGEVMGRTNDLIMSMNSTLFATCSFLRLDPRSRELRSA
                     RAGHVASVWATADGHSGVTADAGGLPLGIEPHQHYPVARRDLDVTGSFVLLTDGVIEG
                     PSLTIDDGLDRIRRLVSSHATADAEDLADQVLKAAALTGHEDDAAVLVLRHDAAAGPA
                     "
     gene            255699..256694
                     /locus_tag="SFLA_RS00970"
                     /old_locus_tag="Sfla_0208"
                     /db_xref="GeneID:11369695"
     CDS             255699..256694
                     /locus_tag="SFLA_RS00970"
                     /old_locus_tag="Sfla_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_030125070.1"
                     /db_xref="GI:662753813"
                     /db_xref="GeneID:11369695"
                     /translation="MIRSEKTRRRAVLVLQILGITAVYYASAQLGLLRQVEVQGSVVT
                     PLWPPSGIALASLLYLGLRIWPAIAAGALLTIMSITDSLTLWGVAVAAGSTLAPVCSF
                     LALRAVGFRAQLDRLRDGVALVFLGALGGMVISATTGTGVQVLSGGQSASQFWPVWAA
                     WWAGDAMGVLMVTPLLLVLHKVRLPRMDDRWAEALALAVVAVTSAAIATRSPLSMIYL
                     LFPVLVWAALRFQLAGSAPCALLMSVMAIVAGTDGVGPFADHSVLEVMLNLCILNGCV
                     ALTALLLAAIVTEHNNIRHETELACEELAALVEQLSPGPSPEGGPDGPRHGWDGA"
     gene            complement(256691..257926)
                     /locus_tag="SFLA_RS00975"
                     /old_locus_tag="Sfla_0209"
                     /db_xref="GeneID:11369696"
     CDS             complement(256691..257926)
                     /locus_tag="SFLA_RS00975"
                     /old_locus_tag="Sfla_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="WP_030125069.1"
                     /db_xref="GI:662753811"
                     /db_xref="GeneID:11369696"
                     /translation="MAFGAKQLHTPASITELQELVSAGTAVRALGTGHSFNTVADTHG
                     ALISVAGLPRSVEIDTEARTATVSAGMRFGELTGTLHRSGLALHNLGSLPHISVAGAC
                     ATGTHGSGVGNRALAGAVRALELVTADGSVRTLERGDADFPGSVVSLGALGVVTRLTL
                     DLVPAFEIQQWVYEGLPQEELLGRFDEVMSEAYSVSLFTGWHGGPIDQVWLKRRVGPG
                     TPGTAPHRWHGSTLARGPRHPVPGVAAEHCTEQQGVPGPWHARLPHFRLEFTPSNGDE
                     LQSEYFVARQDAVAAYEALDRIRQDFAPLLQIGEIRTVAADDLWLSPAQGRDSVAFHF
                     TWVPDTAAVTPVLGAVEEALAPFAARPHWGKVFTTPPGVLRELYDHYADFERLTERFD
                     PTGTFRNDFLARHFPRTGG"
     gene            258339..258533
                     /locus_tag="SFLA_RS00980"
                     /old_locus_tag="Sfla_0210"
                     /db_xref="GeneID:11369697"
     CDS             258339..258533
                     /locus_tag="SFLA_RS00980"
                     /old_locus_tag="Sfla_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010062429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152353.1"
                     /db_xref="GI:503918359"
                     /db_xref="GeneID:11369697"
                     /translation="MSALDKIKKMLKGHEDQAGKGIDKAGDMVDDRTQGKYSKHVDTG
                     QDKLKQQLGSDRDRNDPPRA"
     gene            258742..260337
                     /locus_tag="SFLA_RS00985"
                     /old_locus_tag="Sfla_0211"
                     /db_xref="GeneID:11369698"
     CDS             258742..260337
                     /locus_tag="SFLA_RS00985"
                     /old_locus_tag="Sfla_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase"
                     /protein_id="WP_014152354.1"
                     /db_xref="GI:503918360"
                     /db_xref="GeneID:11369698"
                     /translation="MGETRETALIKAAQKGDPEAQDRLVASYLPLVYNIVGRALNGHA
                     DVDDVVQDSVLRMIRGLPSLRTPKSFRSWLVAITMNEIRGHWRERSTGGMSADPIQDA
                     YDVVDPAADFVELTIVRLGLTGQRREAAEATRWLDDDDRELVSLWWLETAGELSRAEV
                     ASALDLSPQHTAVRVQRMKERLEAARVVVRALAADPRCVLLEDLTVRWDGVPSALWRK
                     RLARHARECTVCAGHRSGLVPAEGLLVGLALVPVAASFAGTSEQLLPTAFLPATAAAA
                     GPGRAERRRDSARRRRRTTVVAGLAAVAVLGGGGAAVHLYTDDTDEDAATAVAPLDGP
                     PAPVSTASSPSAAPSSASPTPSSASPSPSAPPSPSASRSRSATATATPEKTRKPSTPS
                     SKPMAAPEASSAPSVADEVIALVNTERAKEGCGAVSGNGLLAKAASDHSADMVARDYF
                     SHTSPDGTDPGARITAAGYRWSTYGENIAKGQQTAESVMDAWMNSEGHRANILNCALK
                     ELGVGRVDSSGGPVWTQNFGTAL"
     gene            260568..262310
                     /locus_tag="SFLA_RS00990"
                     /old_locus_tag="Sfla_0212"
                     /db_xref="GeneID:11369699"
     CDS             260568..262310
                     /locus_tag="SFLA_RS00990"
                     /old_locus_tag="Sfla_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041825273.1"
                     /db_xref="GI:754214643"
                     /db_xref="GeneID:11369699"
                     /translation="MLRGALAAVPLLLSVLAERPTAGVPVALGAMLAGINDRPGSRRA
                     SVARLGLPALAGSAGLLCGSVVAETVGDGRSLVVVPLVFGLLGLGAGAISSTGPVASA
                     CGTQVLVAVVIGAGMPLPEPGPVRALLFLAGAGWLLLLRLVLPSPGGRRSGPYALDGE
                     REAVAAVYEAVAGLLLAAGSPGARAGRTALSATLDQAQDALSGPRLRRRAGSAAERRL
                     HARYAAALPLAEAATALAWAGVTLPVRFSEGPRRLAAAVRSGVPCGPLPAPAGTDAGL
                     RALDDALLRAAAVFDRPARVPPGERPGRPGTSVLRRAWSAAGLEYGLRVAVSCAASTV
                     LAQWLHHEHWYWLPATTVFLVKPDLGPLASRVVCRAVGTVAGAAVFGVLGVLSSGPSA
                     LVATVALCGALLPVATRHFALQTAVVTVLVLSLVLLGGEPAASWARVVESLLACGTVL
                     LTGHLPLPGRRGHGVRAALDTAVGAAHRYLGHVLDAPEDKALGGALRRDAYRSLAKAR
                     TAIDLSAAELPPVSRHSAGSEGVAGALEQLIDTTTACAVELGHRAAGLPAAHAEVLAA
                     HLSELDRARAVPVG"
     gene            262346..262723
                     /locus_tag="SFLA_RS00995"
                     /old_locus_tag="Sfla_0213"
                     /db_xref="GeneID:11369700"
     CDS             262346..262723
                     /locus_tag="SFLA_RS00995"
                     /old_locus_tag="Sfla_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_014152356.1"
                     /db_xref="GI:503918362"
                     /db_xref="GeneID:11369700"
                     /translation="MIAELECVVLDCADPAGLARFYAAVLGGETDRPDGRWARGEDWA
                     TIHTPAGQVFCFQRVPEYRPPLWPDPAHPQQFHLDFAVPDLDRAHEQVVALGATVLDE
                     GDGCRSWRVFADPAGHPFCLVRH"
     gene            complement(262773..263114)
                     /locus_tag="SFLA_RS01000"
                     /old_locus_tag="Sfla_0214"
                     /db_xref="GeneID:11369701"
     CDS             complement(262773..263114)
                     /locus_tag="SFLA_RS01000"
                     /old_locus_tag="Sfla_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152357.1"
                     /db_xref="GI:503918363"
                     /db_xref="GeneID:11369701"
                     /translation="MEPDKESARGLAQVEGYLLWNAEVEEARRQARSFTGSLPWLTTA
                     QREDVERVYVADRVELCRDTLTRIAGRAVELRGEYTERYERLRARCVALSVLTVAGMG
                     GACAFLALVSR"
     gene            complement(263150..264880)
                     /locus_tag="SFLA_RS01005"
                     /old_locus_tag="Sfla_0215"
                     /db_xref="GeneID:11369702"
     CDS             complement(263150..264880)
                     /locus_tag="SFLA_RS01005"
                     /old_locus_tag="Sfla_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit I"
                     /protein_id="WP_014152358.1"
                     /db_xref="GI:503918364"
                     /db_xref="GeneID:11369702"
                     /translation="MTTRGPAVSAEADDAYQDELPVRRRQPGNVVITWLTTTDHKTIG
                     TLYLGTSFAFFMLGGVLALVMRAELARPGTQIVSNEQYNQAFTMHGTIMLLMFATPLF
                     AGFANWIMPLQIGAPDVAFPRLNMFAYWLYLFGSLIAVAGFLTPQGAADFGWFAYSPL
                     TDAVRSPGVGGDLWIMGLAFSGFGTILGSVNFITTIICMRAPGMTMFRMPIFTWNVLL
                     TGVLVLLAFPVLAAALLALEADRKFGAQVFNASNGGALLWQHLFWFFGHPEVYIIALP
                     FFGIVSEIIPVFSRKPIFGYVGLVAATIAIAGLSVTVWAHHMYVTGGVLLPFFSFMTF
                     LIAVPTGVKFFNWIGTMWKGSLSFETPMLWSVGFLVTFLFGGLTGVILASPPLDFHVS
                     DSYFVVAHFHYVVFGTVVFAMFAGFHFWWPKFTGKMLDERLGKITFWTLFIGFHGTFL
                     VQHWLGAEGMPRRYADYLAADGFTGLNTVSSIASFLLGLSMLPFMYNVWKTAKYGKKI
                     EVDDPWGYGRSLEWATSCPPPRHNFLTLPRIRSESPAFDLHYPSIRALEDATNRPHES
                     VTVAPGDKQE"
     gene            complement(265091..265642)
                     /locus_tag="SFLA_RS01010"
                     /old_locus_tag="Sfla_0216"
                     /db_xref="GeneID:11369703"
     CDS             complement(265091..265642)
                     /locus_tag="SFLA_RS01010"
                     /old_locus_tag="Sfla_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="muramidase"
                     /protein_id="WP_014152359.1"
                     /db_xref="GI:503918365"
                     /db_xref="GeneID:11369703"
                     /translation="MLHGIDVSAYQTEFDTDGLDFVFVKATEGRSYVNPRLRSQVKRV
                     RDAECVVGFYHFLWPGHAKDQAEYFVERTPDKEGDLLAVDWERTGEGTRASSADKDRF
                     IREVKRLRPHRRVLLYCNRSFWVGHDTSSYVGDGLWIADYGKAAAPRIDADWRIHQYT
                     DDPLDKNVADFPSREALRAWAEA"
     gene            265830..266489
                     /locus_tag="SFLA_RS01015"
                     /old_locus_tag="Sfla_0217"
                     /db_xref="GeneID:11369704"
     CDS             265830..266489
                     /locus_tag="SFLA_RS01015"
                     /old_locus_tag="Sfla_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420-dependent NADP oxidoreductase"
                     /protein_id="WP_014152360.1"
                     /db_xref="GI:503918366"
                     /db_xref="GeneID:11369704"
                     /translation="MKIGIIGAGNIGGNLVRRLTALGHDVSVANSRGPETLKALAEET
                     GTTAVTASEAAKGARIVVVTVPLKAVPDLPSGLLDGAADDVAVIDTGNYYPQQRDGRI
                     PAIEDGLTESRWTEQQIGHAVVKAFNGTYAQDILDKGTPPGTPGRQALPVAGDDPEAK
                     QAVRDLIDELGFDTVDAGGIDESWRQQPGTPVYGNRGDAVTITKALADASPERTADWR
                     A"
     gene            266683..267231
                     /locus_tag="SFLA_RS01020"
                     /old_locus_tag="Sfla_0218"
                     /db_xref="GeneID:11369705"
     CDS             266683..267231
                     /locus_tag="SFLA_RS01020"
                     /old_locus_tag="Sfla_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase"
                     /protein_id="WP_014152361.1"
                     /db_xref="GI:503918367"
                     /db_xref="GeneID:11369705"
                     /translation="MPRTMSVSDSILIRMAPSAVYRELSDPTAMGRWSPENRGARVLG
                     EHRGAHVGMVFEGRNKRGSFRWTTKCTVTAADPGERFAFRVHAIGARRPLLPGAIALW
                     EYRFESVDGFTRVTETWTDNRRSWPDFVANAFDRVATRGHTFAEFQRRNIRTTLERLK
                     AVLEADGAEDVRVEGDPGVGGA"
     gene            complement(267341..268171)
                     /locus_tag="SFLA_RS01025"
                     /old_locus_tag="Sfla_0219"
                     /db_xref="GeneID:11369706"
     CDS             complement(267341..268171)
                     /locus_tag="SFLA_RS01025"
                     /old_locus_tag="Sfla_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="G-D-S-L family lipolytic protein"
                     /protein_id="WP_014152362.1"
                     /db_xref="GI:503918368"
                     /db_xref="GeneID:11369706"
                     /translation="MSRSAVNSTTTRRRFLLGAAGALTAGVAGTLCAPGSASATGRTP
                     TAAGTLYIASDSTAQTYSSGYYPQAGWGQKLSPYFTSAVTVANRAIGGRSSRSFIEQG
                     RLAAIHAVIRPGDYLFVQFGHNDATVGNAERYTPPADYKEYLRNDYIRATRALGATPV
                     VVTPVSRRSYDASTGKFNVSFPAYVDAAKAVAREENAPLVDLSAASRSYLDRTGVEAS
                     KGIFLWLDAGQYPSFPGGVQDNTHFQERGAAEMARLVSRSVAGLGLPLSGEVVPTAAR
                     "
     gene            complement(268282..269142)
                     /locus_tag="SFLA_RS01030"
                     /old_locus_tag="Sfla_0220"
                     /db_xref="GeneID:11369707"
     CDS             complement(268282..269142)
                     /locus_tag="SFLA_RS01030"
                     /old_locus_tag="Sfla_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152363.1"
                     /db_xref="GI:503918369"
                     /db_xref="GeneID:11369707"
                     /translation="MPDHDPTAPAVTAPADLRADCANCFGLCCVALTLTASADFAIDK
                     DAGIPCPNLADDFRCGIHARLRTEGFTGCTVYDCFGAGQKVSQETYGGRDWRSAPDTA
                     RQMFQVFPVMRQLHELLRYLTEALTLPAAERLYADLRDVLATTEHLTRLPAGELADLD
                     VSAHRDRVASLLLRAGELERATVRRRDTRSRRGADLIGASLKGADLRGAELRGAYLIA
                     ADLRGADLRRAELIGADFRDADLSDADLSGALFLTQAQVNAARGNAATKLPDSLTRPP
                     HWAADRPGTA"
     gene            269273..269752
                     /locus_tag="SFLA_RS01035"
                     /old_locus_tag="Sfla_0221"
                     /db_xref="GeneID:11369708"
     CDS             269273..269752
                     /locus_tag="SFLA_RS01035"
                     /old_locus_tag="Sfla_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152364.1"
                     /db_xref="GI:503918370"
                     /db_xref="GeneID:11369708"
                     /translation="MSASQERGFEPATGDGPENPADAEVRVAEVRTAFEGMLQIRRLT
                     RADLADPEGVPAPWELNRPLRAVALALEAAGIPASAVGTSGERVASGYRVCDGEAPGS
                     VRVEWVGPPGSGAAHDEEEALGRCVTVLRRLGWTALSYRGPRRRRFLEVEAPPSARS"
     gene            269816..270043
                     /locus_tag="SFLA_RS01040"
                     /old_locus_tag="Sfla_0222"
                     /db_xref="GeneID:11369709"
     CDS             269816..270043
                     /locus_tag="SFLA_RS01040"
                     /old_locus_tag="Sfla_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152365.1"
                     /db_xref="GI:503918371"
                     /db_xref="GeneID:11369709"
                     /translation="MHQAEITAAQAYIRLMAATRAALADPDVAPLYMSVLASPMEEAD
                     EALRSAGLTGNEDRFFALVRQLQPTLTGSDR"
     gene            complement(270107..270865)
                     /locus_tag="SFLA_RS01045"
                     /old_locus_tag="Sfla_0223"
                     /db_xref="GeneID:11369710"
     CDS             complement(270107..270865)
                     /locus_tag="SFLA_RS01045"
                     /old_locus_tag="Sfla_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_014152366.1"
                     /db_xref="GI:503918372"
                     /db_xref="GeneID:11369710"
                     /translation="MDAVFKALADPTRRRLLDELFRDDGQTLGALEARFAMTRFAVMK
                     HLKQLEAAGLVVTRRRGREKLHFLNPVPIRLVHDRWVSKYAEPWAAGLGDLKSRLENP
                     MEKVFEIYIRTTPERLWEAITDPEIRSKYNFGARVVSDWTEGSRFEMGAPGAAGPLGE
                     GKNLEVDPPHRLVQSMVALWSDDVRNEGATRITWEIEQVADSCRLTVTHDELRDGAHE
                     ELYGGWPMILSGLKTWLETGELLTTPGSLMYGDQ"
     gene            271079..272245
                     /locus_tag="SFLA_RS01050"
                     /old_locus_tag="Sfla_0224"
                     /db_xref="GeneID:11369711"
     CDS             271079..272245
                     /locus_tag="SFLA_RS01050"
                     /old_locus_tag="Sfla_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose isomerase"
                     /protein_id="WP_014152367.1"
                     /db_xref="GI:503918373"
                     /db_xref="GeneID:11369711"
                     /translation="MSDVSAVKAALKSQVIETPSWGYGNSGTRFKVFAQPGVPRNPFE
                     KLADAAQVHAHTGVAPKVSLHIPWDRVEDYTALTRYAEELGLRVGAINSNVFQDEDFK
                     LGSVTHPDPKVRRKATDHLLECVDIMDATGSPDLKLWFSDGTNYPGQDDIAGRQDRLA
                     EALAEVYERLGHDQRMLLEYKLFEPAFYTTDVPDWGTSYAHCLKLGPKAQVVVDTGHH
                     APGTNIEFIVAFLLREGKLGAFDFNSRFYADDDLMAGAADPFQLFRIMHEVVKNGGLK
                     SETGVNFMLDQCHNIEAKIPAVIRSVTNVQEATAKALLIDAEALAAAQLSGDVLAANG
                     VLMDAFNTDVRPLLAAVREELGLAPDPFAAYLASGNQERIAADRVGGEQAGWGA"
     gene            272315..274360
                     /locus_tag="SFLA_RS01055"
                     /old_locus_tag="Sfla_0225"
                     /db_xref="GeneID:11369712"
     CDS             272315..274360
                     /locus_tag="SFLA_RS01055"
                     /old_locus_tag="Sfla_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014152368.1"
                     /db_xref="GI:503918374"
                     /db_xref="GeneID:11369712"
                     /translation="MTSATHAEVAALLERAHRIGSDPRNTNYAGGNASAKATAADPVT
                     GGEAELLWVKGSGGDLGTLTEAGLAVLRLDRVRALKDVYPGVDREDEMVSAFDYCLHG
                     KGGAAPSIDTAMHALVEATHVDHLHPDSGIALACAADGEKLTAECFGDQVAWVGWRRP
                     GFQLGLDIAAVKERNPQAVGVILGGHGITAWGDTSEECERNALWMIRTAETFLEERGK
                     AEPFGAVLPGREALDREARLERAAALAPVIRGLASEDRPQVGHFTDAAPVLDFLARAE
                     HPRLAALGTSCPDHFLRTKVSPLVLDLPADAPLEEAVARLGVLHEEYREAYRSYYERH
                     AAPDSPAMRGADPAIVLVPGVGMFSFGKDKQTARVAGEFYLNAINVMRGAEAVSTYAP
                     IEESEKFRIEYWELEEAKLRRMPRPKALATRVALVTGAGSGIGRAIAHRLVGEGACVV
                     VADLNTETAAAVAEELGGPDKAVAVTVDVTSEEQIAEAFKAAAVAFGGVDLVVNNAGI
                     SISKPLLETSARDWDLQHDIMARGSFLVSREAARVMRAQRLGGDIVYITSKNAVFAGP
                     NNIAYSATKADQAHQVRLLAAELGEHGIRVNGVNPDGVVRGSGIFAAGWGAQRAATYG
                     IEEEKLGEFYAQRTILKREVLPEHVANAVFALTGGDLTHTTGLHIPVDAGVAAAFLR"
     gene            274443..275924
                     /locus_tag="SFLA_RS01060"
                     /old_locus_tag="Sfla_0226"
                     /db_xref="GeneID:11369713"
     CDS             274443..275924
                     /locus_tag="SFLA_RS01060"
                     /old_locus_tag="Sfla_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_014152369.1"
                     /db_xref="GI:503918375"
                     /db_xref="GeneID:11369713"
                     /translation="MPATSRHDAAFAAVDLGATSGRVITGRVGPDELVLTEAHRFATT
                     PVHLPDGLHWDVLALYQGMLDGLRVAARGGPVTSVGIDTWAVDYGLLDADGSLLGLPF
                     HYRDARNAAAAEAVLARCDAQELYGVGGLQHLPFNTVFQLEAHRSTAQWSAARTLLMM
                     PDLLVHWLTGTVGAEVTNASTTGLFDARTGEWSDALMGRLGLERSLFPALREPGAPAG
                     TLLPHVAEFTGLPADTPVTTVASHDTASAVAAVPATGPGFAYVSCGTWSLAGLELDTP
                     VLTEESRAANFTNERGVDGTVRFLRNIMGMWLLEECRRTWERDGVATDLESLFWDAAR
                     VRPFAAVIDPDDPVFLAPGDMPSRIDAALVRTGQQVPDGPGGYVRCVLESLALAHRRT
                     LRRAAGLAGRELTRVHLVGGGSRNELLCQWTADATGLPVTAGPAEATALGNVLLQARA
                     HGLVGGLTEMRGLVARTQELRHYAPRGDTAAWDRAEDRLTARA"
     gene            complement(276060..277118)
                     /locus_tag="SFLA_RS01065"
                     /old_locus_tag="Sfla_0227"
                     /db_xref="GeneID:11369714"
     CDS             complement(276060..277118)
                     /locus_tag="SFLA_RS01065"
                     /old_locus_tag="Sfla_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152370.1"
                     /note="catalyzes the formation of
                     3-hydroxy-2-methylpropanoate from
                     3-hydroxy-2-methylpropanoyl-CoA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /protein_id="WP_014152370.1"
                     /db_xref="GI:503918376"
                     /db_xref="GeneID:11369714"
                     /translation="MNDDEPVLLHTEGHILHLTLNRPRALNALTHTMVRGIDEALVRA
                     ADDDAVTAVVIDGAGGRGLCAGGDIRSIYEDARAGRSASVDFWRDEYRLNARIARFPK
                     PYVALMDGIVMGGGVGVSAHGDVRVVTERSRVAMPETAIGFVPDVGGTHLLAAAPGEL
                     GTHLALTGRTVGAADAVLCGLADHFVPSQHLADLVTELARSATPTEVQETVRRYATTA
                     PEGELAAQRTWIDECYAADTVEEIIDRLSNSGVTAAKETAAALLTASPTALKVTLAAV
                     RRAARLGSLEAVLDQEFRVSCRAFTGHDLTEGVRARIIDKDRTPRWSPAEIHEVTAAE
                     VARHFEPLGDRELGLFTS"
     gene            277298..279391
                     /locus_tag="SFLA_RS01070"
                     /old_locus_tag="Sfla_0228"
                     /db_xref="GeneID:11369715"
     CDS             277298..279391
                     /locus_tag="SFLA_RS01070"
                     /old_locus_tag="Sfla_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="WP_014152371.1"
                     /db_xref="GI:503918377"
                     /db_xref="GeneID:11369715"
                     /translation="MTDSSRRADGDALSRLPLERHRAGETGTVERLALNRTGSFEWDL
                     DARTVDVDDAGLMVFGLDPATFDASPSAVIDRLDAADRARLETTIDEAVAGGSNSYSV
                     HFQMPMEDGTHQWTHVQARILRSEDGRAHRVIGVVRDATAEVTHSAFVLDLEKRRRRQ
                     TSIVERTTTAMSRAVTVDDVTAALTGPGGLVGIGADGLALGLVENSALKIIALSGDSV
                     EVLAGLGAGRLDATLPLGDTILSGRPRFITSLGALVQRYPALEPHIGELKFRAVAYLP
                     LIAQARPLGGLALFYRERTAFSADERILCLGLAAIVAQSLQRAILFDEEREFATGLQS
                     AMLPRRIQEIEGGEIAVRYHSAWSGREVGGDWYDVVTLPRGRIGVAVGDVQGHDTHAA
                     AIMGQLRIALRAYAAEGHPPATVLARASRFLAELDTDRFATSTYAQVDLATGEVRVAR
                     AGHFGPLIRHTDGRVGVPQVRGGLPLGISSDFGDEEYPETRLDLVPGETLVLYTDGLV
                     EEPGADVDAGVAALIHEVSEGPDGAEALADHLSDRLWERWGSGDDVALLVLRRSPDLG
                     SPQAPRLHQYIHQADPQGLSEARAIVRQALTDWGLAGLADDAETVTGELLVNVLLHTE
                     GGAVLTLEVLPEPVRRIRLSVQDRSSVWPRRRTPGETSTSGRGLLLLDAVAERWGIEP
                     RGEGKAVWCEIGPDA"
     gene            complement(279557..280216)
                     /locus_tag="SFLA_RS01075"
                     /old_locus_tag="Sfla_0229"
                     /db_xref="GeneID:11369716"
     CDS             complement(279557..280216)
                     /locus_tag="SFLA_RS01075"
                     /old_locus_tag="Sfla_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152372.1"
                     /db_xref="GI:503918378"
                     /db_xref="GeneID:11369716"
                     /translation="MTIPRRSWRGAGAFAAAAVVGLAGGVISAAPAAAHTPTWAVTCS
                     EVTLNLTAYSSKATNEVTVSVVGGEDLLATTEFGREYHTKTPLQLPKHDKELQVRLVV
                     KAGDDDKYSFEQTKTAPVCEDDETPPQETPSETPSETPSETPSTEPSASETAEPSAEP
                     SETATEAAPAPAESSSSAPDLAETGSSSATPVIGGAALAVLLAGGGILWSVRKRRGVQ
                     H"
     gene            complement(280421..280909)
                     /locus_tag="SFLA_RS01080"
                     /old_locus_tag="Sfla_0230"
                     /db_xref="GeneID:11369717"
     CDS             complement(280421..280909)
                     /locus_tag="SFLA_RS01080"
                     /old_locus_tag="Sfla_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_014152373.1"
                     /db_xref="GI:503918379"
                     /db_xref="GeneID:11369717"
                     /translation="MLIREATEKDWPSIWPFFRTIVTAGETFTYPTDLEEDQAQGWWL
                     LEEPNRTVVAVDDTGAVLGTAKMNRNHMGNGSHISSASYMVAPEHSGRGVGRALCEHT
                     LDWAREAGYRAMQFNAVVETNTNAMKLYRSLGFEIIGTLPEGFRHPEHGYVGLHIMHK
                     SL"
     gene            complement(280950..281945)
                     /locus_tag="SFLA_RS01085"
                     /old_locus_tag="Sfla_0231"
                     /db_xref="GeneID:11369718"
     CDS             complement(280950..281945)
                     /locus_tag="SFLA_RS01085"
                     /old_locus_tag="Sfla_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152374.1"
                     /db_xref="GI:503918380"
                     /db_xref="GeneID:11369718"
                     /translation="MTVTGAGRALAARTGAPVSLGRAAQELALRRGDFDLAVQLGLIR
                     AELPAGGTRPRIRREEIDRLRALPGFPDSLREQVRTAGTAEGASLLGVGTSRFTGLAR
                     IGCISPVAFCLNRYRTVVWLYLVDELLAFAAREPHLIAGQSPVGMRTMLDSGTDRRAR
                     NWRSRRIDRLLNRTEDPWRRAALQATALDPVQLAEVVDDPYERAYLARMAPDPAFGRP
                     ASVSGREAMARLILADDPDEILWRRVNLTLELEQARETRSAPRPGYDPALRPLEAGSD
                     RSPREARARDFPVPDGRSSASRGPGRSSRGPAARRAACRGLLVRIGLRGHGRRAG"
     gene            complement(282054..282464)
                     /locus_tag="SFLA_RS01090"
                     /old_locus_tag="Sfla_0232"
                     /db_xref="GeneID:11369719"
     CDS             complement(282054..282464)
                     /locus_tag="SFLA_RS01090"
                     /old_locus_tag="Sfla_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynein regulation protein LC7"
                     /protein_id="WP_014152375.1"
                     /db_xref="GI:503918381"
                     /db_xref="GeneID:11369719"
                     /translation="MALDRGLDWLLDDLTSRVEHIQHALVLSNDGLVTGASTSLARED
                     AEHLAAVSSGLQSLARGSGRHFGAGRARQTMVEFDEALLFVTAAGDGSCLCVLTAAEA
                     DIGQVAYEMTLLVNRVGEHLGVTVRQGADSVDHL"
     gene            complement(282681..283301)
                     /locus_tag="SFLA_RS01095"
                     /old_locus_tag="Sfla_0233"
                     /db_xref="GeneID:11369720"
     CDS             complement(282681..283301)
                     /locus_tag="SFLA_RS01095"
                     /old_locus_tag="Sfla_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_033249781.1"
                     /db_xref="GI:702732602"
                     /db_xref="GeneID:11369720"
                     /translation="MHSTDGEEAGDSSSLALKILVAGGFGAGKTTLVGAVSEIRPLRT
                     EELLSEAGQLVDDTGGVDQKTTTTVAMDFGRITIRSGLSLYLFGTPGQDRFWFLWDEL
                     SQGALGAVVLADTRRLEDCFPAVDYFEHRRIPFVVAVNCFSGARTYAEEDVARALDLD
                     RGTPVVLCDARDRASGKDVLIRMVEYAGRMHTARLLESVGQGAGPE"
     gene            complement(283490..283876)
                     /locus_tag="SFLA_RS01100"
                     /old_locus_tag="Sfla_0234"
                     /db_xref="GeneID:11369721"
     CDS             complement(283490..283876)
                     /locus_tag="SFLA_RS01100"
                     /old_locus_tag="Sfla_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152377.1"
                     /db_xref="GI:503918383"
                     /db_xref="GeneID:11369721"
                     /translation="MPPGSQWYDAEAGPLVRPYAVTGGRTRSGPGGVRFDLIALVEAD
                     DAAADRRGASLLGPEHRALLSLCGQDARSVAELSADADLPVGVVRVLLGDLLEAGCVR
                     VSRPVPPARLPDEWVLREVIDGLRAL"
     gene            complement(284025..284459)
                     /locus_tag="SFLA_RS01105"
                     /old_locus_tag="Sfla_0235"
                     /db_xref="GeneID:11369722"
     CDS             complement(284025..284459)
                     /locus_tag="SFLA_RS01105"
                     /old_locus_tag="Sfla_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynein regulation protein LC7"
                     /protein_id="WP_030125055.1"
                     /db_xref="GI:662753791"
                     /db_xref="GeneID:11369722"
                     /translation="MVNERPGKASGHSGELDWLLDDLVARVAEIRHAVVLSDDGLTVG
                     ASCALSRQDAEHLAAVASGFNSLAKGTGRHFGAGSVRRTMVEMDDGFLFVVAAGHGSC
                     LTVLSTALTDIGLVAYEMARLVKRVGEHLVAPVRSAGPPATG"
     gene            complement(284459..287095)
                     /locus_tag="SFLA_RS01110"
                     /old_locus_tag="Sfla_0236"
                     /db_xref="GeneID:11369723"
     CDS             complement(284459..287095)
                     /locus_tag="SFLA_RS01110"
                     /old_locus_tag="Sfla_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014152379.1"
                     /db_xref="GI:503918385"
                     /db_xref="GeneID:11369723"
                     /translation="MRTPRTTTPGPGAPAGRPATPPRGRRAHAGRPADERPGPETGAS
                     AGRRPRHGSLRPRTVRAKIISLLMVPVVSLLALWGFATVTTAQDVARLREVRRLDTTV
                     RGPVTEAVRALQDERTAALRQLAAPGTGHAATLRERAGRTDAALKALSIGGGHTVADA
                     GLLPVGTAARLTAFLDEVKQVRTVRTRLLSPSRNGSGAPPATGTRGPDTAAGRPAGTE
                     TPSAYTQYGDAVTAALGVCGSLTGIQEAETGSRTRVLLELTRSGEMLAREESLLASAA
                     PKGTLDAEGLRAFAGAVAARRAFADTAGADLPGPGRQAWRELTGRDSYARLEAAEDTV
                     LALPAGRRAKAVPVASWERDAAAVRTELRAIETAAGQGSAGRTDPVARALLSPAAAAV
                     LLGFLAVAASLVISVRIGRGLVVELVGLRDSALDIARRKLPHAMRRLRAGEEIDVRAE
                     TPPGRMSHDEIGQVGEALDTVHRAALDAAVERAELADGISGVFVNLARRSQTLVHRQL
                     ALLDAMERRADDPEELGDLFRLDHLTTRMRRHAESLIILSGAAPGRAWRMPVSLTDVV
                     RAAVSEIEDYARVDVPALPDAAVQGGAVADLTHLLAELVENAAQFSPPHTRVRITGEP
                     VGNGYVLEIEDRGLGMGREVLDEANRRIEQAGALDLFDSDRLGLFVVSRLSARHSVKV
                     QLRTSAYGGTTAVVLLPTALLQGGLPRGSEARTAVGAAPEDVVGAGDGGPRTGHPGAA
                     ARTRIPGPPRPTARTAPIAVPAVGPGGRPAPREEGPVPARTSAPHRRPASTEDGELPR
                     RVRQASLVPQLRDGPGPQDSGQYPGRRAVPAAYTPEQARDRMSAYRAGWVRGGGAPPG
                     SPAEGRSVPVSLSRRHTEGDRS"
     gene            complement(<287346..288068)
                     /locus_tag="SFLA_RS01115"
                     /old_locus_tag="Sfla_0237"
                     /db_xref="GeneID:11369802"
     CDS             complement(<287346..288068)
                     /locus_tag="SFLA_RS01115"
                     /old_locus_tag="Sfla_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152380.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041825548.1"
                     /db_xref="GI:754215102"
                     /db_xref="GeneID:11369802"
                     /translation="MGHLDHAAFGWLTPVLSYAMAAIGAALGLRCTVRALGSRGRSRR
                     NWLITAASALGTGIWTMHFVAMLGFGVTGTDIRYDVPLTLLSLLVAMLVVGAGVFTVG
                     YGKDRPRALVVGGLTTGLGVASMHYLGMAALRLHGSVAYDPLLVTVSVGIAVVAATAA
                     LWAALNIRSAGAVAVASLVMGAAVSSMHYTGMLAVDVRVAPSTSALPGATVMQFIFPL
                     AVGLGSYLFLTSAFVALSPAARE"
     gene            288230..288829
                     /locus_tag="SFLA_RS01120"
                     /old_locus_tag="Sfla_0238"
                     /db_xref="GeneID:11369803"
     CDS             288230..288829
                     /locus_tag="SFLA_RS01120"
                     /old_locus_tag="Sfla_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014152381.1"
                     /db_xref="GI:503918387"
                     /db_xref="GeneID:11369803"
                     /translation="MADDHSHVQDFFAPRAAGWDTRFPDDGPAYAAAVRELGLRPGDT
                     AIDAGCGTGRALPALREAVGAGGTVIGVDLTREMLDAARRAGREASGALLLSDVARLP
                     LPSGVADAVLAAGLVSHLPHPGRGLVELARVVRPGGRLALFHPIGRAALAARHGRPLS
                     DDDLRAEPRLTPLLADAGWRLDAYTDEDSRFLALAVRTG"
     gene            complement(288864..289769)
                     /locus_tag="SFLA_RS01125"
                     /old_locus_tag="Sfla_0239"
                     /db_xref="GeneID:11369804"
     CDS             complement(288864..289769)
                     /locus_tag="SFLA_RS01125"
                     /old_locus_tag="Sfla_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_014152382.1"
                     /db_xref="GI:503918388"
                     /db_xref="GeneID:11369804"
                     /translation="MVQRYERLKEIQRLDPERDFLEIYRLTVTYEFPWDITRALELAL
                     YRTYAVPSIGRLLAETAELTERSQKRYDDTALLLDAVVEHGFDSERGRTAVRRINRMH
                     RSYDISNDDMRYVLCTFVVTPKRWIDAYGWRRLSGHELRAFAAYYRTLGAHMGIQDVP
                     QTYEDFERLLDAYEDEHFGWDRGARAVSDATLALMGSWYPRPLAPVVRRASLALLDDS
                     LLRAFRYARPGPLTRGLTRGSLRLRARAVRLLPPRQSPHYARQNPEIKGYPHGYELAR
                     LGTFPTPGVRGCPMPHGRPPEEPAG"
     gene            289982..290845
                     /locus_tag="SFLA_RS01130"
                     /old_locus_tag="Sfla_0240"
                     /db_xref="GeneID:11369805"
     CDS             289982..290845
                     /locus_tag="SFLA_RS01130"
                     /old_locus_tag="Sfla_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_033249780.1"
                     /db_xref="GI:702732598"
                     /db_xref="GeneID:11369805"
                     /translation="MVGTDETAADDALFVLTAVLLTPAQFPSVLGDDYVAACGALGLE
                     PYAEGYGLVLGQDSGGARWTVVVEDVSLVAVAIASWDCGMEYDLSPDDRSVVCALPGW
                     PLALAVAAPGVPEPHDPPPGPDGDDPAPLTPPDTDVWGPPQRRLGADEIALQWSAWRG
                     RIDDETAFGRSDEAATDAGERTDGGPAGEGPADSAGPARHPGVRMALEAAGAYIDSPP
                     PAGRIRSAFAPGGARTLRVDGPGWSLVARTDDIAFVLLDEEPGEIIPVGRGPELPKLL
                     KALDELAVRPS"
     gene            complement(290889..291395)
                     /locus_tag="SFLA_RS01135"
                     /old_locus_tag="Sfla_0241"
                     /db_xref="GeneID:11369806"
     CDS             complement(290889..291395)
                     /locus_tag="SFLA_RS01135"
                     /old_locus_tag="Sfla_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosysynthesis protein"
                     /protein_id="WP_014152384.1"
                     /db_xref="GI:503918390"
                     /db_xref="GeneID:11369806"
                     /translation="MYSFTKPSRDSVTLLAGLGVEGDVHAGVTVKHRSRVAQDPTQPN
                     LRQVHLIHQELFAELRQAGFEVSPGDLGENITTEGIDLLGLPVGTLLHLGDEAVVEVT
                     GLRNPCLQIDTFQAGLLKQVVGRADDGTVVRKAGIMSVVRTGGVVRPGDVIKAVLPVG
                     PHRRLERV"
     gene            complement(291428..291610)
                     /locus_tag="SFLA_RS01140"
                     /old_locus_tag="Sfla_0242"
                     /db_xref="GeneID:11369807"
     CDS             complement(291428..291610)
                     /locus_tag="SFLA_RS01140"
                     /old_locus_tag="Sfla_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015606463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152385.1"
                     /db_xref="GI:503918391"
                     /db_xref="GeneID:11369807"
                     /translation="MSNGAKIAIGGVVAAVVLIPFIGFWWSLLVLIGVPVVGYLMLDP
                     SQRRRLRRISRKEIGR"
     gene            complement(291705..292769)
                     /locus_tag="SFLA_RS01145"
                     /old_locus_tag="Sfla_0243"
                     /db_xref="GeneID:11369808"
     CDS             complement(291705..292769)
                     /locus_tag="SFLA_RS01145"
                     /old_locus_tag="Sfla_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_014152386.1"
                     /db_xref="GI:503918392"
                     /db_xref="GeneID:11369808"
                     /translation="MPQAVTATVAEHIRDGSDGPGSAQAPGSDFAPLLKAVRGQGLLE
                     RRTGWYAAGIAVNLVALGAVITGMFLLGDTWWNLLLALPLALLWTRTAFYGHDAGHAQ
                     ITAGRKAGRVVGLVHANLLLGMNEAWWNDKHVRHHANPNHVDKDPDVGVGALVWTQKQ
                     AAQREGFARWLTRNQARLFFPMLLLEGIALKIYGFQFLRRQPARERALSGLLLTGHLA
                     LYAALLLTVMSPGKALVFALVHHALFGLHLGMAFAPNHKGMEMPDPDGDRWGHLQRQV
                     LTSRNVRGAVLTDWLLGGLNYQIEHHLFPSMPRPHLRLAQPLVKAHCASIGMPYAETG
                     IVESYRQALRHMHEVGEPLR"
     gene            293028..295943
                     /locus_tag="SFLA_RS01150"
                     /old_locus_tag="Sfla_0244"
                     /db_xref="GeneID:11369809"
     CDS             293028..295943
                     /locus_tag="SFLA_RS01150"
                     /old_locus_tag="Sfla_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase SNF2"
                     /protein_id="WP_030638520.1"
                     /db_xref="GI:664100794"
                     /db_xref="GeneID:11369809"
                     /translation="MHRLPAETLDEISELSRCSAVFLPADPARTGLIAFWNADGSTPP
                     GHPGIRLHEGEGPPGTAGGRTDLTIVGSDVRPYVVPALLLPVSEALPVLTRARTGARS
                     SPSTAFWGAAGLLALQLVARGLLLPGLSPADHDAWRAGPLTADDIERIRVLAASMPPE
                     AHAVPLDAAAGPVMLPDPESLLRSFLDAVADGLPRTPAATAVTGTPAFAARGAQRLPR
                     LRTWAADVAAGHDAGVRLSLRVEVSGLAAAAGEGDAEGAPSFRAVLQIHSIQDPALVA
                     DAADVWADRSPAASSFGPRARMDALLALRRAARAWPPLTPLLSAAVPDAIEPADDEIA
                     ELLGPAARALAATGVQVHWPKELARKLTARAVISPQDDEDATAARTESDTPSFLSADA
                     LLAFDWWFALGDRKLSREELDRLAEAGRPLVRLRDQWVLIDPEDARRARESRDRKVTP
                     IDALGAVLTGSTEVDGRRVDVAATGWLEQLRARIAAPESGDLRAVGQPEALDAALRDY
                     QLRGLNWLHTMTSLGLGCCLADDMGLGKTITLIALHLHRRTIEAAAGPTLVVCPASLM
                     GNWQREVERFAPGTPVRRFHGGSRSLEGLADGEFVLTTYGTMRLDTARLAEVTWGMVV
                     ADEAQHVKNPHSATARQLRTIGARARVALTGTPVENNLSELWAILDWTTPGLLGRLGT
                     FRTRWASAVESGNDPAAAERLASLVRPFLLRRRKSDPGIAPELPPKTETDRAVSLTAE
                     QAGLYEAVVRETLDEISGADGFARRGLIVKLMTALKQICNHPAQYLKEEQPRIADRSG
                     KVELLDELLDTILSEGAGVLVFTQYVQMARLLERHLAARGVPTQFLHGGTPIAEREAM
                     VDRFQAGRVPVFLLSLKAAGTGLNLTRAEHVVHVDRWWNPAVEAQATDRAYRIGQTRP
                     VQVHRLITEGTIEDRIAAMLARKQGLADAVLGGGEAALTELSDAELAELVELRGGAR"
     gene            295940..297229
                     /locus_tag="SFLA_RS01155"
                     /old_locus_tag="Sfla_0245"
                     /db_xref="GeneID:11369810"
     CDS             295940..297229
                     /locus_tag="SFLA_RS01155"
                     /old_locus_tag="Sfla_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152388.1"
                     /db_xref="GI:503918394"
                     /db_xref="GeneID:11369810"
                     /translation="MNKGDEPERTFAALPPAQGRGFACSWWGRAWLKALEDTALDGQQ
                     LKRGRRLAREGRVGAVSVRPGRLTAVVQDHDATACRSDVLLQELSEEEWDRFLDMASE
                     RSGHIAALLDREMPPHLVEDAAAAGLHLLPGIGDLEPECGCGAWDHCPHSGALCYQVA
                     RLLDQDPFVLLLLRGRDERRLLDELQVRSAARAVRVPGAEAAEDQAGGPAPRGVRADE
                     AYAARDILPPLPSPPPLPTEPGLPPSLDTGTTPAAGVDASGLEYLAADSAVRAYAMLA
                     EAMAVGHERQPPAAGLTPEQDAVRLTADGRPDPRLTARLAAAAGRTPAGLDIAVRAWR
                     YGGTAALEVCDEEWRPGPAELARARAQLAAAWEDGEGPRLRGTDNRWTVIGSGAQLRY
                     GRDGRWWPFVKEHGRWTPAGPAEDDPAAALAGTPAGS"
     gene            297321..297902
                     /locus_tag="SFLA_RS01160"
                     /old_locus_tag="Sfla_0246"
                     /db_xref="GeneID:11369811"
     CDS             297321..297902
                     /locus_tag="SFLA_RS01160"
                     /old_locus_tag="Sfla_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_014152389.1"
                     /db_xref="GI:503918395"
                     /db_xref="GeneID:11369811"
                     /translation="MQRRRILQGAAVTAAAALLPASVRAVAAPTEGTDFPSAQWYPAS
                     TSNYTVSSRPSAYPVERVIIHVAQQTFTETIGIFQNPAKQVSAHYVVRSGDGFVGQCV
                     RERDIAWHAGNWDYNTRSIGIEHEGWVDQPSYFTHAMYERSARLTADICDRHGLTKDR
                     AHIIGHHEVPGSDHTDPGVNWDWVRYIRLVNLA"
     gene            complement(297911..299578)
                     /locus_tag="SFLA_RS01165"
                     /old_locus_tag="Sfla_0247"
                     /db_xref="GeneID:11369812"
     CDS             complement(297911..299578)
                     /locus_tag="SFLA_RS01165"
                     /old_locus_tag="Sfla_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014152390.1"
                     /db_xref="GI:503918396"
                     /db_xref="GeneID:11369812"
                     /translation="MTGSRAESAQVADSPERGHGKGIALLIIASCQLMVVLDITIVNI
                     ALPHIQSSLGFSTESLSWVINAYTLTFGGLLLLGGRLGDILGRRRVFVFGVLLFVLAS
                     LLGGLSQESWQLLAARALQGVGGAIASPTALSLITTTFREGPERNRAFGVFAAVSAGG
                     SAIGLLAGGVLVEWLDWRWVFFVNVPIGLLIAFATPRFIKESQRHPGHFDLLGALTST
                     LGMVLLVYGFIRASEDGWTDVLTIGAFAGAVVFMAVFLTVERRSRQPITPLHMFRDRN
                     RAGAYGMMLSLAAAMFGMFFFLTLFVQNILDFSPLRAGLAFLPVSVIIAISAGLASQL
                     LPRWGPKPFMVTGAILAAGGLAWLTQTDVNSTYLGSILGPILVFGSGMGMQFVSLTLM
                     AVSGVEPREAGAASGVLNATQQVGGSLGLSILVTVFGTASRNEAMDQIPRFLAEATPA
                     QQLRFRRTGELPAPWGDQVLASGVSTAFVVAAVIAGVAALIALFVIQVRSSDLERLRG
                     GGVPVPVDEPEDALDGAAGDRPGHGGTDGPRGPAVPPHNRGGSPPPG"
     gene            complement(299755..300429)
                     /locus_tag="SFLA_RS01170"
                     /old_locus_tag="Sfla_0248"
                     /db_xref="GeneID:11369813"
     CDS             complement(299755..300429)
                     /locus_tag="SFLA_RS01170"
                     /old_locus_tag="Sfla_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitin-binding protein"
                     /protein_id="WP_014152391.1"
                     /db_xref="GI:503918397"
                     /db_xref="GeneID:11369813"
                     /translation="MRKNCHERVSLVGWARRVGGVCVSVVLCLLPWTGTASAHGSVVD
                     PASRNYGCWLRWGDDFQNPAMEQEDPMCWQAWQADPNAMWNWNGLYRNGSGGDFPAAV
                     PDGQLCSGGRTESGRYDSLDSVGAWKTTDITDDFTVKLYDQASHGADYFQVYVTRQGF
                     DPAAEALTWSDLQLVAETGRYAPSQNYEIPVTTSGLSGRHVVYTIWQASHMDQTYFLC
                     SDVNFT"
     gene            complement(300816..301094)
                     /locus_tag="SFLA_RS01175"
                     /old_locus_tag="Sfla_0250"
                     /db_xref="GeneID:11369815"
     CDS             complement(300816..301094)
                     /locus_tag="SFLA_RS01175"
                     /old_locus_tag="Sfla_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152393.1"
                     /db_xref="GI:503918399"
                     /db_xref="GeneID:11369815"
                     /translation="MTGSRLDVDSGELGRDLVALVLTVVELLRQLMERQAIRRIDQGD
                     LTDGQVEEIGTTLMMLDQRMAELCEQHGVRPEDLNLDLGPLGSLLPRE"
     gene            complement(301091..301318)
                     /locus_tag="SFLA_RS01180"
                     /old_locus_tag="Sfla_0251"
                     /db_xref="GeneID:11369816"
     CDS             complement(301091..301318)
                     /locus_tag="SFLA_RS01180"
                     /old_locus_tag="Sfla_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152394.1"
                     /db_xref="GI:503918400"
                     /db_xref="GeneID:11369816"
                     /translation="MEREVVPWDNPEPLRGPVGVPLVDLLDRVLATGVVVSGDLVIAI
                     ADVPLVRLSLHALLSSVNERVPAPWADGGPL"
     gene            complement(301318..302130)
                     /locus_tag="SFLA_RS01185"
                     /old_locus_tag="Sfla_0252"
                     /db_xref="GeneID:11369817"
     CDS             complement(301318..302130)
                     /locus_tag="SFLA_RS01185"
                     /old_locus_tag="Sfla_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152395.1"
                     /db_xref="GI:503918401"
                     /db_xref="GeneID:11369817"
                     /translation="MTDRETEQVSAESVLYVFAVCRLPDPTAFAGLPGVAAGEALRRL
                     RFGELTAIVQTVRAADFTDEAWQARMADRGELERYARAHHDVVSAAAVSCPTVPLPMA
                     TLYHGEERAQQALLAETERFLAALRRTADHSEWGVKVYTAAPAVSVPARTRPATSPGS
                     SRPTPGAGLAYLERKRGAQAQRERRHEDSLRLAETVDAAFQGLAAAGRRLRLHVPETT
                     GTGHVQVLNATYLVAEHRAAELAPLTRALQESTGARIDVSGPWVPYSFVGEV"
     gene            complement(302150..302494)
                     /locus_tag="SFLA_RS01190"
                     /old_locus_tag="Sfla_0253"
                     /db_xref="GeneID:11369818"
     CDS             complement(302150..302494)
                     /locus_tag="SFLA_RS01190"
                     /old_locus_tag="Sfla_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152396.1"
                     /db_xref="GI:503918402"
                     /db_xref="GeneID:11369818"
                     /translation="MTDLDFGPEAYPIPGPPNSSLADILERVLDKGIVIAGDIKIDLL
                     DIELLTIRLRLFVASVDTAKKAGIDWWETDPALSSRAAQNSLLDENRALRERLDALEA
                     KTDEKEETSDHT"
     gene            complement(302491..303594)
                     /locus_tag="SFLA_RS01195"
                     /old_locus_tag="Sfla_0254"
                     /db_xref="GeneID:11369819"
     CDS             complement(302491..303594)
                     /locus_tag="SFLA_RS01195"
                     /old_locus_tag="Sfla_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_014152397.1"
                     /db_xref="GI:503918403"
                     /db_xref="GeneID:11369819"
                     /translation="MARTDKDEPEASESGIDRLRGEFTNFLGAQTDKLAQKAGDKLTG
                     LTGQLTDIADNGGSLPSVASRVMQGESPVKAFVSEKAGNVKDKVVDKAKEAFGGGKGK
                     SQSGGGKSMNIIEVLDVGVPLRDAYDHWTRYDKFGSFTKGVQSVSMDEEMSSDWKVKI
                     GPSSRGFKATVQEQVPDDRIVWTSEGAKGSTRGCVSFHELAPSLTRIVLVIEYYPSGF
                     FEKTGNLWRVQGRRMRLDFKHFQRFVTLTDEEPEGWRGEIRDGEVVVTHEEAMEKEEA
                     ESEEPDESDDSEDEEYEDEAGPEDDEDEEEEEEDYEDEDEEEPDEDTEEDYEDEEDEE
                     EEPEEEEEEEPEEEGEEEEEDAPRKRRGRRASR"
     gene            complement(303601..304533)
                     /locus_tag="SFLA_RS01200"
                     /old_locus_tag="Sfla_0255"
                     /db_xref="GeneID:11369820"
     CDS             complement(303601..304533)
                     /locus_tag="SFLA_RS01200"
                     /old_locus_tag="Sfla_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152398.1"
                     /db_xref="GI:503918404"
                     /db_xref="GeneID:11369820"
                     /translation="MEDQTKVTLAAAVVGGYVLGRTKKGRLALSIATYLAGRRFGLEP
                     RQIAAEGVRRLSEMPQFAELQDQLKGEVLESGRKALTAAADRGMNSLADALSDRTSRL
                     GAPEEEEEEEDEGEYEDENEPEYEDEEGDEDEEEDEEPEEPEEEYEEEEPEEEEPEEE
                     EGEEEPEEEEPEEEEPEEEEPRRTKSSDGAAGRGAGRKPAKKQPPAKKAPAKKAPAKK
                     AAAEKPAAKKSAPPKKTAAKKSAPAKKTAAKKAPAKKAASASRKAAAKKAAPAKKTAA
                     KKAPAKKSSARKTTSAKKTTSSKRTASKRGERRR"
     gene            complement(304541..304795)
                     /locus_tag="SFLA_RS01205"
                     /old_locus_tag="Sfla_0256"
                     /db_xref="GeneID:11369821"
     CDS             complement(304541..304795)
                     /locus_tag="SFLA_RS01205"
                     /old_locus_tag="Sfla_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152399.1"
                     /db_xref="GI:503918405"
                     /db_xref="GeneID:11369821"
                     /translation="MGLLSGLLLLPLAPVRGVIWVAEKAEEVADRELHDPSVIRAQLA
                     ELNQELEDGNVGLEEFEREEEELLDRLHAGTVRPSPNHRR"
     gene            complement(304797..305546)
                     /locus_tag="SFLA_RS01210"
                     /old_locus_tag="Sfla_0257"
                     /db_xref="GeneID:11369822"
     CDS             complement(304797..305546)
                     /locus_tag="SFLA_RS01210"
                     /old_locus_tag="Sfla_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152400.1"
                     /db_xref="GI:503918406"
                     /db_xref="GeneID:11369822"
                     /translation="MTGNGVYVYAIIPAGKALPAGAVGVGGPAAALRLVDEGRVTAVV
                     SAAPPQLRARRRDLMAHQEVLQRLTDTGPVLPMRFGTVAPDEESVRAQLAGSQAEHLA
                     TLSHLRGGVEFNLKALPAQDALAAVVAEEKNVRRLREAVRRRPGYEANVRLGEAVSAA
                     LSRRAAEAGRKILHELTPLARETAPGPEVHGCVLNVSFLVDRSRGDSFRTTVQRFADR
                     HRDHVELRVAGPLPCYSFVSSRPLRTPVAGG"
     gene            complement(305550..306002)
                     /locus_tag="SFLA_RS01215"
                     /old_locus_tag="Sfla_0258"
                     /db_xref="GeneID:11369823"
     CDS             complement(305550..306002)
                     /locus_tag="SFLA_RS01215"
                     /old_locus_tag="Sfla_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152401.1"
                     /db_xref="GI:503918407"
                     /db_xref="GeneID:11369823"
                     /translation="MTTTMYADEVAPCPPRAGTLYDVLELILDRGMVIDVFVRVSLVG
                     IEILKIDARIVVASVDTYLRFAEACNRLDLERDSGSTTIPELLGGRAAKSIGKRKVRQ
                     AAESVGDTVRKAVGSGDDDDEDDDRNERPKKRRAPARDGSSRRRRVEA"
     gene            complement(306034..306378)
                     /locus_tag="SFLA_RS01220"
                     /old_locus_tag="Sfla_0259"
                     /db_xref="GeneID:11369824"
     CDS             complement(306034..306378)
                     /locus_tag="SFLA_RS01220"
                     /old_locus_tag="Sfla_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein"
                     /protein_id="WP_014152402.1"
                     /db_xref="GI:503918408"
                     /db_xref="GeneID:11369824"
                     /translation="MAENRPARSGQTAKRAAKKTAKRAAPRSSARRGPEDAAHAACES
                     LERLICHAAEGVSAVRRKDDGWCVVVDVLEVPRIPDTTSLLASYEVQIDERGELMEYS
                     RVRRYRRGSADE"
     gene            306500..306934
                     /locus_tag="SFLA_RS01225"
                     /old_locus_tag="Sfla_0260"
                     /db_xref="GeneID:11369825"
     CDS             306500..306934
                     /locus_tag="SFLA_RS01225"
                     /old_locus_tag="Sfla_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152403.1"
                     /db_xref="GI:503918409"
                     /db_xref="GeneID:11369825"
                     /translation="MSESGEPDEEHVRPPGTGDTTVEALGALSEALEKVERARGQLYG
                     FHQLMGGADLTLDRAVELLRMGGHPEHADLVEREIVGRNVVPGCWTFQLVEAYDDTYY
                     RPFVEVEERVRQELVGGRRHLYEAQMKEVRRTRGHPQHTARP"
     gene            306937..307959
                     /locus_tag="SFLA_RS01230"
                     /old_locus_tag="Sfla_0261"
                     /db_xref="GeneID:11369826"
     CDS             306937..307959
                     /locus_tag="SFLA_RS01230"
                     /old_locus_tag="Sfla_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152404.1"
                     /db_xref="GI:503918410"
                     /db_xref="GeneID:11369826"
                     /translation="MDPADALRRIAFLLERSQAATYRVKAFRTAADAIGSMDGAEIAD
                     RVTRGSLESVRGIGPKTAKVIREAVEGATPSYLEALEEEASTPLTAGGESLLAALRGD
                     CHLHSDWSDGGSPIADMGRTAKELGHEWAVLTDHSPRLTVANGLSTERLLDQLAVVAE
                     LNERWAPFRLLTGIECDILDDGSLDQDPDVLERLDVVVVSVHSKLRMDATAMTARMLA
                     AVRNPHADILGHCTGRLLGGKKRPQSLFDAERVFAACAEAGTAVEINCRPERLDPPRG
                     LLRQAVASGALLSIDTDAHAPGQLDWQIYGCARAEECGVPVDRVVTSWTMERLLEWTG
                     GKAARS"
     gene            308048..309010
                     /locus_tag="SFLA_RS01235"
                     /old_locus_tag="Sfla_0262"
                     /db_xref="GeneID:11369827"
     CDS             308048..309010
                     /locus_tag="SFLA_RS01235"
                     /old_locus_tag="Sfla_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152405.1"
                     /db_xref="GI:503918411"
                     /db_xref="GeneID:11369827"
                     /translation="MTRHRTGPPLPRARGELSAGVIAFLRDDGALPDRGAARDADPYG
                     DDLQLALYVCYELHYRGFAGVRPELEWDPPLLTVRGALEDRFLTALRHDVPATDELDG
                     VLEGLLVEPIRGSGVSWFLQDRGELRHLREYAIQRSLYHLKEADPHAWVLPRLSGRAK
                     AGMAAIEYDEFGAGRADRVHAGLFAGLMSDLGLDTAYGRYLDQGCAPMLALVNVMSLF
                     GLHRRLRGALVGHFAAVEITSSPGSRRLAHAMKRNGAGPAAEFFYTEHVEADAVHEQV
                     VRRDVIGGLLDEEPAMATDIAFGITATSYLEERLGDRMLADWKV"
     gene            309063..309746
                     /locus_tag="SFLA_RS01240"
                     /old_locus_tag="Sfla_0263"
                     /db_xref="GeneID:11369828"
     CDS             309063..309746
                     /locus_tag="SFLA_RS01240"
                     /old_locus_tag="Sfla_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014152406.1"
                     /db_xref="GI:503918412"
                     /db_xref="GeneID:11369828"
                     /translation="MSADLAQAPRALPLMTLPGVYAPQHDTRLLMAALNREGISPGTE
                     VLDVGTGSGALALHAARLGARVTAVDIARRAVATARLNALLHRRRITVQRSDLLSALP
                     GRSYDLVICNPPYVPSPLDRIPGHGAARAWDAGCDGRAILDRMCETAPAALRPGGRLL
                     LVHSGLCDSDITVRRLSDAGLRARVSDRALVPLGPVLRSRLRWLRDTGLVGAGDTAEE
                     LVVIRAEQL"
     gene            309730..309957
                     /locus_tag="SFLA_RS01245"
                     /old_locus_tag="Sfla_0264"
                     /db_xref="GeneID:11369829"
     CDS             309730..309957
                     /locus_tag="SFLA_RS01245"
                     /old_locus_tag="Sfla_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_014152407.1"
                     /db_xref="GI:503918413"
                     /db_xref="GeneID:11369829"
                     /translation="MPNSSEHPCRITIGDDGPLLVEGPVEVTCADGTVAVSDRFVVAL
                     CMCRRSRMYPWCDTSHRRRTQPGEKSRRDTG"
     gene            complement(309964..311202)
                     /locus_tag="SFLA_RS01250"
                     /old_locus_tag="Sfla_0265"
                     /db_xref="GeneID:11369830"
     CDS             complement(309964..311202)
                     /locus_tag="SFLA_RS01250"
                     /old_locus_tag="Sfla_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041825274.1"
                     /db_xref="GI:754214644"
                     /db_xref="GeneID:11369830"
                     /translation="MPAVVTPEPVVKLVQRTTEPAAAQTLRSTAAAVIAFAVAQSVLP
                     EPHPAPLTAPLTALLVVQVTLYATLTTGIRRVNAVVVGVLIASGFSSLVGLSWWTLGL
                     TIFTSLLIGRVVRVNEFVPEVAISAMLVLGVAQVADTAWERVLETLVGAGVGLLFNLL
                     LAPPVWVESAGVSIGGLGERMGKMFRALGEEIGGNHPVREAAARLHEARRLDHDIVEV
                     DASLRQAEESLMLNPRVKEGLLNRVVLRTGLDTLEICAVVLRVLTRTLTDLAKARTEE
                     ALFPEDVATDLRELFGHMSDAIEGFALMITTPMAQSGEEAEERLAEALVRSRRTRDHV
                     ADLLLEDVQEHPRQWQLHGALLAEVDRILDELDIDKRTERLAEELDRRSAEAHDRHPR
                     LRAISRRLRGAAQARRREGG"
     gene            311331..311513
                     /locus_tag="SFLA_RS01255"
                     /old_locus_tag="Sfla_0266"
                     /db_xref="GeneID:11369831"
     CDS             311331..311513
                     /locus_tag="SFLA_RS01255"
                     /old_locus_tag="Sfla_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152409.1"
                     /db_xref="GI:503918415"
                     /db_xref="GeneID:11369831"
                     /translation="MAISLTPPGETPPAEGCISEAHVERPDGGIWEHPAFWAGLVLLG
                     SVVFAGFFIARIFGFA"
     gene            311510..312124
                     /locus_tag="SFLA_RS01260"
                     /old_locus_tag="Sfla_0267"
                     /db_xref="GeneID:11369832"
     CDS             311510..312124
                     /locus_tag="SFLA_RS01260"
                     /old_locus_tag="Sfla_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_014152410.1"
                     /db_xref="GI:503918416"
                     /db_xref="GeneID:11369832"
                     /translation="MSGRRTLDALLERHGTTYAAEAGIRLRDTPQPLYQLLVLSDLLS
                     ARIRAGIAVAAARALFSRGLRTPRRMADATWQERVDALGEGGYRRYDERTATQLGDGA
                     LLLLDAFGGDLRRLRREAGGDVHALRSGLRRFPGIGPTGADIFLREVQTVWPETAPYL
                     DKKALQGAERLGLPGTPAALTRLARDEDPAVLAAALVRGALDKG"
     gene            complement(312131..312880)
                     /locus_tag="SFLA_RS01265"
                     /old_locus_tag="Sfla_0268"
                     /db_xref="GeneID:11369833"
     CDS             complement(312131..312880)
                     /locus_tag="SFLA_RS01265"
                     /old_locus_tag="Sfla_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152411.1"
                     /db_xref="GI:503918417"
                     /db_xref="GeneID:11369833"
                     /translation="MSFPHPGRQSGAAHHEYCNNALCCRCQQRQWTTKLGDERLCGPC
                     AACCRDCGRAPAPHVDGLDDGLCAECRGRCGRCHSALPAEGPCPCRKWRERAAGDPVA
                     YILQALPQPLVQALGHRHPRTVHDLIHRELTRRTPDQLLERLERRWNVRWSHALHEKD
                     EDGRRRWAPQEIAEALVSPGNCGDPQCEDGYLLTTDTPCGRCLRPTHRFVTSVADRTA
                     TSDHARATAAQIRRALVEGRSTKPGKRRPTS"
     gene            complement(313038..313232)
                     /locus_tag="SFLA_RS01270"
                     /old_locus_tag="Sfla_0269"
                     /db_xref="GeneID:11369834"
     CDS             complement(313038..313232)
                     /locus_tag="SFLA_RS01270"
                     /old_locus_tag="Sfla_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152412.1"
                     /db_xref="GI:503918418"
                     /db_xref="GeneID:11369834"
                     /translation="MAISISVVLLLLVLAAIFLRNGGLKISHAIVCALLGFLLAGTSM
                     APTIHEGITATADVVSGLRP"
     gene            complement(313371..314261)
                     /locus_tag="SFLA_RS01275"
                     /old_locus_tag="Sfla_0270"
                     /db_xref="GeneID:11369835"
     CDS             complement(313371..314261)
                     /locus_tag="SFLA_RS01275"
                     /old_locus_tag="Sfla_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152413.1"
                     /db_xref="GI:503918419"
                     /db_xref="GeneID:11369835"
                     /translation="MAHLTRRRVVTTALATAAAGAFVPAQAAAAAPAGTVRPRGPHPL
                     ARAHAHNDYLHPRPLHDALAHGFTSVEADIFLVDGELLVAHEPGSLDPARTLVSLYLD
                     PLLARVRANHGSVHAGHRDPLQLLIDIKTEGAATYLALDQVLRRYRKILTRCDRGRVR
                     PGAVTPVISGDRAARAPMEAQTTRYAFYDGRPEDLGGAAHASFIPLISGNWTTNFGWP
                     GTGPFPAAERTRLRAFVSAAHANGQRVRFWATPDIAGPERDAVWNELLAADVDHLNTD
                     DLGGLESFLRRREDGGRRSV"
     gene            complement(314473..315594)
                     /locus_tag="SFLA_RS01280"
                     /old_locus_tag="Sfla_0271"
                     /db_xref="GeneID:11369836"
     CDS             complement(314473..315594)
                     /locus_tag="SFLA_RS01280"
                     /old_locus_tag="Sfla_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014152414.1"
                     /db_xref="GI:503918420"
                     /db_xref="GeneID:11369836"
                     /translation="MTVQTEAVQAPDLLYSEAEEDLRSAVRSLLADRADAPTVIAGIE
                     SDTPYDLRLWESLAAGIGAAGLLVPEKLGGQGATHREAAVVLEELGRSVAPAPYLTSA
                     VVATEILLALGADGGPAAGLLAELASGRKVAVLALPFSTPPADAGAAMTGTLERTVSG
                     VAEAAAADVLLVPTADGLYAVETAGDGVDVRALVPLDLTRPLATVTLAGATGTLLADA
                     APAAEAVSRGLLAGAGLLASEQLGLAEWCLTETVRHTRERHQFNRPVGSFQSLKHRMA
                     QLWLEVVSARAAARNAADALAAGSPDAPLAVAVAQAYCSEVAVHAAEECVQLHGGIGM
                     TWEHPAHLYLKRAKADSIAYGTAGRHREAVAALVELPAP"
     gene            complement(315591..316781)
                     /locus_tag="SFLA_RS01285"
                     /old_locus_tag="Sfla_0272"
                     /db_xref="GeneID:11369837"
     CDS             complement(315591..316781)
                     /locus_tag="SFLA_RS01285"
                     /old_locus_tag="Sfla_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014152415.1"
                     /db_xref="GI:503918421"
                     /db_xref="GeneID:11369837"
                     /translation="MSTAVDAAGIRRFTQQLLADRPPATTDRTDFLEARFDAGLAWVH
                     YPVGLGGLDAPRSLQPVVDAELAAAGAPDNDPRRIGIGLGMAAPTILGYGTEEQKRRF
                     LRPLWTGAEVWCQLFSEPGAGSDLAALGTRAVRDGDDWVVDGQKVWTSSAHLARWGIL
                     IARTDPDVPKHRGISYFICDMTDPGVEVRPLRQITGEAEFNEVFLTGVRIPDSRRLGP
                     VGDGWNVAQTTLMNERVSIGGARIPREGGMIGTVAKTWREQPGLRTHDLHQRLLTLWV
                     EAEVARLTGERLRQQLVAGQPGPEGSGMKLAFARLNQEISGLEVELLGDEGLLYSDWT
                     MRRPELVDFTGRDAGYRYLRSKGNSIEGGTSEVLLNIVAERVLGLPVEPRNDKDVAWK
                     DLAR"
     gene            complement(316778..317746)
                     /locus_tag="SFLA_RS01290"
                     /old_locus_tag="Sfla_0273"
                     /db_xref="GeneID:11369838"
     CDS             complement(316778..317746)
                     /locus_tag="SFLA_RS01290"
                     /old_locus_tag="Sfla_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014152416.1"
                     /db_xref="GI:503918422"
                     /db_xref="GeneID:11369838"
                     /translation="MQAWRVHRNGEPSEVMELEQADRPTPGEGQVLIAVRAANINFPD
                     ALLCRGQYQVRPPLPFTPGVEICGETADGRRVLATPALPHGGFAEYVVADEAALLPAP
                     EALDDAQAAALHIGYQTGWFGLHRRARLQAGETLLVHAAAGGVGSAAVQLGKAAGATV
                     IGVVGGPEKAAVARELGCDLVIDRHGEDIVAAVKEATGGRGADVVYDPVGGEAYAKSV
                     KCIAFEGRVVVVGFASGAIPTPGLNHALVKNYSIVGLHWGLYNTKDPAAVRACHDELT
                     ALAAKGVVKPLISERVPMADAARAVQRVADGTSTGRIVVLPSGGTR"
     gene            complement(317850..318449)
                     /locus_tag="SFLA_RS01295"
                     /old_locus_tag="Sfla_0274"
                     /db_xref="GeneID:11369839"
     CDS             complement(317850..318449)
                     /locus_tag="SFLA_RS01295"
                     /old_locus_tag="Sfla_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_030638502.1"
                     /db_xref="GI:664100776"
                     /db_xref="GeneID:11369839"
                     /translation="MKEQNQDDPGLDAVLTGVGPRLRRLRKDRGVTLAALSEATGISV
                     STLSRLESGGRRPSLELLLPIARAHEVPLDDLVGAPPVSDPRVRAKPIVHGSRTSLPL
                     TSRPGGLQAYKVVQKAPCTEVPEQRTHEGYEWLYVLSGRLRLKLAEHDLVLGPGEAAE
                     FDTRLPHWFGPVGDEPVEFLSLFGPQGERMHVRAKPKRS"
     gene            complement(318557..319279)
                     /locus_tag="SFLA_RS01300"
                     /old_locus_tag="Sfla_0275"
                     /db_xref="GeneID:11369840"
     CDS             complement(318557..319279)
                     /locus_tag="SFLA_RS01300"
                     /old_locus_tag="Sfla_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="WP_014152418.1"
                     /db_xref="GI:503918424"
                     /db_xref="GeneID:11369840"
                     /translation="MTRQLEPMPTDWRRALAVVAHPDDLEYGCAAAVAGWTDEGREVA
                     YLLVTRGEAGIDTIAPSACAPLREREQRASAEAVGVSSVEFLDHRDGVIEYGTALRRD
                     IAAAVRRHRPELLITLNHRDTWGAVAWNTPDHRAVGRATLDAAGDAGNRWIFSELGLE
                     PWDGVRWVAVAGTDRPTHAVDATPGFERSVRSLLAHRTYIEVLTDEDPEAYCRTFLAG
                     TTGAAAERFGGRPAVAFEVFPR"
     gene            319488..320060
                     /locus_tag="SFLA_RS01305"
                     /old_locus_tag="Sfla_0276"
                     /db_xref="GeneID:11369841"
     CDS             319488..320060
                     /locus_tag="SFLA_RS01305"
                     /old_locus_tag="Sfla_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014152419.1"
                     /db_xref="GI:503918425"
                     /db_xref="GeneID:11369841"
                     /translation="MISPASLSPFEAAARLEEFTVIDVRAPGEYASGHVPGALNIPLD
                     RLPEAVPALKSASARGSLLMVCASGVRSTRACEILADADIDAATLAGGTSAWEGDGNG
                     LERPAGARATWPMERQVRFAAGSLVVAGLVAGRRLPAARWLSAGIGAGLVYSAVTNTC
                     GMAAALARLPHNRAPHQAAGLDATLDALQG"
     gene            complement(320064..321365)
                     /locus_tag="SFLA_RS01310"
                     /old_locus_tag="Sfla_0277"
                     /db_xref="GeneID:11369842"
     CDS             complement(320064..321365)
                     /locus_tag="SFLA_RS01310"
                     /old_locus_tag="Sfla_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014152420.1"
                     /db_xref="GI:503918426"
                     /db_xref="GeneID:11369842"
                     /translation="MNSYRQPGIVLTDRRFTVPLDHDDPGGETIEIFGREAVAAGRPS
                     EGLPWLVYLEGGPGFGARRFVGAEAWLGRAVREFRVLLLDQRGTGLSTPANRQTLPKR
                     GGPREQADYLAHFRSDSIVRDCELIRPRLTGGAPWTVLGQSFGGFCAVHYLSAAPEGL
                     EAVLITGGLPSLDAHADEVYRAAYPRIERKVAAHYARYPQDVARARAVAAYLAEHRPD
                     SAGHTLTPEGFQSLGIMLGSGSGSHQLHYLLENAFVEGPHGAELSDTFQEAMRTSTSF
                     AGHPLYALMHEVIYGQGAMPTDWSAERVRAEFPQFDVNAALAGDGPVLFTGESIHPWH
                     FAVDPALRPLRETAELLAARTDWPVLYDAERLAANEVPVAAAVYHDDMYVDTGHALRT
                     ASAIRGLRTWVTSEYEHDGVRAGGPHVLDRLLALVRGEADR"
     gene            321569..322393
                     /locus_tag="SFLA_RS01315"
                     /old_locus_tag="Sfla_0278"
                     /db_xref="GeneID:11369843"
     CDS             321569..322393
                     /locus_tag="SFLA_RS01315"
                     /old_locus_tag="Sfla_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003964373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014152421.1"
                     /db_xref="GI:503918427"
                     /db_xref="GeneID:11369843"
                     /translation="MSTVPTVTLNNGVTIPQLGFGVFQVPDDETTAAVTAALEAGYRS
                     IDTAAVYGNETGVGRALAESGLGREELFVTTKLWNADQGYDATLTAFDASLAKLGLDH
                     VDLYLIHWPTPARDLYTDTWRALEKLLAEGRIRAAGVSNFQPAHLRRLREESSLVPAV
                     NQIELHPGLQQRELRSLHAGSGIATEAWSPLAQGALLDDEVLTSLAGRHGRSPAQVVL
                     RWHLQLGNVVIPKSVTPARIRQNIDVFDFELSADDMEAIAGLDRGMRTGPDPDTLN"
     gene            complement(322479..322754)
                     /locus_tag="SFLA_RS01320"
                     /old_locus_tag="Sfla_0279"
                     /db_xref="GeneID:11369844"
     CDS             complement(322479..322754)
                     /locus_tag="SFLA_RS01320"
                     /old_locus_tag="Sfla_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014050108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152422.1"
                     /db_xref="GI:503918428"
                     /db_xref="GeneID:11369844"
                     /translation="MSDSELRGSRQVAALFSGGRLTAIPRKPARREQLLTHLAQTLFE
                     RDRVYTEREVNDALLTVHDDCSALRRYLVVAGLLERPRDGSSYRRGR"
     gene            322885..323859
                     /locus_tag="SFLA_RS01325"
                     /old_locus_tag="Sfla_0280"
                     /db_xref="GeneID:11369845"
     CDS             322885..323859
                     /locus_tag="SFLA_RS01325"
                     /old_locus_tag="Sfla_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl xylan esterase"
                     /protein_id="WP_014152423.1"
                     /db_xref="GI:503918429"
                     /db_xref="GeneID:11369845"
                     /translation="MALFDLPLDELHAYRSRSVEPEDFDAFWSATLDEARTHDLDARF
                     ELCADLGLTTVDVYDVTFAGFGGHPVKGWFVIPAGTTEPLPVLVEFIGYGGGRSLPHA
                     HLLWASAGMAHFVMDTRGQGSGWAPGDTADPVGSGPSLAGFMTQGIEDPATYYFRRVI
                     TDAVRAVEAARSHPLADASRTAAIGASQGGGLALAVGGLVTDLAALAPDVPFLCDFPR
                     ATRVTDRKPYREIIDYLKTHRGRAEKAFRTLSYFDGVHFAARGSAPALFSVALEDQTC
                     PPSSVFAAYNAYAHADKEIEVYEYNDHEGGGPFQHAAQLTRLPRLLKA"
     gene            323967..325130
                     /locus_tag="SFLA_RS01330"
                     /old_locus_tag="Sfla_0281"
                     /db_xref="GeneID:11369846"
     CDS             323967..325130
                     /locus_tag="SFLA_RS01330"
                     /old_locus_tag="Sfla_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041825275.1"
                     /db_xref="GI:754214645"
                     /db_xref="GeneID:11369846"
                     /translation="MFVTTSNPSRRKPVRVAIVGTGAIARGSHLPALTALAAGQPLEI
                     IAAVDVDAASVEAFCAEAGIAHAYTDLDRMLAEQRPDLVTLATPPRFHRDQTVAALRA
                     GAWVWCEKPPCPSLEDFDAIEAAEGPSGQGPYAAIVFQHRFGSGARHVRALLAGHAMG
                     RPLVAHCQTTWYRDEAYYAVPWRGTWSSEGGGPSMGHGIHQMDLLLDLLGPWAEIRAM
                     AGRLVHDVETEDVSTALIRFENGAMATVVNSVLSPDEVSRIRIDCERATVELTHLYGH
                     RNTDWRITPAPGVTSEEADAWRDFGADVPSSHEAQLTGLLGDLRAGRRPRSSGPDGRK
                     SLELVAALYKAAFTGSTVRAGEIGPGDPFYGALHGDVPDWAPRNVDRAEGVVA"
     gene            325127..326056
                     /locus_tag="SFLA_RS01335"
                     /old_locus_tag="Sfla_0282"
                     /db_xref="GeneID:11369847"
     CDS             325127..326056
                     /locus_tag="SFLA_RS01335"
                     /old_locus_tag="Sfla_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152425.1"
                     /db_xref="GI:503918431"
                     /db_xref="GeneID:11369847"
                     /translation="MTRTAELVHRHGDHLSVTAAGSGVELLRYVYRAEDAWEAPKPYI
                     HPLRTLSGRVVTGYRPNDHRWHKGLQMTASHLSGANLWGGNSYVDGEGYLALPERVGS
                     MAHAGFDDVSVHDGGVRFTERLTWHPHDGGLWAQETRRVEVHDVDEVTGSWALTWSSE
                     ITNRRDEPLRFGSPTTHGRPNAGYTGLFWRGPRAFRDGRIISPEAEGPDLMGQQAPWL
                     AYSGEHDESDGHATLVFVHSPGNDHTGAGGAHPAHWFVRNTPFAAVAPSFAFHEELVL
                     DPGATLARRYRVLVADGAWDRDRIASAVGRLSW"
     gene            complement(326182..326625)
                     /locus_tag="SFLA_RS01340"
                     /old_locus_tag="Sfla_0283"
                     /db_xref="GeneID:11369848"
     CDS             complement(326182..326625)
                     /locus_tag="SFLA_RS01340"
                     /old_locus_tag="Sfla_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="WP_014152426.1"
                     /db_xref="GI:503918432"
                     /db_xref="GeneID:11369848"
                     /translation="MPMEGEYEPSPTTWVREQVELIESSGGTQGTTMRGMPVILLTTR
                     GAKSGKLRKTPLMRVEHDGQYAVVASLGGAPKHPVWYYNVLADPEVELRDGTVRQDMT
                     AREITGEEKALWWSRAVEAFPDYAEYQTKTDREIPVFVLSPSGER"
     gene            326959..328320
                     /locus_tag="SFLA_RS01345"
                     /old_locus_tag="Sfla_0284"
                     /db_xref="GeneID:11369849"
     CDS             326959..328320
                     /locus_tag="SFLA_RS01345"
                     /old_locus_tag="Sfla_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_014152427.1"
                     /db_xref="GI:503918433"
                     /db_xref="GeneID:11369849"
                     /translation="MTRPVRVAIVGAGPAGIYAADALLKSEAAQEPGVSIDLFERMPA
                     PFGLIRYGVAPDHPRIKGIVKALHQVLDKPQLRLFGNVDYPNDIGLDDLRSFYDAVIF
                     STGADADRALDIPGIELDGSYGAAEFVAWYDGHPEVPRTWPLEAEKVAVLGVGNVALD
                     VARILAKTADELLPTEIPANVYDGLKANKALEVHVFGRRGPAQAKFSPMELRELDHSP
                     NIEVIVNPEDIDYDEGSIATRRENKQANMVASTLENWAIRDVGDRPHKLFLHFFESPV
                     EVVGEDGRVVALRTERTELDGTGNVKGTGRHTDWDVQSVYRAVGYYSEELPKLPFDVV
                     SGTVPHAAGRVLTGDEPMPSVYVTGWIKRGPIGLIGHTKGDANETVACLLEDHAAGRL
                     PAPAQPDTDAVVDFLEQRGVRYTTKEGWHRLDAHEQALGAEQGRERVKVVERAAMLDA
                     SGA"
     gene            328496..328870
                     /locus_tag="SFLA_RS01350"
                     /old_locus_tag="Sfla_0285"
                     /db_xref="GeneID:11369850"
     CDS             328496..328870
                     /locus_tag="SFLA_RS01350"
                     /old_locus_tag="Sfla_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_014152428.1"
                     /db_xref="GI:503918434"
                     /db_xref="GeneID:11369850"
                     /translation="MEPGDSTKQARAAAQLRKGVLEYCVLALMRDRPRYGVELLQALE
                     DSGALATSQGTVYPLLSRLRRDDLVTTTWQESASGPPRRYYALTDSGRAALDEFTRVW
                     PGFRDAVDTFLSPPPPSTGDHA"
     gene            328867..329460
                     /locus_tag="SFLA_RS01355"
                     /old_locus_tag="Sfla_0286"
                     /db_xref="GeneID:11369851"
     CDS             328867..329460
                     /locus_tag="SFLA_RS01355"
                     /old_locus_tag="Sfla_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152429.1"
                     /db_xref="GI:503918435"
                     /db_xref="GeneID:11369851"
                     /translation="MKTPADPVRDYLRAVEREASALPADRRQELVADLAEHVEVTRAE
                     RPDATPGEILAELGDPRTIAATALAEAGRAPGIPAEGGAGDPARRGKVHPLVPLLMLT
                     LSLPFVMVFSDSPGPLFGLLFRIAGVVLLCTSVHWTTVRKTTGVLLAGVVPTVVIASW
                     NLSSGGPAGDTPALVGNLGMLALLTGTAVWLWRSRRA"
     gene            complement(329544..330437)
                     /locus_tag="SFLA_RS01360"
                     /old_locus_tag="Sfla_0287"
                     /db_xref="GeneID:11369852"
     CDS             complement(329544..330437)
                     /locus_tag="SFLA_RS01360"
                     /old_locus_tag="Sfla_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152430.1"
                     /db_xref="GI:503918436"
                     /db_xref="GeneID:11369852"
                     /translation="MPSPDRADRGRQNPEDGREVAVPPDRGPGESRSDVFLDVPALHV
                     DELNLEVDDLEAHVSLQAEVLDLLKLNVGADVRLGRVELDIEGVDVQAQLRVRLHNIA
                     AIVTRLLSTVDRNPQILEQLTRGVGEAVENVGAGAGTAVERLGEGTSTAVSDVGRGAG
                     EAVESVAADAGTAVKGIGEGAGEAVEDVGRSGARAVEGADDAVGEITGDVVGSTRDDE
                     GPGAAKKTESGRKPRARGAPASKDDASAKKSRAKKAPARKAAADAGAAAKPAAKKAAG
                     VARRSGGKVTGGAAGRRRRPA"
     gene            330610..331230
                     /locus_tag="SFLA_RS01365"
                     /old_locus_tag="Sfla_0288"
                     /db_xref="GeneID:11369853"
     CDS             330610..331230
                     /locus_tag="SFLA_RS01365"
                     /old_locus_tag="Sfla_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014689553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="WP_014152431.1"
                     /db_xref="GI:503918437"
                     /db_xref="GeneID:11369853"
                     /translation="MAKYFDVHPENPQRRTITNVAESIRSGALVAYPTDSCYALGCQL
                     GSRDGIDRIRSIRNLDDRHHFTLVCQNFAQLGQFVQVDNDVFRAIKAATPGSYTFILP
                     ATKEVPRQLLHPKKKTVGVRIPDHVVTQALLTELGEPLLSSTLLLPDEEEPLTQGWEI
                     KERLEHVVDVVLDSGDCGTEPTTVIDFSGGELEVVRRGAGDVSRFE"
     gene            331342..331533
                     /locus_tag="SFLA_RS01370"
                     /db_xref="GeneID:23391305"
     CDS             331342..331533
                     /locus_tag="SFLA_RS01370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015580076.1"
                     /db_xref="GI:505392974"
                     /db_xref="GeneID:23391305"
                     /translation="MSESEDVRARLRRMRGQAEDLEKAAEQASDPSERRRLQDEAHRL
                     ESQSVQVSGMASGDIYPME"
     gene            331722..332108
                     /locus_tag="SFLA_RS01375"
                     /old_locus_tag="Sfla_0290"
                     /db_xref="GeneID:11369855"
     CDS             331722..332108
                     /locus_tag="SFLA_RS01375"
                     /old_locus_tag="Sfla_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152433.1"
                     /db_xref="GI:503918439"
                     /db_xref="GeneID:11369855"
                     /translation="MRWRPFLEAVQERGDYPSVAEAERASRVVLALLGAHLVGEERNE
                     LAARLPETFALILLNPLQAAEPLSSERFVRAVSAWIEGATERTAAWDTGAVLSVVADA
                     SGEELLERLLLQLPPGYDLLFGHPGG"
     gene            complement(332111..333110)
                     /locus_tag="SFLA_RS01380"
                     /note="methylene-tetrahydromethanopterin reductase;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391306"
     gene            complement(333195..333581)
                     /locus_tag="SFLA_RS01385"
                     /old_locus_tag="Sfla_0292"
                     /db_xref="GeneID:11369857"
     CDS             complement(333195..333581)
                     /locus_tag="SFLA_RS01385"
                     /old_locus_tag="Sfla_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030125024.1"
                     /db_xref="GI:662753749"
                     /db_xref="GeneID:11369857"
                     /translation="MGHGRDEQTSATTRERLDAVGAAGVAATLQALATPSRLRILARL
                     QEGPCAVGDLAEAVEMEPSACSHQLRLLRNLGLVAGERQGRSIVYALYDHHVAELLDQ
                     ALYHVEHLRLGLRDAPAEIAATATGH"
     gene            333679..335694
                     /locus_tag="SFLA_RS01390"
                     /old_locus_tag="Sfla_0293"
                     /db_xref="GeneID:11369858"
     CDS             333679..335694
                     /locus_tag="SFLA_RS01390"
                     /old_locus_tag="Sfla_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-transporting ATPase"
                     /protein_id="WP_014152435.1"
                     /db_xref="GI:503918441"
                     /db_xref="GeneID:11369858"
                     /translation="MPAAVIPPPTRLASPGRGEAPRRRTRVLALAEARWAAAALALFL
                     LALPLHLTGAPGWAWGPLYALVYVAGGWEPALSGLRELREKVLDVDLLMIVAALGAAS
                     IGQVMDGALLIVIFATSGALEALATARTQDAVRGLLDLAPATASRLTADGSEESVATG
                     ELTVGDVIRIRPGERVGADGRVLDGASEVDQATITGEPLPTAKEPGDEVFAGTLNGTG
                     TLRVAVERDASESVIARIVAMTEEAARTKAPTQLFIEKVEQRYSLGMVVATLAVFLVP
                     LAFGDDVTGSLLRAMTFMIVASPCAVVLATMPPLLSAMANAGRHGVLVKSAVVMERLG
                     QADAVALDKTGTLTEGTPRVTRVHPLAGSGLTGDALLALAAAAEHPSEHPLARAVVKA
                     AQERGLRLSPVSEFDSAPGTGVTATVDGRVISVGSPVRLLRDVAASASADATASAAVL
                     EEAGSTAVLVLRDGEPVGVLGVADRMRHDAAATVAAMAGLTDVPPMLLTGDHARAAAR
                     LAAEAGITDVRAGLLPQDKAAAVREQEQAGRRVLVVGDGVNDAPALAAAHVGVAMGRA
                     GSDLAVEAADAVVIRDELAAVPTVVALSRATRRLVVQNLVVAGVFISVLVVWDLVGHL
                     PLPLGVLGHEGSTVIVGLNGLRLLRETAWRRAAEQGRGVKSVRRRRD"
     gene            complement(335666..336880)
                     /locus_tag="SFLA_RS01395"
                     /old_locus_tag="Sfla_0294"
                     /db_xref="GeneID:11369859"
     CDS             complement(335666..336880)
                     /locus_tag="SFLA_RS01395"
                     /old_locus_tag="Sfla_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014152436.1"
                     /db_xref="GI:503918442"
                     /db_xref="GeneID:11369859"
                     /translation="MRRNSSIVLLSLGHACVDVHQGAAAALVPFFAAERAYTYAVASG
                     VVLAASLLSSVVQPVFGALTDRWPMPWLLPAATLLSGAGIGVSGLSGSYALTLVCVAV
                     SGLGVAAYHPESARVARIAARGSHRAMGWFSTGGNIGFALAPLMVGTVVGAGGLHRTP
                     LLALPALAGAAMCLPVVHALRRERAGGSHTAPPTGNDDVPSFLKLSLAVVFRSIAFVG
                     LSTFISLYARQRLGGSAAAGTAALSVFYLGGAVGSVLGGSLASRWDRVRVSRCSYVLT
                     AVAVTGVVWVPGPAIHVFVALASVGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTVS
                     IGGLAAPALGALADATSLRTALAPLALMPLLSWLLFRALPEPAAPKASAPPPAAGDGG
                     GAAVSPAAGERS"
     gene            336935..337678
                     /locus_tag="SFLA_RS01400"
                     /old_locus_tag="Sfla_0295"
                     /db_xref="GeneID:11369860"
     CDS             336935..337678
                     /locus_tag="SFLA_RS01400"
                     /old_locus_tag="Sfla_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_038273008.1"
                     /db_xref="GI:740441057"
                     /db_xref="GeneID:11369860"
                     /translation="MTEIRHDPVAPTRTQWLASGAAIDAHRHDDHQIVYAGRGVLSVT
                     TSEGSWVAPGTRAIWVPAGTVHAHRAYGELDLHLVGLAATENPLGLGAPTVLAVGPLL
                     RELIIAYTRTEDDAGPERARLRAVLLDQLRASPQQPLHLPTPATPLLRAVYDILIADP
                     GDSRTLSELGREVGASDRTLSRLFRSDLGMTFPQWRTQLRLHHALILLTGRTPVTTVA
                     HRCGWSSASAFIDAFRRAFGHTPGCRPAE"
     gene            complement(337731..338621)
                     /locus_tag="SFLA_RS01405"
                     /old_locus_tag="Sfla_0296"
                     /db_xref="GeneID:11369861"
     CDS             complement(337731..338621)
                     /locus_tag="SFLA_RS01405"
                     /old_locus_tag="Sfla_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152438.1"
                     /db_xref="GI:503918444"
                     /db_xref="GeneID:11369861"
                     /translation="MAGRALSLPSSRRRAVAGAAAFLASVLGAGLLAGCAGDAAASGG
                     DEPTRATRTADVLLPTPGAGFDYQIGGGYTPPEGVRALSRDREDDPAPGRYNVCYVNA
                     FQTQPGALKWWQDTHPDLLLRDGDGEMIIDEGWDEVLLDTSTAARRTQLEKIVGEWID
                     GCAESGFQAVEPDNLDSFERSKGRLTQDHNAAFAQALAERAHGDGLAIGQKNTTDLLD
                     RHEEIGFDFAVAEECAQFDECDAYADAYDGRVFVIEYEGEGEVGFDESCDRWGDRISL
                     VLRDLDVLPAGEKGYVFRTC"
     gene            complement(338711..339634)
                     /locus_tag="SFLA_RS01410"
                     /old_locus_tag="Sfla_0297"
                     /db_xref="GeneID:11369862"
     CDS             complement(338711..339634)
                     /locus_tag="SFLA_RS01410"
                     /old_locus_tag="Sfla_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_014152439.1"
                     /db_xref="GI:503918445"
                     /db_xref="GeneID:11369862"
                     /translation="MHQQTDVLVVGGAGVDTVVHVPELPLPHADSYMIRPGIETRAGQ
                     SGDFVALGLHALGLRTHHLDMIGDDHEGDLVRALHRDRGIPLTEAHQASGTKRAVNLV
                     APDGRRLSLYDASRGDDAGRFDETAVRRLAAATRHAHVVITQPCALTLPVLREAGVTI
                     STDLHDWDGVDGYHETFALQADIVFLSTTALTDPERTMRDIAGRGRARIVVATAGADG
                     SYLLHDDELTHTPAATPPAPVVDSNGAGDAFASGFLLGVLSGEHPLRCALHGTVAGAY
                     ACTVPSTGTAAIGREELLARVAELEKERAAG"
     gene            complement(339876..340634)
                     /locus_tag="SFLA_RS01415"
                     /old_locus_tag="Sfla_0298"
                     /db_xref="GeneID:11369863"
     CDS             complement(339876..340634)
                     /locus_tag="SFLA_RS01415"
                     /old_locus_tag="Sfla_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_014152440.1"
                     /db_xref="GI:503918446"
                     /db_xref="GeneID:11369863"
                     /translation="MADPKNYIIESLDTGLRLMRLFLTHDTLSVTDAARELDVARSTA
                     HRVLSTLESRGFATRDASGRGYSAGPELVTLGRPAGYGPEIRTRLQIVLDAAAAATGE
                     TVSTAALIGDQVIITDGRESAHPVRAVLETGRAHPAHATSAGKVLLAQLTTEQVCALY
                     PEERLPDVSGTTPTSRSDLLSSLAAVRTLGRADSTGESVRGMNTVAVPLAGTSWRDRL
                     ALMASMPADRGDESRRGRHALALQAAAGLLPPPS"
     gene            340995..342092
                     /locus_tag="SFLA_RS01420"
                     /old_locus_tag="Sfla_0299"
                     /db_xref="GeneID:11369864"
     CDS             340995..342092
                     /locus_tag="SFLA_RS01420"
                     /old_locus_tag="Sfla_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014152441.1"
                     /db_xref="GI:503918447"
                     /db_xref="GeneID:11369864"
                     /translation="MRSVTEQAAFAARFGLSGTPGSDAFWATAGSPASVAADGGGWTT
                     LFLWRGSPASVSFESWSESVPLHRWEDTDCWYAEVPMPPRLRVTYQFLADSGEYGDPF
                     NPEGAGGDRSVFATPDAPRQPHWPAFGADDVLPVPSTRIRWASGVLGGRRTVRVHPVG
                     GGGPVVLLLDGDDWLYLHPAMTAFESAVEAGDMPPVTLVFLPSKDRAAEFGCGRELWQ
                     AVRDELLPLVAESGVHADPDRLVVAGQSLGGLSAMYAALEFPELVSRVACQSPSFWWT
                     PDALDRADLLDGPVGGSIAGRLRERPDLSGLRVAFDVGEHETRILPHCALVESLTEQA
                     GASVRVSRSASGHDRAGWRHALLRDVAWALT"
     gene            complement(342085..342351)
                     /locus_tag="SFLA_RS01425"
                     /db_xref="GeneID:23391307"
     CDS             complement(342085..342351)
                     /locus_tag="SFLA_RS01425"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825276.1"
                     /db_xref="GI:754214647"
                     /db_xref="GeneID:23391307"
                     /translation="MRATRTGWSFSIMRNSWSVVFFVRHGRVGFDSKGGRSAARSANS
                     AYDAPAPASRNCGCAPPAVFFHARVCSRRHGGIVRRGSLAAQVR"
     gene            342409..342735
                     /locus_tag="SFLA_RS01430"
                     /old_locus_tag="Sfla_0300"
                     /db_xref="GeneID:11369865"
     CDS             342409..342735
                     /locus_tag="SFLA_RS01430"
                     /old_locus_tag="Sfla_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152442.1"
                     /db_xref="GI:503918448"
                     /db_xref="GeneID:11369865"
                     /translation="MTAGLVAFVRARFNEELEKARFAGNVVGSRPERFGVGPEEAAEH
                     ARFSVAAAEARIVLLDDTVVPYLGTAGPGGRNAEFQLRLLAAPYVEHRDYPHDDGSAR
                     RPGSPA"
     gene            342732..343154
                     /locus_tag="SFLA_RS01435"
                     /old_locus_tag="Sfla_0301"
                     /db_xref="GeneID:11369866"
     CDS             342732..343154
                     /locus_tag="SFLA_RS01435"
                     /old_locus_tag="Sfla_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152443.1"
                     /db_xref="GI:503918449"
                     /db_xref="GeneID:11369866"
                     /translation="MTAALVAFVRARLDEREAAAVAAGGAGEGWQAWGTGIYATSSPD
                     DDVPPLVTTGPEVGGSDEDAARAAHIALHDPPQVLRDVEAIRSLLEQYTAPEAGEGLP
                     DGLDQRTAGTRRPAVETAVRHLAQAHARHPDYRPEWRP"
     gene            343289..343816
                     /locus_tag="SFLA_RS01440"
                     /old_locus_tag="Sfla_0302"
                     /db_xref="GeneID:11369867"
     CDS             343289..343816
                     /locus_tag="SFLA_RS01440"
                     /old_locus_tag="Sfla_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="WP_014152444.1"
                     /db_xref="GI:503918450"
                     /db_xref="GeneID:11369867"
                     /translation="MTETTPGWLTEDELGMARARMPVLYVEAVPVRVDETGDVTGIGL
                     LLRIGTDGTISRALVSGRVLHHERVRDALLRHLEKDLGSVALPRVPASLQPFTVAEYF
                     PTTGVTPFHDPRQHAVSLAYVVPVAGDCRPRQDALDLVWFSPQEAASPAVQNEMPGGH
                     GALLKQALAHMGHIY"
     gene            complement(343993..344283)
                     /locus_tag="SFLA_RS01445"
                     /old_locus_tag="Sfla_0303"
                     /db_xref="GeneID:11369868"
     CDS             complement(343993..344283)
                     /locus_tag="SFLA_RS01445"
                     /old_locus_tag="Sfla_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152445.1"
                     /db_xref="GI:503918451"
                     /db_xref="GeneID:11369868"
                     /translation="MRQQVLILFLANSALDAEVIGWSSYDGTGRTRPTTGDGDEPPYG
                     TGLDALLDGWRLIQASQLIPPHPGHEYDTSFLKHEFIFEKLHEEKGAAVTDA"
     gene            complement(344280..345080)
                     /locus_tag="SFLA_RS01450"
                     /old_locus_tag="Sfla_0304"
                     /db_xref="GeneID:11369869"
     CDS             complement(344280..345080)
                     /locus_tag="SFLA_RS01450"
                     /old_locus_tag="Sfla_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_014152446.1"
                     /db_xref="GI:503918452"
                     /db_xref="GeneID:11369869"
                     /translation="MLTSVQVARFVASGSLRLDAVVPPGMNEQAVAVLDAGIPPVPYG
                     TPLAEAFAPGSFAQRLTSLPAVAGAIRSLVGPGPTVDHHAVHVREPHQGSAQPLHGDA
                     IIDVRPDAFDIQLMYYPHEVTTDMGGTLSVPGSHLRRTNETDTGRYQNLRGQTRLVCP
                     AGTVVLLHHGIWHGGRRNDSDTPRYMFKIRLNPTVPQVRLWNTDDLGDPRVGDELRTV
                     FDWYEPAAGRLEVHNRVLLWRALTGDDTFDVDHWVTRVNNRPALGSNA"
     gene            345169..345963
                     /locus_tag="SFLA_RS01455"
                     /old_locus_tag="Sfla_0305"
                     /db_xref="GeneID:11369870"
     CDS             345169..345963
                     /locus_tag="SFLA_RS01455"
                     /old_locus_tag="Sfla_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014152447.1"
                     /db_xref="GI:503918453"
                     /db_xref="GeneID:11369870"
                     /translation="MDQVSLSLAEPPVVVNIGVGVHGVSGPRDVFRLPGLWQLHLYDW
                     TGHLTVGGSRHAIGPGRVSLVPPGTEAAFDYRGRSEHLYAHLRVADAGERRLVPVVQD
                     AGTEAPLISGLLKRALAAMPGAPAQATAEMWTALWRVAGLAGRERPGGAHGAVAAAMA
                     HIEAHLAAPLTVPEIARRSGVSHSHLTRLFRSETGSTVAAYIRARRLEHAGHLLREST
                     MSVQAIACSVGISDLQAFNKACHRELGGSPRAIRGRLLPGDAAGPG"
     gene            complement(346006..347706)
                     /locus_tag="SFLA_RS01460"
                     /old_locus_tag="Sfla_0306"
                     /db_xref="GeneID:11369871"
     CDS             complement(346006..347706)
                     /locus_tag="SFLA_RS01460"
                     /old_locus_tag="Sfla_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_041825277.1"
                     /db_xref="GI:754214649"
                     /db_xref="GeneID:11369871"
                     /translation="MTTPDMQRGRPGAGILRTALRRNSGAVARGTVLMGLYQAGETAF
                     PIALGLIVEHTMQDRSLGSLGLSIAALAVIITTVSLSWRFGMRVLQKANTTEAHRWRV
                     KVAACGLQPVARDVDLKSGEVLTIATEDADQTADIVEVVPLLISSLVAVVVAAVALGM
                     ADLRLGLLVIVGTVAILSVLSAMSRRIGSSTREQQARVARAGAKVADLITGLRPLHGF
                     GGNHAAFLSYRKVSTEAKHQAITVARVNGVYAGTALALNAVLAAAVTLTAGWLAYGGR
                     ITIGELVMAVGLAQFIMEPLKMFSEMPKYVMMARASADRMALVLAAPPSASPGRDRPA
                     AGGDLEVDGVHHGALHGLRFTVHAGEFVAVAAYQPRAGADLAALLGANVPPQAYEGVV
                     RVSGREIKDLSVEALREHLLVNPYDGEIFEGSLRTNIDPSGTSGLVPEAVEASLLTDV
                     VALHREGLDHAVRDRGANLSGGQRQRLSLARSLAADSDVLVLHDPTTAVDAVTEQLIA
                     RNIAKLRKGRTTLVITSSPALLDAADRVLVLDDGAVTAEDTHRRLLATDEDYCRAVAR
                     "
     gene            complement(347693..358596)
                     /locus_tag="SFLA_RS01465"
                     /old_locus_tag="Sfla_0308"
                     /note="peptide synthetase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:11369873"
     gene            complement(358656..360446)
                     /locus_tag="SFLA_RS01470"
                     /old_locus_tag="Sfla_0309"
                     /db_xref="GeneID:11369874"
     CDS             complement(358656..360446)
                     /locus_tag="SFLA_RS01470"
                     /old_locus_tag="Sfla_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter permease"
                     /protein_id="WP_014152451.1"
                     /db_xref="GI:503918457"
                     /db_xref="GeneID:11369874"
                     /translation="MSGTDTRVAPAATLRTAAGGESTRWVAARCREVPWLTAATVFTT
                     VAGAALQVLPVLLLGRVVDGVVEGDGRSVLVTTGILMAAAALLGAAATAVSTYLIGRL
                     GADLLAQLREAAVRAVLGMPSARIEQVGRGDVLSRVGDDVAVLSRGIRTAIPTVFSAG
                     VLVAIATVGMFGLDWRLGLAGAGALPAYALALRWYLPRSAPLYQQQRVAQADRAQALI
                     SGLNGIDTVRAYRLEGAFREQVTDKSWRVRELGIQVFRIFGRFVGRENRAEFIGLVLI
                     LVVGYVLLETGAATLGDVSAAPLMFHRLFTPLGAIMFTFDEAQKSGASLTRLVGVLGE
                     SSERRLVGDAPVASGGPVPHAVTVEGLTFGYPGAEEPVLRDVSLSIPAGGSLALVGAT
                     GAGKSTLAALIAGIGTPQAGSVRIGPHDLAGLDEAGARALVSILTQETHVFSGPLAED
                     LRLSAPAATDTELMDALRVVGARPWAEELPDGLDTTVGEGGERLDVTKVAQIALARLV
                     LNQAGVVVLDESTAEAGSEGAAELEKSVRAACSGRTTLFVAHRLTQAMAADRIAVLDA
                     GRVVEQGTHEELVALGGRYARLWRAWREGS"
     gene            complement(360490..361542)
                     /locus_tag="SFLA_RS01475"
                     /old_locus_tag="Sfla_0310"
                     /db_xref="GeneID:11369875"
     CDS             complement(360490..361542)
                     /locus_tag="SFLA_RS01475"
                     /old_locus_tag="Sfla_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron siderophore-binding protein"
                     /protein_id="WP_014152452.1"
                     /db_xref="GI:503918458"
                     /db_xref="GeneID:11369875"
                     /translation="MLFHRSTFPKPGRRLAAALAAVTLGVGLLAGCGSDSEDGTSDKA
                     PAAASGAFPVTVEHAFGSTEVTKAPERVVSVGYTDDQAVLALGIKPVGMVDQYPNPAG
                     TSPDINTQWPWVKDKWGDTRPEVVMSNGDSGPNYEKIAALRPDLIIAVYSEIDRAAYD
                     KLSKIAPTVGRTKAEKELFSAPWQDNAVHIAKALGKEDEGTALVKGIQEKLDAASEAH
                     PEFADQTAVALSWYEDSVAPFTTTDVRGRLVTGIGFKGATKIDEIAGDSFYTKLSPER
                     MDLVDVDRLFVINDKADQDALKKFELFSNLSAVKAGKVSYMLDSEGPAVGAAMSQGTL
                     LSLPYAIDELVKSVEQ"
     gene            complement(361659..362498)
                     /locus_tag="SFLA_RS01480"
                     /old_locus_tag="Sfla_0311"
                     /db_xref="GeneID:11369876"
     CDS             complement(361659..362498)
                     /locus_tag="SFLA_RS01480"
                     /old_locus_tag="Sfla_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-enterobactin transporter ATP-binding
                     protein"
                     /protein_id="WP_014152453.1"
                     /db_xref="GI:503918459"
                     /db_xref="GeneID:11369876"
                     /translation="MGAQHGTTKHSAASDEARLAARGVTVGYGGRTVIDGLDVTVPSG
                     LITTIIGPNGCGKSTLLRTLTRLLKPASGAVVLDGEDIAGLRTRDVAKKLGLLPQAPV
                     APEGLTVADLVARGRHPHQSWLRQWSSDDASVVERALAMTGVSELADRPVDSLSGGQR
                     QRVWISMTLAQGTDLLLLDEPTTYLDLAHAIDVLDLVDDLHESGRTVVMVLHDLNLAT
                     RYSDNLVVMRAGSILAQGHPRDVITVELLHEAFGLNAKVIDDPVGDRPLIVPIGRTHV
                     QLN"
     gene            complement(362551..363615)
                     /locus_tag="SFLA_RS01485"
                     /old_locus_tag="Sfla_0312"
                     /db_xref="GeneID:11369877"
     CDS             complement(362551..363615)
                     /locus_tag="SFLA_RS01485"
                     /old_locus_tag="Sfla_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="WP_014152454.1"
                     /db_xref="GI:503918460"
                     /db_xref="GeneID:11369877"
                     /translation="MNGTDVKRPVVPGVRLGGMSFVWRPWLVSVTVLLAGATFLVFCV
                     SVGVGDFPIGVPRVVATIFGHGEQVDEFVIMDLRMPRALAGLLVGLALGVSGALTQSI
                     ARNPLASPDILGITGGAGVVAVFLVTASGGAAAAVVSTVGLSAAALAGGLGAGLLVYF
                     LAWRRGIDGFRLILIGISVTAVTEALTTWLLATADIRDVARAQAWLVGSLDNRSWDEV
                     RVVFWCSLVLLAVVTAAAFQFRPLHLGDEVAAGLGVRFSRVRAVLLLCAVLLAAAAVG
                     AAGPVPFVALVAPQVAMRLARHPTPPLVASGLVGALLLLGADLVARAALPITLPVGVV
                     TAAIGGPFLVYLLVRSNLRQ"
     gene            complement(363612..364670)
                     /locus_tag="SFLA_RS01490"
                     /old_locus_tag="Sfla_0313"
                     /db_xref="GeneID:11369878"
     CDS             complement(363612..364670)
                     /locus_tag="SFLA_RS01490"
                     /old_locus_tag="Sfla_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_041825551.1"
                     /db_xref="GI:754215105"
                     /db_xref="GeneID:11369878"
                     /translation="MSTSAVERPVLRGAAEARRRRAVGLGALVAVLVAGVVASLAVGA
                     RALSPAEVWHGLFAAPDSDQRLTEIRLIVQTVRVPRTVLAVVAGIALGVGGALIQGYT
                     RNPIADTGLLGVNSGASFAVVTVIAVFGLTSPFQYVWFAFLGAGAAGVVVFGLSSIGR
                     GAGNPLTLALAGQGVTVFLAAMTMAIALSDLKALDALRFWNAGSVAGVGFDVIGPVGA
                     FIAVGVLLALTTLPSLNLLNLGDDVARGLGVNIALSRTVGIVAITLLAGAATAACGPI
                     AFLGLMVAHVARYLTGPDYRWLVPYAGLLGAVVLLVCDIVGRLVVRPGELDAGVVVAL
                     LGAPFFAALVWRGKFRSA"
     gene            complement(364852..366195)
                     /locus_tag="SFLA_RS01495"
                     /old_locus_tag="Sfla_0314"
                     /db_xref="GeneID:11369879"
     CDS             complement(364852..366195)
                     /locus_tag="SFLA_RS01495"
                     /old_locus_tag="Sfla_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lysine 6-monooxygenase"
                     /protein_id="WP_014152456.1"
                     /db_xref="GI:503918462"
                     /db_xref="GeneID:11369879"
                     /translation="MSQVQPGDAPQVLDLIGIGFGPSNVAMAIAISEHNTDAAAQQPV
                     SAHFFEQQPRFGWHRGMLIDDATMQVSFLKDLVTLRNPTSEFSFLCYLKSRGRLVDFI
                     NHKNLFPLRVEFHDYFEWAAAKVGDMVSYRQEVVGVTPVLNDGGAVEYLDVTVRSDEG
                     LTVHRARNVVIGTGLRPLMPEGVERGDRVWHNSELLAKVEGLEGASPSRFVVVGAGQS
                     AAENVAYLHRRFPEAEVCAVFSRYGYSPADDSSFANRIFDPGAVDEYFAAPGDVKRRL
                     MDYHGNTNYSVVDIDLIDDLYRQMYQEKVLGTERLRFLNVSRLAAVEEKPDTVHATVT
                     NLVTGEEAVLDADIVVFATGYSPVDPLGLLGEAAGSCLRDEEGRVRVERDYRIATEAG
                     LSCGIYLQGGTEHTHGITSALLSNTAIRVGEILDSLLARGVKATSDEARPLADAS"
     gene            366442..367389
                     /locus_tag="SFLA_RS01500"
                     /old_locus_tag="Sfla_0315"
                     /db_xref="GeneID:11369880"
     CDS             366442..367389
                     /locus_tag="SFLA_RS01500"
                     /old_locus_tag="Sfla_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012382147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_014152457.1"
                     /db_xref="GI:503918463"
                     /db_xref="GeneID:11369880"
                     /translation="MRVVMFGYQTWGHRTLQALLDSEHDVVLVVTHPRSEHAYEKIWS
                     DSVADLAEARDVPVLIRNRPDDDELFARLQEADADIIVANNWRTWIPPRIFGLPRHGT
                     LNIHDSLLPKYAGFSPLIWALINGESEVGVTAHMMNDELDAGDIVRQEAVAVGPTDTA
                     TDLFHKTVDLIGPVTIGALDLIAAGQTEFTRQDRSQATFFHKRAAEDIRIDWNWPAED
                     LERLVRAQSEPYPSAFTFHRGRRIEILAAVVSQGRYGGTPGRVFYREGEGVVIVAGSD
                     ARTGRNHGLAVTRVRTEDGRELPATEYFTSMGGYLTGRP"
     gene            367617..368516
                     /gene="fecE"
                     /locus_tag="SFLA_RS01505"
                     /old_locus_tag="Sfla_0316"
                     /db_xref="GeneID:11369881"
     CDS             367617..368516
                     /gene="fecE"
                     /locus_tag="SFLA_RS01505"
                     /old_locus_tag="Sfla_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152458.1"
                     /note="Part of the FecBCDE citrate-dependent iron (III)
                     transport system; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-dicitrate transporter ATP-binding subunit"
                     /protein_id="WP_030125008.1"
                     /db_xref="GI:662753728"
                     /db_xref="GeneID:11369881"
                     /translation="MRAGESTSTAVGTPVSAVGPPRRGHGLSADGVTVAYGRVDVVHG
                     AALTLRPAEVTALVGPNGSGKSTLLRTLARLQSARTGSLTVDAGTDAAEDGFALGARE
                     FARRVALLTQSRSTPGGLTVRDVVDFGRYPHRGRWGRPDPRGTAAVDRALRLTGVEDL
                     AARGVDQLSGGQLQRVWLASCLAQETGVLLLDEPTTYLDLRYQVELLDLIRDLADDHG
                     IAVGVVLHDLDQAAAVADRVALLHAGRVVADGVPEDVFTPGLLSDVYGIRIDVDTDPA
                     TGSLRTRAIGRHHSRSERLSTTS"
     gene            368513..369496
                     /locus_tag="SFLA_RS01510"
                     /old_locus_tag="Sfla_0317"
                     /db_xref="GeneID:11369882"
     CDS             368513..369496
                     /locus_tag="SFLA_RS01510"
                     /old_locus_tag="Sfla_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014152459.1"
                     /db_xref="GI:503918465"
                     /db_xref="GeneID:11369882"
                     /translation="MRRHLLTTAAVAVAALSLAACGTTEPSSDDASAASGKPAEKITL
                     TDAKGTKVTLDGPATKVVATEWNVVEDLVALGVDPVGVADVKGYTAWNTAAPLTGSPK
                     DIGTRGEPSIDTVAALAPDLVVATSDLSPAVVKQLRKVAPVIEITSADAADQIGTMTE
                     GLDLIAKATGKESESAALKKDFDTSVAEGKKALADAGLGGAEIASADGYVASNQVSVR
                     AYTGGSLLGAVNEKLGLKNAWTVKGDESYGLATTDVEGLTGLGDVQFTYVANDADGDA
                     FAGPLAKNAVWKSLPFVKAGDVHRLPDGVWMFGGPRSMEAYIDSLVDALTK"
     gene            369524..371569
                     /locus_tag="SFLA_RS01515"
                     /old_locus_tag="Sfla_0318"
                     /db_xref="GeneID:11369964"
     CDS             369524..371569
                     /locus_tag="SFLA_RS01515"
                     /old_locus_tag="Sfla_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_033249778.1"
                     /db_xref="GI:702732589"
                     /db_xref="GeneID:11369964"
                     /translation="MAGRDRSVAATTGAVAVTATLVLLVVVLAAVDITQGTADVGGSE
                     VWDALTGNAAAGDSSVVIASRLPRMVAAVLVGVALGTAGAALQAVSRNVLASPDTLAV
                     NAGSYLALGIVAVTGVSLPLLASSGAAFVGGLAAAAVVLGLSGLGKGTVRLVLAGTAL
                     ALGLSAVTEALLLLFPQETEGLYSWNQGSVGQNGFDAVVRMAPVVVAGLAGLMLLARR
                     IDALALGDDAARGLGVPVRGTRVTTVVVATLLSAAAVTLAGPIGFVGLCAPALVRPLT
                     RRFRGLVRSRVSLPVTGLVGAALVLGSDVLLRAVVPADTAVEVPTGVVTTVVGGVFLV
                     VMALRLRDTASAEPPDRLRIPGRTAFLVTVAVLAVVLVGVLFAAVLLGDSKLLLGDVM
                     NWAQGRSGRVVTFVLDTRVPRVSAALLAGGALALSGTLVQAVTRNPLAEPGVLGVSGG
                     AGLGAVLLVTTVQSPGSWEIAGAAFGGAAVTATFVFGLAARGGFQQNRLVLLGVGVSA
                     AAAALISLVIVLSDPFDTTKALTWLSGSTYGRNMPDVVPVAVVLAVGIVLAVVRRREL
                     DLVALDEDTPRLLGMGLPRARLGLLVMAVLLAATAVAAAGTIAFVGLVAPHAARALVG
                     RRHVRVVPVALLLGAALVCLADLAGRTVIAPAQLGAGLMTAVIGAPYFLYLLVRTRR"
     gene            complement(371657..372094)
                     /locus_tag="SFLA_RS01520"
                     /old_locus_tag="Sfla_0319"
                     /db_xref="GeneID:11369965"
     CDS             complement(371657..372094)
                     /locus_tag="SFLA_RS01520"
                     /old_locus_tag="Sfla_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152461.1"
                     /db_xref="GI:503918467"
                     /db_xref="GeneID:11369965"
                     /translation="MTRAWILPMSLVLSGVLVATAQVRDGSPVLAVVLLLVFAVLAWL
                     YSPLAFPRSIGAVEAQRRSAADGRPVVYWRAGCVYCLRLRIRLGRDARRSHWVDIRRD
                     PAGAAEVRAANGGDETVPTVVVAGRPHVNPDPAWVRGQLPPSA"
     gene            372199..372546
                     /locus_tag="SFLA_RS01525"
                     /old_locus_tag="Sfla_0320"
                     /db_xref="GeneID:11369966"
     CDS             372199..372546
                     /locus_tag="SFLA_RS01525"
                     /old_locus_tag="Sfla_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_014152462.1"
                     /db_xref="GI:503918468"
                     /db_xref="GeneID:11369966"
                     /translation="MPVRRVVPDIRSEAMEESRDFYGLLGFEEVMNQGWVMTLASSSC
                     PTAQVTLTSHDRSAPVVPDISIEVDDVDAAYAVMRESGADIVYPLRDEEWGVRRFFVL
                     DPNGTVVNVLSHR"
     gene            373075..374946
                     /locus_tag="SFLA_RS01530"
                     /old_locus_tag="Sfla_0321"
                     /db_xref="GeneID:11369967"
     CDS             373075..374946
                     /locus_tag="SFLA_RS01530"
                     /old_locus_tag="Sfla_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152463.1"
                     /db_xref="GI:503918469"
                     /db_xref="GeneID:11369967"
                     /translation="MRARRTAGWAASALVTVLASAGLLAAPAAASGPAAARGPQVATA
                     TDPVTHEENDRVPEGSLWTQHYFPSSDRSGTELHADVLLPEGLPRKAEVPVILSVGPY
                     FGHSGQSGAEGWSHTGPSARFQDFIEGTDLFDQGYAFVMVDLRGFGGSTGCLDWGGPG
                     EQADVKAAIDWAAKQPWSTGAVGLYGKSYDAVTGLIGNNLDQRALKAVVAQEPLWDMY
                     QYIYSNGVPRPNVTGTANAYNSIATLDQLPDDDARYLANSRYEEAHPECLTENSAGYR
                     IADQHDPFWTSRDLAKAARGTDTPLFVTQGFIENNTKPEEMQEYLDNHKGPERGWVGQ
                     WEHVRGGDRTGDGRLAMGREGWYDETLSFYDQYLKGVRPTVRYPAYSVEDSTGAWRAQ
                     KTWPAVERSVSISLGGGSYVDDGGLSSIAGLVGPDGQAPRERVEPSGDWDLENAPAID
                     PAAPKGLAEKQARLPRPGAVTSSFFVWSEALEKAVRVTGTPRVSLTARGEGNVMLKLY
                     DVAPDGTAVMFDEQVSLLRTGKLSVDLKATDWTLAAGHVLAVEIGSIRTGSWRDTPSG
                     GTIRVEGARLGLALDDPADDIATGGARSPYLDTYLLRYTVPLPAGPGTFTVVPGGRL"
     gene            complement(375069..>375693)
                     /locus_tag="SFLA_RS01535"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391308"
     gene            complement(375764..376879)
                     /locus_tag="SFLA_RS01540"
                     /old_locus_tag="Sfla_0323"
                     /db_xref="GeneID:11369969"
     CDS             complement(375764..376879)
                     /locus_tag="SFLA_RS01540"
                     /old_locus_tag="Sfla_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152464.1"
                     /db_xref="GI:503918470"
                     /db_xref="GeneID:11369969"
                     /translation="MSVTMSSTKTRAALRVSARVSGELLLVLVMTAVALWLLGRMWSV
                     VWPLVVGLLLTTLTWPLTRFLRRRGWPPALAASTVTVLFLLVAGGAVALIAVPVASQS
                     GELADGVVEGIQRLREWASGPPLNIGDDQITGAFDSATARVQDSVGSMVTTVVTGVST
                     VVNGVVTAVLAVFLMFFMLKDGPRFLPWLARQLPGRLATDVPTVAARGWDTLGEFVRS
                     QAYVGLLDAVLIGLGLWIVGVPLVLPLAVLTFVSAFVPIVGALFAGFVAVLIALVSNG
                     LTDALIVLAIIVVVQQLEGNVFQPMIQSRGLGLHAAVVLLAVTLGGSLAGIVGSLLAV
                     PAAALIAVVWNYVREQLVEPGEEPEVQTSPSPVGTPS"
     gene            377045..377743
                     /locus_tag="SFLA_RS01545"
                     /old_locus_tag="Sfla_0324"
                     /db_xref="GeneID:11369970"
     CDS             377045..377743
                     /locus_tag="SFLA_RS01545"
                     /old_locus_tag="Sfla_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="WP_014152465.1"
                     /db_xref="GI:503918471"
                     /db_xref="GeneID:11369970"
                     /translation="MTSQRQNEQTWTLYGQRQLDHGFQPPVPQRIDWGFWPGVGPGAE
                     LLGDIRGRRVLDIGSGPGHHAVHLARGHGALVCGVDISPTQHRRATRAHRDEPGVRFL
                     CADIAAHLRGSELYEAAYGVRTFGCIDPHHLLPALRDGLTGGSPLVFSALHTDSDGHG
                     PSGSVESRPEVIRLRDEEPIATHMWVLDPGLWEELLAAHHFTVTATHLLQAPEAGSPV
                     VMQVIQARRQAGRG"
     gene            377998..378843
                     /locus_tag="SFLA_RS01550"
                     /old_locus_tag="Sfla_0325"
                     /db_xref="GeneID:11369971"
     CDS             377998..378843
                     /locus_tag="SFLA_RS01550"
                     /old_locus_tag="Sfla_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MIP family channel protein"
                     /protein_id="WP_014152466.1"
                     /db_xref="GI:503918472"
                     /db_xref="GeneID:11369971"
                     /translation="MAKRSTRSGLLGELSAEFAGTMILILFGCGVVAQVVAGGALTDP
                     PGGLGDHDSIAWAWGLGVTLGVYVAARLSGAHLNPAVTLALATFRGFPWSKVAPYFLA
                     QTAGAFVAALLVRWNYTEALAKADPGHTTKTQTVFSTLPANGNPALPVHEWGAFRDQV
                     IGTAILLLLIMAITDMLNTPPGANLAPFIIGLVVVAIGMAWGTNAGYAINPARDFGPR
                     LASFITGYNGAWRDQYGNLYFWVPIVGPLVGGLLGAGLYKAFVGRFLPSAEPEPPGRV
                     PAPED"
     gene            378871..380388
                     /gene="glpK"
                     /locus_tag="SFLA_RS01555"
                     /old_locus_tag="Sfla_0326"
                     /db_xref="GeneID:11369972"
     CDS             378871..380388
                     /gene="glpK"
                     /locus_tag="SFLA_RS01555"
                     /old_locus_tag="Sfla_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152467.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_014152467.1"
                     /db_xref="GI:503918473"
                     /db_xref="GeneID:11369972"
                     /translation="MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHAQILPRSGWV
                     EHDPVEIWERTNSVMQNALRFGGIAPGDLAAIGITNQRETTVIWDPRNGRPYYNAIVW
                     QDTRTDAIAAELERSGRGDVIRRKAGLPPATYFSAGKIQWILENVDGVREAAEAGHAI
                     FGNTDAWVLWNLTGGPDGGIHATDVTNASRTMLMDLETLDWDEELLSFFNIPRSMLPT
                     INPSSHAEAYGTTRTSRPLRAAVPIGGVLGDQQAATVGQVCFSPGEAKNTYGTGNFLV
                     LNTGTELVRSQHGLLTTVAYQFGDSPVVYALEGSIAVTGSAVQWLRDQMKIIKTAAES
                     EVLARSVDDNGGMYFVPAFSGLFAPYWRSDARGAIVGLARYNDNAHLARATLESICYQ
                     SRDVVEAMEQDSGVHLDVLKVDGGVTANDLCMQIQADVLGVPVSRPVVAETTALGAAY
                     AAGLATGFWQNTDELRAQWHESERWAPQWSEEQREEGYAGWKKAVERTLDWVKVS"
     gene            complement(380502..381467)
                     /locus_tag="SFLA_RS01560"
                     /old_locus_tag="Sfla_0327"
                     /db_xref="GeneID:11369973"
     CDS             complement(380502..381467)
                     /locus_tag="SFLA_RS01560"
                     /old_locus_tag="Sfla_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018955766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_014152468.1"
                     /db_xref="GI:503918474"
                     /db_xref="GeneID:11369973"
                     /translation="MSNLDRQATPSVCGGRGFVVAEPVRELLTPRHVQLGESTEVRRL
                     LPNLGRRMVGAWAFVDHYGPDDIADEPGMQVPPHPHMGLQTVSWLHEGEVLHRDSLGS
                     LQQIRPRELGLMTSGRAISHSEESPKPHARFLHGAQLWVALPGSDRHVEPRFEHHTGL
                     PAVTAPGLTATVILGELDGAASPGTAYTPIVGADLTLTAGAEARLPLDPDFEYAVLSM
                     SGEAEIDGVPVLPGSMLYLGCGRTELPLRAASDAGLMLLGGEPFAEEIVMWWNFVGRS
                     HEEIEQARQDWMEGPRFGEVKGYDGGRLPAPELPPVALKPRGRVR"
     gene            381588..381965
                     /locus_tag="SFLA_RS01565"
                     /old_locus_tag="Sfla_0328"
                     /db_xref="GeneID:11369974"
     CDS             381588..381965
                     /locus_tag="SFLA_RS01565"
                     /old_locus_tag="Sfla_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152469.1"
                     /db_xref="GI:503918475"
                     /db_xref="GeneID:11369974"
                     /translation="MEDTYYEFGTPADRWDRAQMFFEAKEYLTAARILGGLVQEVPEQ
                     VAPRLLLARAYYHSARLGKAETELREVLERNPVEDYARLMLGRTLERQGRQSEADTHL
                     RMVQAMAGDLGPELHAQEQRIQG"
     gene            complement(382038..382733)
                     /locus_tag="SFLA_RS01570"
                     /old_locus_tag="Sfla_0329"
                     /db_xref="GeneID:11369975"
     CDS             complement(382038..382733)
                     /locus_tag="SFLA_RS01570"
                     /old_locus_tag="Sfla_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014152470.1"
                     /db_xref="GI:503918476"
                     /db_xref="GeneID:11369975"
                     /translation="MSTRARILEVAARLVAESPDGEISTRAVCEAAQVGAPALYRHFG
                     DKEGLLSAVVDHGFDAYLATKRERGDTTDPVEDLRNGWDSHVDFALRNPNLYRLMNSP
                     AMRTPPGSAIEAHRILTHDLERAAAQGKLRVAPELAAQMIMSATTGVALMLVSRPVTF
                     PDVGMSARVRDAVHAAVFTADVSPGAPVETAVPSAAATLGALLRRSHGSGLSTAESAL
                     MTEWLDRVSNAER"
     gene            complement(382851..383600)
                     /locus_tag="SFLA_RS01575"
                     /old_locus_tag="Sfla_0330"
                     /db_xref="GeneID:11369976"
     CDS             complement(382851..383600)
                     /locus_tag="SFLA_RS01575"
                     /old_locus_tag="Sfla_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_014152471.1"
                     /db_xref="GI:503918477"
                     /db_xref="GeneID:11369976"
                     /translation="MTEQHTTSTRRVALVTGGSRGIGRESAERLASDGFAVVINYAGN
                     KTEAEAAVAAVVAAGGQAVAHQADVADEAAVAALFDAAEEAFGGVDVVVHAAGIMSLS
                     PLVDLDLDALDGMYRTNVRGTFVVDQQAARRLRGGGAIINFSSSVLALAIPGYTAYAA
                     TKGAVEAMTLILARELRGRDITVNAVAPGPTATALFLDGKDEETIARMAAQPPLERLG
                     APEDIAEVVSFLAGPARWVNGQVLRANGGII"
     gene            complement(384046..384717)
                     /locus_tag="SFLA_RS01580"
                     /old_locus_tag="Sfla_0331"
                     /db_xref="GeneID:11369977"
     CDS             complement(384046..384717)
                     /locus_tag="SFLA_RS01580"
                     /old_locus_tag="Sfla_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_014152472.1"
                     /db_xref="GI:503918478"
                     /db_xref="GeneID:11369977"
                     /translation="MIERLLPAYVACSDTHETDAPEGSLYPEEVRQVASSVDRRRHEF
                     AAVRACARKAMADLGLPPAPVLSGHRGMPRWPEGTVGSMTHCEGYRAAVLARTSDARA
                     VGIDAEPNAPLPPDVWEVISLPSERARRPLGADSGTVHWDRLLFSAKESVFKTWFPLT
                     RIELDFSEADIVFRASPDSATEGTFTAELLRVAPGMPSAYEGRWLVDDGFAVTAIVLP
                     ATPFV"
     gene            complement(384714..385619)
                     /locus_tag="SFLA_RS01585"
                     /old_locus_tag="Sfla_0332"
                     /db_xref="GeneID:11369978"
     CDS             complement(384714..385619)
                     /locus_tag="SFLA_RS01585"
                     /old_locus_tag="Sfla_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_014152473.1"
                     /db_xref="GI:503918479"
                     /db_xref="GeneID:11369978"
                     /translation="MSSPAGPAPHTSNGGGRLLAVSDLHVGIADNRPVADRLHPSGDE
                     DWLIVAGDVAEEAEEVERALELLAGRFAHVVWTPGNHELWTVDKDPVRLRGQERYEHL
                     VKVCRELGVTTPEDPYPHWQGDDGPVAVAPVFLLYDYSFRVPGVTSKEESLARAHDAG
                     VVCTDEYLLHPDPYATRDDWCRARVALTEQRLAAHDPDVPLVIAGHWPLLREPTSVMW
                     YPEFAQWCGTELTADWHRRFNVAAVVYGHLHIPRTTWHDGVRFEEVSIGYPREWRKRG
                     HPRGLLRQILPYGGQEPPATKGEGS"
     gene            385772..386659
                     /locus_tag="SFLA_RS01590"
                     /old_locus_tag="Sfla_0333"
                     /db_xref="GeneID:11369979"
     CDS             385772..386659
                     /locus_tag="SFLA_RS01590"
                     /old_locus_tag="Sfla_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014152474.1"
                     /db_xref="GI:503918480"
                     /db_xref="GeneID:11369979"
                     /translation="MPDAERPQDPTQLHPRPEFPQQEQEHPGRTGPMDPPPDHGEDSY
                     RGHELLLDRKAVVTGGDSGIGRAVALAFAREGADVLLTFLPEEESEAEETARLVEQAG
                     RRAVPVECDIREEGACLALVERAVSEFGRIDVLVNNAAYQMSQPDGIAAISTAQFDRV
                     VRTNLYGMFWLCKAALPHIPSGGSIINTTSVQAYKPSPHLLDYAMTKGAIVTFTQGLA
                     QMLASDGIRVNAVAPGPVWTPLIPATMPDTTEFGKQSPLGRPAQPAEMAPAYVFLASS
                     NASFITGEIMNATGGTPLP"
     gene            386699..388186
                     /locus_tag="SFLA_RS01595"
                     /old_locus_tag="Sfla_0334"
                     /db_xref="GeneID:11369980"
     CDS             386699..388186
                     /locus_tag="SFLA_RS01595"
                     /old_locus_tag="Sfla_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
                     /protein_id="WP_014152475.1"
                     /db_xref="GI:503918481"
                     /db_xref="GeneID:11369980"
                     /translation="MRADHREAPVLDALAAYKGKGELAFTPPGHKQARGADPAVRAVL
                     GDAVFFGDLLAIGGLDDRRQTSGALRRAEALMAEAVHAEHTFFSTCGSSLSVKAAMLS
                     VAAPGRKLLMGRDAHKSVVAGLILCGVDPVWVEPQWDTERHLAHPPSAEAYERAFDQH
                     PDACGALVTSPTPYGSAADLCAIAEVCHRRSRPLVVDEAWGAHLPFHPDLPSWAMDAG
                     ADVCVTSIHKMGSGLEQGSVFHLQGDLVDHDTLASRADLLGTTSPSVLLYAGIDGWRR
                     QMVMEGHTLLSGALDLAAEVRQRIEEIDGMHVNGSEGFCGPGKAAEFDPLPVIIDVSD
                     LGTSGYRAADWLRAHHHLDMHIVDHRRISAQFTHADDRKTADRLLDALRDLSGRAPGL
                     GPGPEVMVPGPDELRPDQACAPRDAYFAATEDIPAERAAGRVAAEMMTPYPPGIPAVL
                     PGERLTEPLLRYLRTGVAAGMNVPDAADPTLRTVRVCKEGEGTEA"
     gene            388262..388633
                     /locus_tag="SFLA_RS01600"
                     /old_locus_tag="Sfla_0335"
                     /db_xref="GeneID:11369981"
     CDS             388262..388633
                     /locus_tag="SFLA_RS01600"
                     /old_locus_tag="Sfla_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_014152476.1"
                     /db_xref="GI:503918482"
                     /db_xref="GeneID:11369981"
                     /translation="MPVATYGLVALDCPDPRSLAEFYRGVLGGEVRNDYPDWYDLYAP
                     GGARIAFQKAPDHRPPEWPRGDRNSQQEHLDLDVTDIERAQQEVLTLGATPLDLDDRG
                     GERPFRVYADPAGHPFCLCWH"
     gene            388752..389288
                     /locus_tag="SFLA_RS01605"
                     /old_locus_tag="Sfla_0336"
                     /db_xref="GeneID:11369982"
     CDS             388752..389288
                     /locus_tag="SFLA_RS01605"
                     /old_locus_tag="Sfla_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="WP_014152477.1"
                     /db_xref="GI:503918483"
                     /db_xref="GeneID:11369982"
                     /translation="MSRSALVVIDMLNTYSHPDAEILIPSVREALPHIVGLIERARAD
                     GVPVIYANDNFGEWRSHHGEIIEATLAGPHRDLVEPLLPDGDSLFVVKARHSIFYETP
                     LTYLLSQLDVSRVVLCGQVTEQCVLYSALDAHIRHLAVTVADDAVAHIHQDLARAALR
                     MMERNMDASIRKASAVDF"
     gene            complement(389315..390016)
                     /locus_tag="SFLA_RS01610"
                     /old_locus_tag="Sfla_0337"
                     /db_xref="GeneID:11369983"
     CDS             complement(389315..390016)
                     /locus_tag="SFLA_RS01610"
                     /old_locus_tag="Sfla_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-phosphosulfolactate phosphatase"
                     /protein_id="WP_030880481.1"
                     /db_xref="GI:664352835"
                     /db_xref="GeneID:11369983"
                     /translation="MDSRFVGIAELAETPSVAVVVDVMRAFTVAAWAFARGAEKIVLA
                     GSLDEALALKARHPDRLALKDGASAPGFDLVNSPGLLRSVDLGGRTVVQKTTAGTVGA
                     LAVEDASLVLCAGFVVAEATARVLRARECDEVTFVVTGEDGQADEDLACAQYIARRAA
                     GEGRDTAEFLRRAAGSRAAAELAEGVRQGVHPDDVALCLELDRFPFAMVAASEDSHMV
                     LRPCTVPRPPDEGAV"
     gene            390163..390771
                     /locus_tag="SFLA_RS01615"
                     /old_locus_tag="Sfla_0338"
                     /db_xref="GeneID:11369984"
     CDS             390163..390771
                     /locus_tag="SFLA_RS01615"
                     /old_locus_tag="Sfla_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152479.1"
                     /db_xref="GI:503918485"
                     /db_xref="GeneID:11369984"
                     /translation="MTGPVQAAPQPRKRQGAARRKLLDAAARRFYADGVSATGIDTIT
                     AEAGVAKMSLYNNFSSKADLVLAYLDARHEEWLDLYRCRMESARDGRDGVLAVFDAYA
                     DHARFAYERGFRGCGLLNAAAELPAGDEGRAVVRRHKEHVEALLSAHVAQLLAGRPEE
                     VGPVAEHLSFLLEGAMARAGLEGSAARVEHARTMASDLLERL"
     gene            390822..>391676
                     /locus_tag="SFLA_RS01620"
                     /db_xref="GeneID:23391309"
     CDS             390822..>391676
                     /locus_tag="SFLA_RS01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152480.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_041825552.1"
                     /db_xref="GI:754215107"
                     /db_xref="GeneID:23391309"
                     /translation="MLLASVLWGTTGTAATLAPDVGPLAIGAVAMGLGGLLQAVVAAP
                     RIRREAPLLRAERGVVLLGALAVAAYPPAFYSSMHLAGVATGTVVSIGSAPLASALIE
                     RVVDGRRLTRRWITGAVLGLSGTVLLCAAEATAGASSGPGARSAGSTVLGVALGLTAG
                     LTYAVYSWAAHRLIGRGLTSGAAMGTVFGIGGLLLVPVLAATGAPLLDSWSAAAVGAY
                     MALVPMFLGYVLFGWGLARVRASTATTLTLLEPAVAAVLAVLVVGERLRPAGWVGVAL
                     IVCCLGVLT"
     gene            complement(391832..392599)
                     /locus_tag="SFLA_RS01625"
                     /old_locus_tag="Sfla_0340"
                     /db_xref="GeneID:11369986"
     CDS             complement(391832..392599)
                     /locus_tag="SFLA_RS01625"
                     /old_locus_tag="Sfla_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_014152481.1"
                     /db_xref="GI:503918487"
                     /db_xref="GeneID:11369986"
                     /translation="MTHVQDPSAGGTPAPTQPTRASDATVTRYTAASDAAATRLALAA
                     RDGDPVKADRFVRALHSDVWRYVAHLSGETQAADDLTQDVFLRALTGLPGFEGRSSAR
                     TWLLSIARRTVADSFRRAAARPRLADRDDWQRAAEQAQPCGTPGFDEGVALAELLSSI
                     QADRREAFVLTQLLGIPYKEAATVIGCPVGTVRSRVARARITLMELLTDGPPTPDDLT
                     SDPASTGTQRPVRPLPVARISSQPEQRPAPDMLEIPG"
     gene            complement(392817..393617)
                     /locus_tag="SFLA_RS01630"
                     /old_locus_tag="Sfla_0341"
                     /db_xref="GeneID:11369987"
     CDS             complement(392817..393617)
                     /locus_tag="SFLA_RS01630"
                     /old_locus_tag="Sfla_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152482.1"
                     /db_xref="GI:503918488"
                     /db_xref="GeneID:11369987"
                     /translation="MKPGRYSRAVRAVLFATVCVPLAATGHVLMSGTPVSGPVIFAAL
                     GGTAAAAWALAGRERGLLAVTAAAVAAQAALHQGFAFAQSLSAQPPPLPTQSFARQWA
                     ERLLCGDGATVLSERDAVAVVTDAGLGSVISRPPPGTFAPAVGPAGHGLHAMHGMPTD
                     AAGTVQAAHGGQGMVAAAPTGMLAAHLLAAVLCGLWLAYGERALFRVLRALAWRLRTP
                     LHLLLRLAAPPERPSPRVRWRRTPQSLTRLLLVHSITSRGPPRGTTVA"
     gene            complement(393763..394296)
                     /locus_tag="SFLA_RS01635"
                     /old_locus_tag="Sfla_0342"
                     /db_xref="GeneID:11369988"
     CDS             complement(393763..394296)
                     /locus_tag="SFLA_RS01635"
                     /old_locus_tag="Sfla_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease SbcC"
                     /protein_id="WP_014152483.1"
                     /db_xref="GI:503918489"
                     /db_xref="GeneID:11369988"
                     /translation="MPTDSDRIELSDNELREIAGYAADCARTVLPIYEGGLPADTRPR
                     DAVDAARTFAEGGPRTNRLRQSAWAAYKAAAGAESPGAADAARSASHAAAAAFLHPKA
                     SAHQVKHVLGAAAHALRARELAATEGRPGVAESLDRVRRDAPAAVTAVLGRLPGAPSG
                     GGRVGEIIRELDALLRD"
     gene            complement(394430..395842)
                     /locus_tag="SFLA_RS01640"
                     /old_locus_tag="Sfla_0343"
                     /db_xref="GeneID:11369989"
     CDS             complement(394430..395842)
                     /locus_tag="SFLA_RS01640"
                     /old_locus_tag="Sfla_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_014152484.1"
                     /db_xref="GI:503918490"
                     /db_xref="GeneID:11369989"
                     /translation="MSVEPAVRTPGDPQEGGRPDPPGTRSVWAPLRPLVRRLHFYAGV
                     LIAPFLLVAATTGLLYAASYQVEKIVYAEELRVPVGGSELPVSRQVTAAREAHPEGEV
                     AAVRPSPEDGATTRVLLSGVPGVDPDHTLAVFVDPYTGGVTGALEQYGSTGALPLRTW
                     IDELHRDLQLGQPGRLYSELAASWLWVTAGGGVVLWFGRRRARRRIRGATGRRRALSL
                     HGTVGVWAAAGLFFVSATGLTWSTYAGQNVTELREAVGQTTPALDAGSSSGGEHAEHM
                     GAGAPAGAPGEDIGLDAALSTARAERLSNPVEIVPPADSSGYVVRQIQRSWPEKQDAV
                     AIDPATGEVTDVVRFADYPVLAKLTRWGIDAHTGVLFGLLNQLVLVALCSGLILLIVL
                     GYRMWWQRGRGSAFGRPLPRGAWQKVPPQVLVPLMAAVAVLGYFVPLLGIPLAAFLAL
                     DIVLGEYAYRRGRRSYATAD"
     gene            complement(395973..397145)
                     /locus_tag="SFLA_RS01645"
                     /old_locus_tag="Sfla_0344"
                     /db_xref="GeneID:11369990"
     CDS             complement(395973..397145)
                     /locus_tag="SFLA_RS01645"
                     /old_locus_tag="Sfla_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_014152485.1"
                     /db_xref="GI:503918491"
                     /db_xref="GeneID:11369990"
                     /translation="MPDPLPRPEPFIQQAAPAVLEDLRTRLRATRWPDAPEDAGWSLG
                     TDLDYLRELVDHWAESFDWPAQEAALARLPRFRVPVGGLGIHFVHARAVDPVGPVLPL
                     VLSHGWPDSFWRYSKVVPLLTDPGAHGGDPADAFDVVVPDMPGFGYSDRPTGRPLDSI
                     DVAGLWAELMTVLGYEKFGAAGGDVGSHVSRYLGLDHPDRVVAVHRTDGGLPVFTGDP
                     AELSPEERSWIDGTTAWGASEGAYAAIHRTKPQTAAFGLSDSPAGLASWIVEKLRSWS
                     ACGGDIERSFTKDEILTNVTLYWVTETIGSSMRMYRANAAIPPAQHARRVEVPSGFSL
                     FSGDVVRPPRQWLERTTNMVRLTEPARGGHFAAFEEPELYAEEIRAFFRPYRAAAG"
     gene            397284..398498
                     /locus_tag="SFLA_RS01650"
                     /old_locus_tag="Sfla_0345"
                     /db_xref="GeneID:11369991"
     CDS             397284..398498
                     /locus_tag="SFLA_RS01650"
                     /old_locus_tag="Sfla_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_014152486.1"
                     /db_xref="GI:503918492"
                     /db_xref="GeneID:11369991"
                     /translation="MSSHIDQQIEHSRPDDASLYADRAQRLRRRLERLIGIAATEGNK
                     LVPLRNGDQIFSSMLESIRAAEHTVDMMTFVYWRGEIACDFAEALSERARAGVRVRLL
                     LDGFGSRLIEKDQLAMMEEAGVEVAWFRKPLYLSPLKQNHRCHRKVLITDEETAFTGG
                     VGIAEEWCGDARDETEWRDTHVRVRGPAVDGLAAAFAQNWAECHDELFTDRDRFVDAT
                     QHGDAVVQVVRGSAGFGWQDMQTLLRVVLESAEERIRLTTAYFAPDAYFVELLCAAAR
                     RGVSVEILLPGPYTDKRVCQLAGQNFYEDLTACGVKIYQYQPTMLHTKVLTVDGVASL
                     IGSTNFNRRSLEHDEEVMLAVLDRDFTVTLDGHFEEDVKKSTLIDGARWKRRSPVQRL
                     REVAVLPIRRFL"
     gene            398640..399068
                     /locus_tag="SFLA_RS01655"
                     /old_locus_tag="Sfla_0346"
                     /db_xref="GeneID:11369992"
     CDS             398640..399068
                     /locus_tag="SFLA_RS01655"
                     /old_locus_tag="Sfla_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152487.1"
                     /db_xref="GI:503918493"
                     /db_xref="GeneID:11369992"
                     /translation="MSESVETRLEATPVVTEPVPDLQLQLLIQLLDREQRSSLPITLA
                     LAGGVLHGDVIGHEAWKADWARSLRQVEGEGANLIAEFPETVDQGIRELGGGDVSSQL
                     PRWIHLRDATLMSGGAGALRLPLWRGRLADVSGWALGRPQ"
     gene            complement(399141..400112)
                     /locus_tag="SFLA_RS01660"
                     /old_locus_tag="Sfla_0347"
                     /db_xref="GeneID:11369993"
     CDS             complement(399141..400112)
                     /locus_tag="SFLA_RS01660"
                     /old_locus_tag="Sfla_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_014152488.1"
                     /db_xref="GI:503918494"
                     /db_xref="GeneID:11369993"
                     /translation="MFSSDDGLCGIGELAERARVSVKTVRFYSDNGLLPEASRSAGGH
                     RRYGPDSLERLRMIRSLRTLDLPVPTVRRILDEGDTPGRAGGALEDAVAGQLRVLGSQ
                     LTAMRWREAALRSVQECPTAERPGRLALIGALTTPPDTAPLARFWRAWLPARMPAHAV
                     TAFLEAAVPQPPADPEPVQVIAFAGLCALVSRPCEGNEVTQPHAHEAAGARESAVLYA
                     GLAEAYDLAGAEMRRGREPYAGDALDGFVDAYASVHRTADTGAFRSGLALRLAADPRI
                     DRYWELTSELVGRPSGRPEPTPGSAHDWLLAALDAQLAKEPPVRHAP"
     gene            400205..401722
                     /locus_tag="SFLA_RS01665"
                     /old_locus_tag="Sfla_0348"
                     /db_xref="GeneID:11369994"
     CDS             400205..401722
                     /locus_tag="SFLA_RS01665"
                     /old_locus_tag="Sfla_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014152489.1"
                     /db_xref="GI:503918495"
                     /db_xref="GeneID:11369994"
                     /translation="MTVFILVSGVFTGPHVWDDTASRLTAAGAEVRAVALSGLGGGHP
                     ADGGDIDLETHIADVLRVVDRTVGPDGREVVLVGHDYGIHPVLGAADRRAGSVARVVY
                     LDSGLPQDGVPALAAVADQGMREEVLRLAGGGAHGAGAALPPPARDAWHLWGSTAGIP
                     DAALDRLTALASPQPLGTLLLPLELTGAAASVPMAGVLCTGGGASIAMVQARVDFGEP
                     ALQALTDPRVTFFELPTGHWPMLSDPDALAVTLLRAAAGKGHRLTPAGAVRPEPFLLD
                     VPELPRERTGTIDLYLPPSAGGPRPALLFVHGGPVPPDARPTPRDWPVLTGYARYAAD
                     HGVVGVTLDHRLHAVTDYAVAADDLADAVERVRADPRVDADRVALWFFSGAGPLTADW
                     LGKPPPWLRCLAADYPVMAPLPSWGRLADRFQPVDAVAHAGSLPLVLVRAGLESDGIA
                     ATVERFLGAARACGAAVEVIDVPNGHHSFETVDRTDESREAVHRAMGAVLRHLTA"
     gene            401876..403141
                     /locus_tag="SFLA_RS01670"
                     /old_locus_tag="Sfla_0349"
                     /db_xref="GeneID:11369995"
     CDS             401876..403141
                     /locus_tag="SFLA_RS01670"
                     /old_locus_tag="Sfla_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_014152490.1"
                     /db_xref="GI:503918496"
                     /db_xref="GeneID:11369995"
                     /translation="MTNRQHPRPPDAVVVGAGLAGLACALDLIRAGLRVELLEASDGV
                     GGRMRTDRRDGFLLDRGFQVFNTSYPQVKRRLDLRALRLRPFTPGLVARTASGRVRLT
                     DPTRRPGDAGALLPGRVLPARDLAALAALTARDVLLPAKRVGRMTDRTAAEALVRAGL
                     SPLAIEDLLRPFLSGVFLEEGLETSARFLHLVWRSMARGTLCLPAHGIGAVPAQLAAG
                     LPEGALRLDSAVTGVTDSGVLLADGGERPGGAVVVATDSATAARLLPGLPVPDGRTVT
                     TYYHAADRSPLTEPTLVVDSGLAVLNSCVLTEVAPSYAPRGTALVSTSVLGSGPPGGE
                     RTVRARLAELYDADTSTWETVAAYTVEGALPAMRPPWPLSRTTRFAPGRYVCGDHRAT
                     GSVQGALASGSRAAREVLADRAAARTTGT"
     gene            403138..404343
                     /locus_tag="SFLA_RS01675"
                     /old_locus_tag="Sfla_0350"
                     /db_xref="GeneID:11369996"
     CDS             403138..404343
                     /locus_tag="SFLA_RS01675"
                     /old_locus_tag="Sfla_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lycopene cyclase"
                     /protein_id="WP_014152491.1"
                     /db_xref="GI:503918497"
                     /db_xref="GeneID:11369996"
                     /translation="MTGHPQERVDDAVVVGGGAAGLCLAHWLTRTGTGVTLVEAPDGP
                     LRPAERTWCYWEAGTGEFEEAVVASWRRLRVRGPDGAVVESDPAPLRYRMVRSGPFER
                     LVHARLAAAPAARVVRATAHEVRDAPYGAEVRCTAADGRPLVLRGRHVFDSRPVRDTP
                     PHRTLLLQHFRGWFVRTAVPRFDPGVADLMDFRVPQPGHGLAFGYVLPLAADRALVEY
                     TEFSRAPLPTAAYEASLRQYTGDVLGLGRFTVESAEQGVIPMTDARFPRRAGRAVFRI
                     GAAGGATRPATGYTFAAVQRQGRAVASALGRGRPDVPPPHGRRALAMDAVLLRALDTG
                     RVDGPRFFTDLFRRVPMERLLRFLDGGSTPWEEFGIGLRTPVGPMLRTAAELPFLVRR
                     ATGRSEESL"
     gene            404343..405077
                     /locus_tag="SFLA_RS01680"
                     /old_locus_tag="Sfla_0351"
                     /db_xref="GeneID:11369997"
     CDS             404343..405077
                     /locus_tag="SFLA_RS01680"
                     /old_locus_tag="Sfla_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis methyltransferase UbiE"
                     /protein_id="WP_014152492.1"
                     /db_xref="GI:503918498"
                     /db_xref="GeneID:11369997"
                     /translation="MTLLRDHDLARAFDHASLTYDRLTALNPGYRSDLLRSAHRLRLP
                     RGGRGLRLLDLGCGTGASTRALLRAAPYARITAVDASAGMLERARAKRWPANVRFLHR
                     SAEELPTTDDDGSYDAVFAAYLFRNVAEPGEVLRAVRALLRPGGRLLAHEYSLSGSRV
                     HRAVWNTVCRGVIVPAGTLTGDRELYHHLWRSVLAFDTAPAFARRVARAGFPFVRTVP
                     VGGWQTGIVHAFLARNGADPVRTDAA"
     gene            405074..406636
                     /locus_tag="SFLA_RS01685"
                     /old_locus_tag="Sfla_0352"
                     /db_xref="GeneID:11369998"
     CDS             405074..406636
                     /locus_tag="SFLA_RS01685"
                     /old_locus_tag="Sfla_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isorenieratene synthase"
                     /protein_id="WP_041825278.1"
                     /db_xref="GI:754214652"
                     /db_xref="GeneID:11369998"
                     /translation="MSARGGRPGAARHGRDRRAEVIVPEPGRERFTGDAPSAAVIGGG
                     VAGLAAATALAERGVRVTLYEQGESLGGRLAGWPVRLGDGSSATMSRGFHAFFRQYYN
                     LRGLLRRTDPALSMLTSLPDYPLLHRNGMADGFARVPRTPPWSALGFVALSPSFGLRD
                     LAAMNPREALPLLDVRVPEVYERFDGVGAEDFLRRIGFPEAARHLAFEVFSRSFFADP
                     RELSAAELLLMFHIYFLGSSEGLLFDVPREPFPQALWEPLGGHLRGLGAQVRTGTPVH
                     RVRPATGGDLTVETEGAVDRHQAVVLALDTQGLRHVVGASEQLGDASWRAGVESLRTA
                     PPFLVSRLWLDRPVREDRPGFLGTSGFDGLDNISVLDRWEGESARWAARTGGSVVELH
                     AYAVDGGTEREKVQRRMLDRLNEIYPETAAARIVDVRHEWRDDCPVFSVGGYRHRPAV
                     RTPHPRVTLAGDMVRTGLPVALMERAATSGFLAANALLAGWGIRGQVLWTVPRAGRSR
                     VLRTLAGRFAAP"
     gene            complement(406640..407647)
                     /locus_tag="SFLA_RS01690"
                     /old_locus_tag="Sfla_0353"
                     /db_xref="GeneID:11369999"
     CDS             complement(406640..407647)
                     /locus_tag="SFLA_RS01690"
                     /old_locus_tag="Sfla_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S ferredoxin"
                     /protein_id="WP_014152494.1"
                     /db_xref="GI:503918500"
                     /db_xref="GeneID:11369999"
                     /translation="MNGPRARTMWTSPLRVRRVPRWDRQAPTWREAKPAVIAEALKRS
                     AARPSGNWYVVGASRELEARDRPYGRTIAGTEVVLWRTGDGELRAGPGECPHLGAPLR
                     EGRVACGTLLCRWHGLGLDGGPFVGWEPYPLHDDGVLVWVRLDRAGGETPLDRPVVPA
                     RPLPGAAVDAVYTAVGRCEPEDVVANRLDPWHGSWFHPYAFVGLRVAGTPEDGEDDAF
                     AVDVSFKVAGRLVVPVRAEFTAPGPRTVVMHITDGEGTGSVVETHATPLTAPGAAEPR
                     TAVVEAVVAASDRRGFALARAAAPVLRPLMRRTAGRLWRDDLAYAERRWSLRSTGRFP
                     G"
     gene            complement(407644..408630)
                     /locus_tag="SFLA_RS01695"
                     /old_locus_tag="Sfla_0354"
                     /db_xref="GeneID:11370000"
     CDS             complement(407644..408630)
                     /locus_tag="SFLA_RS01695"
                     /old_locus_tag="Sfla_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene synthase"
                     /protein_id="WP_014152495.1"
                     /db_xref="GI:503918501"
                     /db_xref="GeneID:11370000"
                     /translation="MSRRELDAAGISGPDLRDAYARCRKLNARHGRTYFLATRLLPVE
                     RRCAVHALYGFARWADDIVDDLDRGQSPEERDRLLRLLESDLVHGLRTGGGGQPVVRA
                     VADTAGRYAIDHGLFADFLASMRSDLTVTDYPTYADLRAYMHGSAAVIGLQMLPVLGT
                     VVPREEAAPHAAALGVAFQLTNFLRDVGEDLDRGRVYLPADLLAAHGVDRPLLEWSRR
                     TGRHDPRIRNAFVEADAVIRTVYREAEPGIAMLEPRVRPCIRTAFVLYRGILDAVAAD
                     DYRVVHRRSVVPRRRRAVVAAAGLARILGARVRTRTTAPEPGVVAGAEGSLR"
     gene            complement(408627..410165)
                     /locus_tag="SFLA_RS01700"
                     /old_locus_tag="Sfla_0355"
                     /db_xref="GeneID:11370001"
     CDS             complement(408627..410165)
                     /locus_tag="SFLA_RS01700"
                     /old_locus_tag="Sfla_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase"
                     /protein_id="WP_014152496.1"
                     /db_xref="GI:503918502"
                     /db_xref="GeneID:11370001"
                     /translation="MRTVPGATDHVVVVGAGLSGLAAALHLLGAGRRVTLVERDAGPG
                     GRAGRLELGGYRVDTGPTVLTMPHLADEAFAAVGDSLHRRVELIPLHPAYRARFADGT
                     GIDVHTDGDAMEAEVRSFAGDAEAAGYRRLRRWLERLYRAQMSRFIDTNFDSPFQLLH
                     PDLARLAALGGFGRLDPQIGRFLSDPRLRRVFSFQALYAGVAPARALAAYAVIAYMDT
                     VAGVWFPKGGMNALPRAMADAAADAGGEFRWSAEVEALERSGGRVRAVRLATGERIAC
                     DAVVLTPDLPVVHRLLGRAPRRPVPLRHAPSAVVLHAGTDRTWPELAHHTLSFGAAWE
                     HTFDELTRTGRLMSDPSLLITRPTTHDPSLAPPGRHLHYVLAPCPNTTTGPSAGTWRG
                     GLGERYRDSLLAVLERRGLHGFASSLDRELLVTPADWTAQGHAAGTPFSVSHTFAQTG
                     PFRPRNLVRGYDNVVLAGCGTTPGVGVPTVLLSGKLAAARITGLARTTAARRRPPVLE
                     GQSR"
     gene            complement(410162..411340)
                     /locus_tag="SFLA_RS01705"
                     /old_locus_tag="Sfla_0356"
                     /db_xref="GeneID:11370002"
     CDS             complement(410162..411340)
                     /locus_tag="SFLA_RS01705"
                     /old_locus_tag="Sfla_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranyl pyrophosphate synthase"
                     /protein_id="WP_014152497.1"
                     /db_xref="GI:503918503"
                     /db_xref="GeneID:11370002"
                     /translation="MLGPGAMRAGTGGGAGPEPGTRGHRVPGTVGGTAAAVDAVLAEH
                     LRTRLGEARRTDAVFADEVASRVAAFVLQGGKRLRTAFVRCGWLAAGGSGDPGTPLRV
                     GAALELLQACALVHDDVMDESPVRRGAPAVHAQFARLHREGRMRGSATSYSATAAVLA
                     GDLALVWADDLLTETALSSPYGGHLHREWQAMRGEMVAGQYLDMRAQATGSSDETQAR
                     NIATLKSALYTVERPLALGACLAGAGAPVMDALRSAGRCAGLAFQLHDDLLGAFGDPA
                     VTGKPADEDLRTRKLTGLLAAALRLAGESGDTDALAVLGHQGPEPGGGTADRMRAALE
                     RTGARAAVEEEIARLSASSLRHFADTGADDRAQEEFAALVARAAGTAAPLPVPGGEGA
                     "
     gene            complement(411503..411991)
                     /locus_tag="SFLA_RS01710"
                     /old_locus_tag="Sfla_0357"
                     /db_xref="GeneID:11370003"
     CDS             complement(411503..411991)
                     /locus_tag="SFLA_RS01710"
                     /old_locus_tag="Sfla_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015580016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymuconolactone decarboxylase"
                     /protein_id="WP_014152498.1"
                     /db_xref="GI:503918504"
                     /db_xref="GeneID:11370003"
                     /translation="MNGTEADRAHKRVYVDKRSPKAYHALTATAEAVRAVAQEAGLER
                     TLVELVNLRVSQMNGCAYCLDVHTRAALREGETTRRLGVLAAWRDTEVFTTQERAALA
                     LAEATTHPADAALQEDAYATARRTLSEDEISAVIWVAVTINAFNRVSIMSKHPVRGVP
                     RQ"
     gene            412115..413092
                     /locus_tag="SFLA_RS01715"
                     /old_locus_tag="Sfla_0358"
                     /db_xref="GeneID:11370004"
     CDS             412115..413092
                     /locus_tag="SFLA_RS01715"
                     /old_locus_tag="Sfla_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_014152499.1"
                     /db_xref="GI:503918505"
                     /db_xref="GeneID:11370004"
                     /translation="MSGVDTDRVAPQTDPGPGVEVLTPRDVPLGGPRAMTVRRTLPQR
                     ARTLIGAWCFIDHYGPDDVAETGGMDVAPHPHIGLQTVSWLFSGEIEHRDSLGSHAFV
                     RPGELNLMTGGHGISHTEVSTPGTALLHGVQLWVALPDAHRHTGRDFRHHVPAPVHLD
                     GAVIRVFLGSLAGDTSPVPAFTPLLGAEIVLEPRTTTTLDIDPAFEHGLLVDQGSVRL
                     DGTLLRGAELGYTATGNRTMTLANETDVPARAVLVGGTPFEERIVMWWNFVGRTHEDI
                     VEARQDWEASSDRFGHVDGYPGARIPAPALPNATIAPRGNPTRPKGSTR"
     gene            413089..413427
                     /locus_tag="SFLA_RS01720"
                     /old_locus_tag="Sfla_0359"
                     /db_xref="GeneID:11370005"
     CDS             413089..413427
                     /locus_tag="SFLA_RS01720"
                     /old_locus_tag="Sfla_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_014152500.1"
                     /db_xref="GI:503918506"
                     /db_xref="GeneID:11370005"
                     /translation="MTQADAPLVRNVDARHRYEILAGEVTAGFTAYRDRDGQRVFFHT
                     EIDDAFAGQGLASVLVQEALSHVRDTGRRIVPVCPYVAKFLKKHEEFADITDPVTPEI
                     LQWLDTALAR"
     gene            complement(413449..414987)
                     /locus_tag="SFLA_RS01725"
                     /old_locus_tag="Sfla_0360"
                     /db_xref="GeneID:11370006"
     CDS             complement(413449..414987)
                     /locus_tag="SFLA_RS01725"
                     /old_locus_tag="Sfla_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_014152501.1"
                     /db_xref="GI:503918507"
                     /db_xref="GeneID:11370006"
                     /translation="MAFFDNPVIPGFSPDPSMCRVGEDYYVATSSFEYVPGVPLWHSR
                     DLVHWRLIGHALDRPSQLTLPDDAPSSCGVYAPTLRYHDGRFWMITTVVAGAGNILVT
                     AEDPAGPWSEPVPVGIPGIDPDLAWDDEGNCWCVFSHDGIRGVRIDPETGELLGEPVE
                     MWSGSGLQYPEGPHLYRIGDWWYLLLSEGGTERGHAMSVARARSLPGPFEPHPDNPVL
                     SHRSTGHPVQNTGHGDLVRAHDDTWWMVLLGTRPRGDTPKFHGMGRETFLVPVRWEDE
                     WPLPGPLELRAEAPRLAPHAWPAEPHRDDFDAPALAPCWVSLRRQDPDAVRLGERPGH
                     LVLRARADGMDRPGALFVGRRQRDADCVARTRIDVGDEGRGGIAVRLDEAHHYQVEVE
                     GGTVRAVARIGPSRTTVAERRVPAGPLTLRVDVTTEDVLPPTVTVRPADPDAEAPSGL
                     RVGGPDTLRLGYETEDGHVEVLAELDGRYLTTEVAGGFTGRVIGMYATRGEAAFDWFE
                     LRPA"
     gene            415477..417336
                     /locus_tag="SFLA_RS01730"
                     /old_locus_tag="Sfla_0361"
                     /db_xref="GeneID:11370007"
     CDS             415477..417336
                     /locus_tag="SFLA_RS01730"
                     /old_locus_tag="Sfla_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_041825554.1"
                     /db_xref="GI:754215109"
                     /db_xref="GeneID:11370007"
                     /translation="METPPPPPPATITFEGKHGKNPLAEASFGALCMRLPSILAHTAR
                     RAWAVDRTGSVLLLVCQLLTGTAAALVLAFTARAMTHLLATGPVSERLHSALPALAVV
                     ATAAGFGRVSAALSSYADARITPLLTTEADLSLVSAVCRVEASAYGEDGFADRQEAAE
                     VGVTRTRTMVQDAQRFMAALIRMVAATGVITALHWMMLPLLLLAVLPAGLGAVLSARV
                     DYETHYHNVGDRNVRSMMRWWATYSRYGDEVRANGMTGYLIHWYRALSDRIDRRTLTA
                     APRMLRIVLATSALGGVFLLGTWAVLAWLAVSGRVALPVAATAVVAVQTALAALSQFV
                     VHGAAMFHTSLYLADMRSFLDMADERAPKRGTATVPDRVDEIRLDEVVHRYPGRDEPA
                     VAGVSLTLRRGEILAVVGENGSGKSTLAKLITGILLADKGRVLWDGTDLADADPEAVW
                     RRTALVPQNFACWPLRARENVTLGQPRTYDDGPVWEAVDAVGMRETVEKLPHGLDTLL
                     ARELWGGAELSGGQWQRLACARALYRRTPLLILDEPTSQMDPRGEHRIFLEVRRIAAE
                     RMTVVVTHQLENTRLADRIVVMRAGRVVEQGTYEELAHAGGLFAELVALAQDR"
     gene            417436..418332
                     /locus_tag="SFLA_RS01735"
                     /old_locus_tag="Sfla_0362"
                     /db_xref="GeneID:11370008"
     CDS             417436..418332
                     /locus_tag="SFLA_RS01735"
                     /old_locus_tag="Sfla_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152503.1"
                     /db_xref="GI:503918509"
                     /db_xref="GeneID:11370008"
                     /translation="MDGIPVEHPDTAPPPWPNQVLGFPPGARLLLVNCDDFGMHPAIN
                     AAVVESIEEGIAASCSLMTVCPAAADAMRLLRRHSAIPFGVHLTLVCESSHLRWGPLS
                     PANTVPSLLDPSGTFFEPTPAGRAALLGRARTDEIETEFRAQIDAVADAGLSPTHLDF
                     HCLADGGRADILDLTVGLAAEYGLAVRVWLDPGRREMRRRGRPVVDHDFLDSFSLPTE
                     GKAEHYRRLLHDLPAGLSEWAVHPAAGRGAETLDGGRPVRRTDHAFLTSPEAREAVAR
                     EGVTVIDYRALQRVWARNTDRG"
     misc_binding    418406..418627
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            418786..421104
                     /locus_tag="SFLA_RS01740"
                     /old_locus_tag="Sfla_0363"
                     /db_xref="GeneID:11370009"
     CDS             418786..421104
                     /locus_tag="SFLA_RS01740"
                     /old_locus_tag="Sfla_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_014152504.1"
                     /db_xref="GI:503918510"
                     /db_xref="GeneID:11370009"
                     /translation="MTTEHTTAATRSTVYGYPRQGQNRELKKAVEGYWKGRVTADALR
                     ATAAGLRRDTWRQLSEAGIDEVPTGDFSYYDHVLDTSVMVGAVPDRHREAVAADPLDG
                     YFAMARGTQDAAPLEMTKWFDTNYHYLVPELGPDTVFAANSAKQVAELDEAVALGLTA
                     RPVLVGPVTYLLLAKPAPGVAADFEPLTLLDRLLPVYAEVLADLRAAGAEWVQLDEPA
                     LVQDRTPADLDAVARAYTQLGGLADRPGLLVASYFDRLGDALPVLARTPIDGLALDFT
                     DAAAANLDDLAAAGGLPGRRLVAGVVDGRNIWINDYEKSLATLTTLLGLAGRVDVATS
                     CSLLHVPLDTAAEEEIDPEILRWLAFARQKTAEVATLARGLAEGTDAIAAEIAANRAD
                     LTSRADSPVTYDPAVQARADAVTDADGRRSQPYEVRAAAQRAHLGLPLLPTTTVGSFP
                     QTDELRAARADLRTGRTDSAGYDERIRKEIAEVISYQERTGIDVLVHGEPERNDMVQY
                     FAERLSGYLATRHGWVQSYGTRYVRPPVLAGDISRPEPMTVGWTTYAQSLTDRPVKGM
                     LTGPVTMLAWSFVRDDQPLGDTARQVALALRDEVDDLESAGISVIQVDEPALRETLPL
                     RAAGRPAYLAWATEAFRLSTSGVRPDTQIHTHMCYAEFGDIVQAIDDLDADVISLEAA
                     RSHMQVAHELADHGYPREAGPGVYDIHSPRVPSVRETASLLRTGLAAIPSERLWVNPD
                     CGLKTRGWPETRASLENLVAAARTVRDELSAH"
     gene            421438..422265
                     /locus_tag="SFLA_RS01745"
                     /old_locus_tag="Sfla_0364"
                     /db_xref="GeneID:11370010"
     CDS             421438..422265
                     /locus_tag="SFLA_RS01745"
                     /old_locus_tag="Sfla_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_014152505.1"
                     /db_xref="GI:503918511"
                     /db_xref="GeneID:11370010"
                     /translation="MASVPAITLNNGVEIPQLGFGTFQIPPQETRETTLAALKAGYRH
                     IDTAQMYGNEKEVGEAVRDSGLDRGDVFVTSKLDNGAHAYDDALHAFEGTMEKIRLDY
                     LDLFLIHWPLPDRGDFVETWKALEEIYRSGRVKSIGVSNFQPHHLRRLLDGSVVVPAV
                     NQIEVHPYLTQDAVRSFGAEHGIATEAWSPIAQGKVLDDPTLVRIAERVGKSTAQVTL
                     RWHLQRGDIVFPKSVTRRRIEENFDLFDFELTEGDIGEINALNRDERTGLDPDRFNG"
     gene            complement(422343..424691)
                     /locus_tag="SFLA_RS01750"
                     /old_locus_tag="Sfla_0365"
                     /db_xref="GeneID:11370011"
     CDS             complement(422343..424691)
                     /locus_tag="SFLA_RS01750"
                     /old_locus_tag="Sfla_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152506.1"
                     /db_xref="GI:503918512"
                     /db_xref="GeneID:11370011"
                     /translation="MRWTQWIRGAGTAAAAAALLGGAVAAPASADGAGHAGRGRLTDL
                     VNPFIGTENEGNTYPGAAVPFGMVQFSPDTGHNTGYDYSETHIRGFSTVHISGVGCGL
                     GGDLPVLPTTGDITSTDNAVYAAGFSHDDEKAGPGTYQVGLDTGIKAELSATERTGVQ
                     RYTFPATDKANVLINAGQSLHRTVNTEVEILDDRTVRTAITGSGFCQDTKPYTVYTVT
                     RFDRPFTVSGTWKGETVTEGSTASSAGAERNGAFVRFDTSKDRTVEATTAISYVDAKG
                     AALNLRAEGGRSYDRVARAAQAAWEDRLDDVRAKGGSETLRRTFYSSLYRSFLAPNIG
                     SDVDGRYTGWDQRIHKAKGFTYYQNWSLWDTYRTQAQLLSLLAPHESRDMAISVIKID
                     EDSGWLPKWGYGTVETNIMTGDPVTPFLTNAYQQGLLKGYEEQAYRALRKNADGVPPA
                     DSAPVGREANKEYLADGFAPYIKGRAHVKPGDSDYDHGASATLEYALSDAMLGRMAKE
                     LGHDQDAARYAERAQNYRKIFDSSTGFFRARDANGDFTGPADPARSEGFHEGTSWQYQ
                     WLVPQDLPGMVSLIGGTDAANGRLDSFFAYEQLLQDPSKTAREVWVNGPYDYYNADKY
                     NPQNEPDLIAPYTYLSTGQPWKTTDVVHAALTLFTDTPIGMTGNDDLGTMSAWNVLSS
                     IGVFPVQPGTDTWGLSTPVFERVDLTLDRRYYPEGALTVKAPGTSDSARYIRSARTDG
                     AAYGKTYLTTEDIRRTRELSFEVGTMPSGWGTSADAAPPALK"
     gene            424888..426054
                     /locus_tag="SFLA_RS01755"
                     /old_locus_tag="Sfla_0366"
                     /db_xref="GeneID:11370012"
     CDS             424888..426054
                     /locus_tag="SFLA_RS01755"
                     /old_locus_tag="Sfla_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ser/Thr phosphatase"
                     /protein_id="WP_014152507.1"
                     /db_xref="GI:503918513"
                     /db_xref="GeneID:11370012"
                     /translation="MSPYRTTTGLTSHAPQNESELLPWWARIAPLALVVLALAVDLPT
                     PGAFSGDVFLILSSMIAACVYALRAVVRVAVLNSLAGLVLLFGKHLSSDGRHAVVDYI
                     AMVVLAWATVPLSRLRLSLRRRLQGAERVAESAQRAVLPPVRAWWGKTWIAVRYEAAS
                     AAASVGGDLYAAEHTPYGVRLLIGDVRGKGLNAIPGVAALVGSFHEAAHHTPTLPELA
                     RHLDEAVSRHTRETASVSGGSDVDGEHFITAAIAQIPDDGTEVRLISRGHCPAFLVSE
                     DALRVWEPEHAGLPLGLGELDTGPWQDESRPFGPGHLLLLCTDGLLEARDADGRFYTP
                     GEDLRQCWRDGPPAVVERLAGAVHTHTDGVLADDLALVAVTRVEHAPSGGKASP"
     gene            complement(426092..426691)
                     /locus_tag="SFLA_RS01760"
                     /old_locus_tag="Sfla_0367"
                     /db_xref="GeneID:11370013"
     CDS             complement(426092..426691)
                     /locus_tag="SFLA_RS01760"
                     /old_locus_tag="Sfla_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C60"
                     /protein_id="WP_014152508.1"
                     /db_xref="GI:503918514"
                     /db_xref="GeneID:11370013"
                     /translation="MPFTPNSSWRTALSAAAAGLLITLAGCSAPDAPEPSTGAKASPA
                     ARDADVPKAPAPTRLSVPSLGIDSGLLRLGLNEDGTVEVPPAEKGMTAGWYAGGAVPG
                     EPGAAVLIGHNDTRFGKAVFHDLHSITKGADIAVAGGGGKETHFTVTGTETVRKDEFP
                     TDKVYGATGERVLRLITCDGEFDAAGHPVDNLIVYATLR"
     gene            complement(426779..427165)
                     /locus_tag="SFLA_RS01765"
                     /old_locus_tag="Sfla_0368"
                     /db_xref="GeneID:11370014"
     CDS             complement(426779..427165)
                     /locus_tag="SFLA_RS01765"
                     /old_locus_tag="Sfla_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152509.1"
                     /db_xref="GI:503918515"
                     /db_xref="GeneID:11370014"
                     /translation="MSLRPTLRTAVLAAATMGAVLFPSMAAVADSSPTAVPAERPTEP
                     PAASEPSRATPVPEPTDAAESATPAPAEPVPARTVPRGGVDAGERPAGEAGGTALHGS
                     AAGAVLLAGAGVLVMRRRTAAQRDHG"
     gene            complement(427267..429288)
                     /locus_tag="SFLA_RS01770"
                     /old_locus_tag="Sfla_0369"
                     /db_xref="GeneID:11370015"
     CDS             complement(427267..429288)
                     /locus_tag="SFLA_RS01770"
                     /old_locus_tag="Sfla_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014152510.1"
                     /db_xref="GI:503918516"
                     /db_xref="GeneID:11370015"
                     /translation="MARRADKGGQRLRPPLRKSLLGRFLAVSALVAACSVAATAWLAV
                     QTTSGAIEQEQGRNLAADTRVLDTLLAYAARHPTWDGVGATVDELADASDRRITLTTQ
                     SRQILADSAGSSPPPPSLPPQASAVVDPLSVADVSSGSGSGAGSVTIAAPGTDGTQRP
                     GTDRVDPRAVGPFELSEAERTSLRRTADEAVQCLSRTGIASDVVEGPSGRPRIQVVGN
                     DPDRLDGSRCSTDALDRPTGTEAKALVALNELVNACLDRQGREAVELDLDLSWRTGEE
                     PLPATAVPVPTPAPSLSVPREAMPTEVATPAPLDSDNDRDIASCVGIARQEQLSSYVA
                     SPALLFISDPGGGEVPGFDLSPGNTAKITGVAALVLALTVGASVFAGVRLVRPLHALT
                     GAAQRMRDGEAPSQVVVAADNEIGRLATAFNDMSAHRARMEEQRKVMVSDVAHELRTP
                     LSNIRGWLEGAQDGVADADATFVSSLLEEAVQLQHIIDDLQDLSAADAGALRLHPEPV
                     RIGDLLAHVVAAHQAQADAAGVDLTVTVAEEHGAVPVVEADPVRLRQAIGNLVSNAVR
                     HTPAGGRVTLRAHATGPGGPDDEVLLEVADTGSGIAPEDLPYVFDRFWRAEKSRSRRT
                     GGSGLGLAIVRKLVEAHGGTAGVVSTVGRGSVFTLRLPCSGPDPMNTAA"
     gene            complement(429269..429997)
                     /locus_tag="SFLA_RS01775"
                     /old_locus_tag="Sfla_0370"
                     /db_xref="GeneID:11370016"
     CDS             complement(429269..429997)
                     /locus_tag="SFLA_RS01775"
                     /old_locus_tag="Sfla_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate regulon transcriptional regulatory
                     protein PhoB"
                     /protein_id="WP_015579995.1"
                     /db_xref="GI:505392893"
                     /db_xref="GeneID:11370016"
                     /translation="MCANVIVAEDDAKQAELVRRYLEREGHAVTVVSDGLSALEQARQ
                     GAPDLLVLDVMMPRADGLDVVRILRAEERELAVLMLTARATEDDLLLGLDLGADDYMT
                     KPYSPRELMARVRTLLRRTRRDGAREDGGQVLRVGTLAVDPVRHEVSVDGVGVECTPG
                     EFRLLATMAAEPERVFSREQLLAELHGFDRYISSRTVDVHIMNLRKKIERAPRRPVRL
                     LTVFGVGYKLMDPQKGATRGAARR"
     gene            430265..430543
                     /locus_tag="SFLA_RS01780"
                     /old_locus_tag="Sfla_0371"
                     /db_xref="GeneID:11370017"
     CDS             430265..430543
                     /locus_tag="SFLA_RS01780"
                     /old_locus_tag="Sfla_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152512.1"
                     /db_xref="GI:503918518"
                     /db_xref="GeneID:11370017"
                     /translation="MTRDAEWRTGPDGRAVLLVAGLADLAVTTAGSALGAVRGLLRRS
                     DTAELAAEAERDLIARGRLVLGRWSTAPPAHLEVLAREAVVRRAADDA"
     gene            430533..431588
                     /locus_tag="SFLA_RS01785"
                     /old_locus_tag="Sfla_0372"
                     /db_xref="GeneID:11370018"
     CDS             430533..431588
                     /locus_tag="SFLA_RS01785"
                     /old_locus_tag="Sfla_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="WP_014152513.1"
                     /db_xref="GI:503918519"
                     /db_xref="GeneID:11370018"
                     /translation="MTHDRWDMAEFKERVDDVLRVFVAREAERFAAVDPVLDPVAGQL
                     ESSAAHGKRLRAAFCYWGWRATGQPDDESLVRAAASMELVHAAAVVHDDLIDDSPLRH
                     GLPTAHMALRGAARGRPRSVSAGRSLAMLVGDLLMGLAGQLFATSGLPAAYLARARPL
                     WSALARDLIAGECLEILRTGAAPDTADSLKVIRYKTAKYTVEQPLLIGGALAGAGERV
                     RSGYSAYGLPLGEAFQLRDDLVGLFGSPQDTGKAATDDLRGNRPTALLAETWRVADDG
                     ERRQLRALLGRGDPGPDGLRAARELMLRLDAPGRVEKMITERVEEALTALDALSLSTP
                     ATTALTTLAHSVAVRGA"
     gene            431715..432893
                     /locus_tag="SFLA_RS01790"
                     /old_locus_tag="Sfla_0373"
                     /db_xref="GeneID:11370019"
     CDS             431715..432893
                     /locus_tag="SFLA_RS01790"
                     /old_locus_tag="Sfla_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152514.1"
                     /db_xref="GI:503918520"
                     /db_xref="GeneID:11370019"
                     /translation="MRYTESSLDTMRRAGDELADATVATLFERGEVGKFNTLMRYVST
                     AGAPLPDGLPDVAREYLEVTGAPPAWVDWGEMERARLFFIDNNVHISTALSFASMPAC
                     YVVPHVAKLLSATHGLDYPSKRMAETGQFTVHLMQPDAFEAGGRFLPAAQKVRLLHAS
                     IRHHLEREGRWDTAALGTPICQEDMIGGQMFFSLLVLDSLHRLGVHMSEEGARSYYYA
                     WRVVGAMLGVDQDAVPGTLDEARHFLDLYMLRHMGPSPEGAHLTRQLIDLYEEVVPGT
                     FFDPVVSALVRHLVGDICGDWLGVPRTSWDTLVKAVPRLIGVLETVEDRSPLGAWALD
                     RLGHLTTVLELSSLTRGRVMHYAIPEHLKKDYGVAGSVPRTRRWVPPAPTVRGRAPGQ
                     "
     gene            complement(433050..434342)
                     /locus_tag="SFLA_RS01795"
                     /old_locus_tag="Sfla_0374"
                     /db_xref="GeneID:11370020"
     CDS             complement(433050..434342)
                     /locus_tag="SFLA_RS01795"
                     /old_locus_tag="Sfla_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152515.1"
                     /db_xref="GI:503918521"
                     /db_xref="GeneID:11370020"
                     /translation="MTTAPPAGPAAPPRALPALFAPSPTSAPRPEAPSLPPVRRTPLV
                     VSGLLAVALTVYVWSVHGAKPGVLLLLGLGLGVALFHSRFGFTSAWRQLIAVGNGTGL
                     RAHALLLGTTATLFALLIGSGTGLFGSQPAPSAGPIGVGLVVGSLLFAVGMQLGGACA
                     SGTLFAVGSGQTSVLLTLGGFIAGATLAAWQFDLWKDLPAWEPVVLSEHIGWAGSWAV
                     TIAALLLVVLVTRRVQARRNPPPLGPVPSARTAAVRALRGSWPLAAGALVLAVLGAGV
                     LAVSGGAWGVTSAFSLWGSELVGALGGHPENWTWWRQPGNAEMLAGPVLADKTSLTDI
                     GIMIGAAVAAALGGTWALHRGIPWRTAVASVLGGVLMGIGARLAGGCNIGAYLAGVAS
                     GSLSGWLWGAVALAGTWLGLRLRPLFGLGNPKPGDGVC"
     gene            434850..435737
                     /locus_tag="SFLA_RS01800"
                     /old_locus_tag="Sfla_0375"
                     /db_xref="GeneID:11370021"
     CDS             434850..435737
                     /locus_tag="SFLA_RS01800"
                     /old_locus_tag="Sfla_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014152516.1"
                     /db_xref="GI:503918522"
                     /db_xref="GeneID:11370021"
                     /translation="MSGSARPLQGRVAVVTGAARGVGAAMARELTRRGARVALLGREE
                     STLAQVRETLPGARCWEVDVTDDAGMGRVADEVRDRMGPASVVVANAGLAEGGPFAES
                     DPVTWRRVIEVNLIGSAISARAFLPHLRTTGGYYLQIASLASIGAAPMMSAYCASKAG
                     VESFAHSLRAEFAHEHVGVGIAYLNWTDTDMIRDADEHPVLRELRAHMPKPARKVYPV
                     ETVAESLARAVERRSASVYAPAWLRVTQLVRAAMPPVVTALSKREIPRLQRETSFEGT
                     GLLGAGGRADLGAGGRAGG"
     gene            435871..436509
                     /locus_tag="SFLA_RS01805"
                     /old_locus_tag="Sfla_0376"
                     /db_xref="GeneID:11370022"
     CDS             435871..436509
                     /locus_tag="SFLA_RS01805"
                     /old_locus_tag="Sfla_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_014152517.1"
                     /db_xref="GI:503918523"
                     /db_xref="GeneID:11370022"
                     /translation="MPPQTSTPRYTVPGLSTKDGGRMIDVLRMRLHALNDLALTLKHI
                     HWNVTGPHFIAVHEMLDPQTLAVRDMADGTAERISALGGVPHGTAGVLVSERTWEDYS
                     VGRADAIAHLGALDLVYTGIIEDHRKAAAKAASLDPVTEDLLIEHLRSLEQFQWFVRA
                     HLENSAGVLATTDARSEKQAAAAAGTSRTIPAKQTASPRRTAKKSAVTKRGK"
     gene            complement(436786..438162)
                     /locus_tag="SFLA_RS01810"
                     /old_locus_tag="Sfla_0377"
                     /db_xref="GeneID:11370023"
     CDS             complement(436786..438162)
                     /locus_tag="SFLA_RS01810"
                     /old_locus_tag="Sfla_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_041825556.1"
                     /db_xref="GI:754215112"
                     /db_xref="GeneID:11370023"
                     /translation="MTPGPPVRGVLAALAVTATLLTGLSAAPASAAATATGPITGLAG
                     KCVDVAGGAVANGTAVQLYDCNGTAAQQWTVGADGTIRALGKCLDVASGGTADGTKVQ
                     LWDCNGSAAQQWATPAARDIVNPQADKCLDVSGGSSANSTRLQIWTCTGAANQKWTAP
                     SAGGETPGPGAMAVAPYLYNGWGSPPSPTTVMNATGVKWFTLAFVLSNGYCNPQWDGN
                     RPLTGGVDQQTVNTVRAAGGDVIPSFGGWSGNKLESSCSSAGELAAAYQKVINAYGLK
                     AIDIDIEAAAYDSPVVQQRTVDALKTVKAANPGIKVYVTFGTGQNGPDSSLIGKAAAS
                     GLTVDSWTIMPFNFGGAGQNMGTLTVRAAEGLKTAVQNAYGYSDDQAYRHTGISSMNG
                     VTDNGETVTVADFRTILGYAQQRHLARLTFWSVNRDRPCTGGGADTCSGISQQPWDFT
                     RVLASYTG"
     gene            complement(438159..439439)
                     /locus_tag="SFLA_RS01815"
                     /old_locus_tag="Sfla_0378"
                     /db_xref="GeneID:11370024"
     CDS             complement(438159..439439)
                     /locus_tag="SFLA_RS01815"
                     /old_locus_tag="Sfla_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,3-beta-glucanase"
                     /protein_id="WP_014152519.1"
                     /db_xref="GI:503918525"
                     /db_xref="GeneID:11370024"
                     /translation="MRSPRLPRRLILSLAMALGLATMSTGLAQSAPTPVTTAAEQSAG
                     TTAAAAVTFSDEFDGAAGSAVNGAKWQIETGDNVNNHERQYYTAGNRNAVLDGQGHLV
                     ITARKENPGNYQCWYGRCEYTSARLNTSGKFSTTYGRVEARMKIPRGQGIWPAFWMLG
                     SDIGSVGWPNSGEIDIMENVGFEPGTVHGTLHGPGYSGSGGIGAGYSLPGGQAFADAF
                     HTFAVDWSPNAITWSVDGTVYQRRTPADLGGRQWVFDKPFFVILNLAVGGYWPGDPDG
                     STVFPQQLLVDYVRVSSDSGQPGGGGPITGLAGKCVDVAGGAVANGTAVQLYDCNGTA
                     AQQWTVGADGTIRALGKCLDVASGGTADGTKVQLWDCNGSAAQQWATPAARDIVNPQA
                     DKCLDVSGGSSANSTRLQIWTCTGAANQKWTVTR"
     gene            439919..440668
                     /locus_tag="SFLA_RS01820"
                     /old_locus_tag="Sfla_0379"
                     /db_xref="GeneID:11370025"
     CDS             439919..440668
                     /locus_tag="SFLA_RS01820"
                     /old_locus_tag="Sfla_0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030124504.1"
                     /db_xref="GI:662752933"
                     /db_xref="GeneID:11370025"
                     /translation="MNTAETGRHPLDSTSVMNAKRTVLELLGRAGMFPGEAEELVALV
                     EAGAIAGAHHEIGKPRDAPAGSGEAYGSGWRDGALATSDELGHAAERALERALGPALS
                     GSSGAVARDRHPVGRVDVERAKVAVIPLYLEFSDLSELDPEVSDEVLTAVLGTMNVVG
                     RVGYAGQLEQFTASGRERLARLYAHYGPRGHIAVHGRYSLLHSPTSIAVLERLAAAGP
                     ALRAEWEHAELPPAWLDGLATAWEASEAPPA"
     gene            complement(440719..442335)
                     /locus_tag="SFLA_RS01825"
                     /old_locus_tag="Sfla_0380"
                     /db_xref="GeneID:11370026"
     CDS             complement(440719..442335)
                     /locus_tag="SFLA_RS01825"
                     /old_locus_tag="Sfla_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014152521.1"
                     /db_xref="GI:503918527"
                     /db_xref="GeneID:11370026"
                     /translation="METDTVQQASATRAPGSAGGGWTTRGWLGAGSGAVLVLLLVLTA
                     GGGWVLAHATDVNKRLTDRWSPALIASVRMESALINQETGIRGYGMTGKREFLEPYQD
                     GVAQERAAARELARLTEGDERATADLTRVREDSERWQTTTARPVSEAAEPTASARQRT
                     ESGKSAFDALRASLTEQQNHIEAERDRARDDLQAARTLRNTAFTAIACVVLAVIALAF
                     AGLRRGVQLPLDRLRTDVRQVADGRFGHTITSSGPADLRALARDVDGMRRRLAGELEF
                     TDRARARLDEQATELRRSNEELEQFAYVASHDLQEPLRKVASFCQLLERRYANQLDDR
                     AKQYISFAVDGANRMQTLIGDLLDFSRVGRLHAEDTDVSIEAVLRRTTNSLGMVIEES
                     GAVITHDPLPAVHGDPTQLGVLLQNLISNAIKFRTPGEVPRIHLGAREQEDFADGAEG
                     AGPRWEFAVSDNGIGIGPEYAERIFVIFQRLHTRDTYPGNGIGLALCKKIVEYHGGTI
                     GLDTAHTPGTRFVFSLPSARQEASATGAVS"
     gene            442615..443256
                     /locus_tag="SFLA_RS01830"
                     /db_xref="GeneID:23391310"
     CDS             442615..443256
                     /locus_tag="SFLA_RS01830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_033249377.1"
                     /db_xref="GI:702730742"
                     /db_xref="GeneID:23391310"
                     /translation="MSRAVEECATLAARAAAQEGAGYPQLGRAWGVSRQGARKRWPGL
                     VFTARPASRPLPHDQTRSSLMNGLAPRTYTVLLVEDDMADAMLIEEALTEHGMARGIQ
                     RADDGVAALEYLRDPHTDRPDLIVLDLNMPRMNGRELLNVLKKDTALSSIPIVVLTTS
                     AAPDDVEDAYRQHANAYVTKPVNLDEFMQTVQSIDSFFLDTATTLPPHPGDEA"
     gene            complement(443328..447272)
                     /locus_tag="SFLA_RS01835"
                     /old_locus_tag="Sfla_0382"
                     /db_xref="GeneID:11370028"
     CDS             complement(443328..447272)
                     /locus_tag="SFLA_RS01835"
                     /old_locus_tag="Sfla_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_014152523.1"
                     /db_xref="GI:503918529"
                     /db_xref="GeneID:11370028"
                     /translation="MQHPSSPHQPVHPSRSVSRRRILEGGAAGFGALALSALPAVVSA
                     AATAHADPASAGWGPTANGHPEWNNNIAIFDIGSEPPHTTLMPYADVDAALTGDRTRS
                     PWRLDLDGTWKFAYADRPDGRDPDFHRTDLDDRSWDTVPVPSCWQLHGYDFPIYSNIT
                     YPWAGPNGLGEEAQPPYAPTRYNPVGQYRRTFTVPRSWDGRRVFLHFEGVKSAHYVWI
                     NGVPVGYREDSYTSAEYDITPHLRPGRNQIAVEVYRFSDGDWMEDQDMIRLSGIFRSV
                     HLFSTPTVHLRDFKLDTPLSDGWTAAELSVTASVRAYGDNPPGKGEYTVETQLYDAAG
                     HPVWSRPLRQTAGLGAARAGDDVTVRASKAVPKPALWSAEHPNLYTAVLRLRDPAGKV
                     TETLSHRVGFREFAIVDGLMRINGRPVSLRGTNRHEMHPDRGMSLTRADMVEDIGVVK
                     RLNMNTVRTSHYPNNPLWLELADEYGLYLVDETNLETHGIRDSYPGDHADWTEACVAR
                     ARNMVHRDKNHASAVIWSLGNEAGTGSAFVAMHDWIRAYDPTRVIQYEGDDRPALSDI
                     RSEMYTKPDQVEQRATDTGDTRPFVLIEYSHAMGNSSGNFKKYWDVIRAHDVLQGGWI
                     WDFADQALTWPTPTRTLFTETGPGEMTGELLAPSGRFDRDKGVSGGTVFRNDAGLDIT
                     GSLTLEAWITQKVTGRHQPILAKGDTQYALKQTDGSLEFFVHAAGRWTTASWALPQNW
                     TGTEHHVAGVFDAAAATLTLYVDGEAKATRTAAQRPDSNNAPVALATDADRPTREFSG
                     TVRRAHVYARALTAAELASGSRGPGDEGVRLWFDAATVGLEEVRPPEPTFRAYGGDFG
                     DNPNDGSFSADGIVLADRGHTGKAAEIKRILQAIDVTADGGGDPRRFTVTNEYLFTNL
                     RELDADWTVVADGKAVRRGRLTRAQLDIAPLSSKGITVPFTLPDRPAPGTEYFLELSF
                     TTREATKWAEPGFEVARQQLPLDAGSPAVKPRPLDSVRTLSRRDGDGSVTVTGHDFSV
                     QIDRRTGLITSWEAGGERLIISGPAPNYWRAPTENDIGNGQPARNGTWRHAGSDRKVT
                     GFEVRELRDRAVEIAVSGTLPTTTESAYTTTYTVFGNGEIKVDHTLHPGASGLPYIPE
                     IGSLLLLPGRLSHVHYYGRGPEENHWDRNNGTDVGLHSATVAEQWTPYVRPQENGNRT
                     DVRWVALTDGTGRGLLATGEPLLEVNASYFTPEDLSAGARHDYQLTPRKDVVLRLNHR
                     QMGVGGDDSWGAHTHDEYKLFADQDYAYTYRLRPLNGLDSATAASRRPTATE"
     gene            complement(447745..448785)
                     /locus_tag="SFLA_RS01840"
                     /old_locus_tag="Sfla_0383"
                     /db_xref="GeneID:11370029"
     CDS             complement(447745..448785)
                     /locus_tag="SFLA_RS01840"
                     /old_locus_tag="Sfla_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_014152524.1"
                     /db_xref="GI:503918530"
                     /db_xref="GeneID:11370029"
                     /translation="MTTVAAYAAPSAKAPLERTTVERRAVGEFDVLIDIKFAGICHSD
                     IHQARDGWGEGIFPMVPGHEIAGVVTETGSGVTKFAVGDRVGVGCMVDSCRECDNCKA
                     GLEQYCAKGNTGTYNALDKNGDPTYGGYSTHIVVDEKYTLRIPDGLALDEAAPLLCAG
                     ITTYSPLKHWNAGPGKKVAVVGMGGLGHMGVKIAHALGAEVTVLSQSLRKQEDGLKLG
                     ADHYYATSDPKTFETLRGTFDIILSTVSAPLDFGAYLSLLKTDGALVNVGAPEEPISV
                     NLFSLIGGRKSLSGSGIGGIQETQDMLDFCAEHGFGAEIELIGASEINEAYERVLNSD
                     VRYRFVIDAATI"
     gene            448956..449900
                     /locus_tag="SFLA_RS01845"
                     /old_locus_tag="Sfla_0384"
                     /db_xref="GeneID:11370030"
     CDS             448956..449900
                     /locus_tag="SFLA_RS01845"
                     /old_locus_tag="Sfla_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_030124507.1"
                     /db_xref="GI:662752938"
                     /db_xref="GeneID:11370030"
                     /translation="MEEQPVTEGHPVGDPRPGGNAGPALDRRAELSEFLRSRRARLKP
                     EDVGLPDFGRHRRVPGLRREELAQLAGVSVAYYTRLEQGNGQNVSGEVLAAIASALRL
                     TDAEQAHLSHLAKPKRHRKKPSARQQRVREALSRLLDTMDGVPAYVVGRRSEILAWNR
                     MAAAVFGDWSQLQPPERNWARLVFLDPEYRELFVEWDQKASDIVSYLRMDAGCHPDDP
                     RLSALVGELSVKSDEFRRLWARHDVKEKSHGVKRLHHPLVGELALGFETFTLPDDAEQ
                     SVVAYHAEPGSASAEALRLLASWGTDATRAGTSASGRQ"
     gene            449979..450797
                     /locus_tag="SFLA_RS01850"
                     /old_locus_tag="Sfla_0385"
                     /db_xref="GeneID:11370031"
     CDS             449979..450797
                     /locus_tag="SFLA_RS01850"
                     /old_locus_tag="Sfla_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014152526.1"
                     /db_xref="GI:503918532"
                     /db_xref="GeneID:11370031"
                     /translation="MQSPGSSPSSARSGPAAAPAQRGLLTERIARELEHDIRSGEIPV
                     GTKLPSERELAAQFGASRNVVREVLRRLEAQLLIEVAPGRGSFVREQTPGQARGYDAL
                     YRAGRPTVRQLIEARLPLEVETVRLATEHATDADIEVLRSARDTLESATDVVVKARAD
                     MAFHDAIAEASGNPVLRIMLSSISGMMFEMMLRSNSDPSIGEPGVPHHPEIFEAIEAR
                     DADLAGERMREHLMLGLRTYGKDLDIQVDVMARNHIEALLDETGNRYGAGGTGQ"
     gene            451000..452319
                     /locus_tag="SFLA_RS01855"
                     /old_locus_tag="Sfla_0386"
                     /db_xref="GeneID:11370032"
     CDS             451000..452319
                     /locus_tag="SFLA_RS01855"
                     /old_locus_tag="Sfla_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014152527.1"
                     /db_xref="GI:503918533"
                     /db_xref="GeneID:11370032"
                     /translation="MSTSSQLLSRRSFGRLAAGVAGAVGTGALTACTTGGGKPSADTP
                     LRIMAINHVWSQAIRRRTEEFEELIGRRVSMTLLTADQLASSYNVKLNASGTDVDVMM
                     VRALQEQLLFAHNGWLADLSDRVAQDEEFAWPDFQKAPRDASVSGGRVLSVPVVTERP
                     ALYYRKDLVEDHGGPPPTLEQLMATAQELTDKRKGFYGFVGRGQRSGAVSQWSSFLYS
                     HGGDFVVGGKSGIGTPEALAAYEYYGRLLARTGPPGATNMSLEQAMPIFAQGKAAFYV
                     DADAIYSSFLDPQVSTVRETVGFAPFPAGPAGARPHNIPSWSLGISTFSLLRDDAWEF
                     IRWAAGPEMTAELQKDGIPGARTSVWSDPRSLASFPPDLAEAMRLNAERGLGYDRPRV
                     LQVGRARDIVGRPLVAGILGNDVRPVARDADAEFAGFLVRDNRHKES"
     gene            452319..453278
                     /locus_tag="SFLA_RS01860"
                     /old_locus_tag="Sfla_0387"
                     /db_xref="GeneID:11370033"
     CDS             452319..453278
                     /locus_tag="SFLA_RS01860"
                     /old_locus_tag="Sfla_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014152528.1"
                     /db_xref="GI:503918534"
                     /db_xref="GeneID:11370033"
                     /translation="MSTTEVSPARPAAASGGGPAPARRPRTFEQANRRLKWAMLTPAL
                     LFVGLMIVFPLVYTVDLSLTDAFGAVNAGKGYVGLQNFADALGDTRRFWPAARRTLVF
                     TVGAVILETVLGLALAMLMRKPFRGMRWVRTVLIIPLLTTPVAIGILWLLILDPTNGI
                     ANHLLAGIGLPRQEFLGSVGQSLPTLMLIDVWQWTPMMTLLLLAGLTTLPEEPEEAAR
                     VDGANGWQRFRHIVLPMLGPTLATALVLRAVDALKTFDILYATKGAGGGSDFEVETLN
                     VYAYGLTFDYQEYGLAAAVLVLFTLFIIGVVVLLRRRGGRKTA"
     gene            453275..454129
                     /locus_tag="SFLA_RS01865"
                     /old_locus_tag="Sfla_0388"
                     /db_xref="GeneID:11370034"
     CDS             453275..454129
                     /locus_tag="SFLA_RS01865"
                     /old_locus_tag="Sfla_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014152529.1"
                     /db_xref="GI:503918535"
                     /db_xref="GeneID:11370034"
                     /translation="MSATVSPVPAAARLRRRTAGSWLRGITIGVVTLVFALPLVWMFA
                     AAFKTNVQVTDPSVGLWFSPTLENFRNVVEAGQILRSMGNSLLVGVVSTVLSAVIAVP
                     AAWAVGRFGMHRTGSLILVARIVPAISLLVPWYYLFAQMGLVGSYTVLILSQMFVSVP
                     LIMWIMISFFAGLPVELEEAARTDGLSAFGAFRRIALPLAAPGTATASLLAFVFSWNN
                     FMFALIFADDRTQTVPVTLFNFISYASTDWGGLMAAATLITVPVVLAAVLGQKYLVAG
                     LTSGATKG"
     gene            454168..455382
                     /locus_tag="SFLA_RS01870"
                     /old_locus_tag="Sfla_0389"
                     /db_xref="GeneID:11370035"
     CDS             454168..455382
                     /locus_tag="SFLA_RS01870"
                     /old_locus_tag="Sfla_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007456337.1"
                     /note="starvation-sensing protein; maybe involved in
                     homoserine lactone degradation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional D-altronate/D-mannonate
                     dehydratase"
                     /protein_id="WP_014152530.1"
                     /db_xref="GI:503918536"
                     /db_xref="GeneID:11370035"
                     /translation="MKIVDAKVLVTSPGRNFVTLKLTTDEGLTGLGDATLNGRELAVV
                     SYLEDHVVPLLLGLDPHRIEDTWQSLYRGAYWRRGPVTMAAIAAVDVALWDIKAKAAG
                     LPLYQLLGGASRDRVGTYGHANGRDIPELLDSVRARLAEGYPAVRVQSGIPGLKAVYG
                     VSSTADDGSPVLHQQARPLVEDWDTDAYLRHMPDVLEAVRAEFGPELPLLHDAHHRLT
                     PVQAARLGKELEPYHLFWLEDCTPAENQEALRTVRRHTTTPLAVGEVFNTVYDYQGLI
                     TEQLIDYVRSAVTHFGGVTPLRKLFDFAAQYQIKSAIHGPEDISPVGMAAAVHLDLAV
                     HNFGIQEYSGHTPLTEEVFRHAYTFEDGHLHPGEAPGIGVDLDEELAAAHPYEAAYLP
                     VNRLHDGSVHDW"
     gene            complement(455488..455991)
                     /locus_tag="SFLA_RS01875"
                     /old_locus_tag="Sfla_0390"
                     /db_xref="GeneID:11370036"
     CDS             complement(455488..455991)
                     /locus_tag="SFLA_RS01875"
                     /old_locus_tag="Sfla_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="WP_014152531.1"
                     /db_xref="GI:503918537"
                     /db_xref="GeneID:11370036"
                     /translation="MRLLLTSDTHLPERARELPPSLIEEMDTADVVLHAGDWVDVATL
                     DLFETRARRLVGVYGNNDGPGLRSRLPEVARVECGGLRFGVVHETGATRGREKRCADR
                     FPDLDVLVFGHSHIPWDTTAPGGLRLLNPGSPTDRRRQPYRTYMTAEVADARLTDVRL
                     HRIPPRT"
     gene            456376..458787
                     /locus_tag="SFLA_RS01880"
                     /old_locus_tag="Sfla_0391"
                     /db_xref="GeneID:11370037"
     CDS             456376..458787
                     /locus_tag="SFLA_RS01880"
                     /old_locus_tag="Sfla_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="WP_014152532.1"
                     /db_xref="GI:503918538"
                     /db_xref="GeneID:11370037"
                     /translation="MTAGNTERSADFRGPLDVTWAATVVVDAQDTVIGWSPAATRLLG
                     HPAHEIVGRPLGMFLSPGPPGSTPPLTTPFRGNEVRVARHRDGHELIVAATVCPLPGA
                     GTAARVLVMTELQDLRQWESRLALLHGLTTRSPVGLAIYDNDLRLTWCNAAFEDEIGR
                     PLAEFRGTRADELYLDGHFVTQGHPPTLDAVLRHVLDTGESFLDLHFQGRPPSDPETD
                     HLWSCAYYRLQDPDGHVFGVCEDTFDISDRFKAQRRLALLVEAGRGIGTALDVLAAAE
                     TIPEVAVPEFATTVTVDLSEAVLEGEMPAPGDAAAMSLIRVARRSAADVGRRPAPAPV
                     ADRPPVRYPAGSPQDRCLSSGGLVLDETTLVVPLRAGNSSLGLVTFVRGVRSAVFDGG
                     EVALADELAARTAVSIDNARRFTRERAASLVLQRQLLPRHVPEQSAVDVAYRYLPTDA
                     MTGVGGDWFDVIPLSGTRVGLVVGDVVGHGLQAAATMGRLRTTVRAFAQMDLDPVELL
                     SRLDDLVRQSAEEQWGGAGSADGAHFDVTTGATCLYAVYDPVSRRCVMARAGHLPPAV
                     VPPRGEPSFPDLPAGPPLGLGGLPFEPLEMELPAGSLLALFTDGLVESRDRDIDHGLD
                     ILGHVLGDDRRTALGELCDRAVEELLPNGPAADDTALLLVRTRELGASQVAEWELDAE
                     MVAPGHARELTTAQLHRWGLDELSFATELVVSELVTNAVRYAEGPLHVRLIRDRTLLC
                     EIADTGHTSPHLRHSGEDDEGGRGLFIVAQLVQRWGTRYTRSGKTLWTEQALPADHRP
                     LTADR"
     gene            459151..459636
                     /locus_tag="SFLA_RS01885"
                     /old_locus_tag="Sfla_0392"
                     /db_xref="GeneID:11370038"
     CDS             459151..459636
                     /locus_tag="SFLA_RS01885"
                     /old_locus_tag="Sfla_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152533.1"
                     /db_xref="GI:503918539"
                     /db_xref="GeneID:11370038"
                     /translation="MTMKEESRADIGTPVPDASSTDELREQAERTRDELGRTAEALGA
                     KADVKAQAKEKSAAARKQASEKASLVADQIREKAEQATELVKDRTPDPVLEKTAQAAA
                     QVRETASKAGQYAADKTPDPVLEKAGRATSIARANRKPLLAGGALLAVVLLVRRARGR
                     R"
     gene            459956..461287
                     /locus_tag="SFLA_RS01890"
                     /old_locus_tag="Sfla_0393"
                     /db_xref="GeneID:11370039"
     CDS             459956..461287
                     /locus_tag="SFLA_RS01890"
                     /old_locus_tag="Sfla_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152534.1"
                     /db_xref="GI:503918540"
                     /db_xref="GeneID:11370039"
                     /translation="MGTVLSMQINGAKQQRGHVLLIAGDSATRRRTVQVLPSKNLAAL
                     SMVPVSALLGSNVPSDTTYLDGIHDQNALQVRLRTAAATPGPLLVYLSGRLTTDRRGQ
                     QLYLALSRTTASTVRYTALPWEWLGTELRTRPQGLTTVVFDLAADKAAWPLLREYGTL
                     PASTAAEVYGVVTPPGFAGDEGVSSYTRHWIEQLRHAPERPSNSRLHALTVASAAPPP
                     GALVLPGIREITAPGYAFGHPATDRPQGRTDGPAPQPVVPRPAHEPGGGRGAGPAPRT
                     GTVVVPQTDAAPSPQPPPAHPVFVAQDPRPHIHALAQSGRHTEAAQMAQMWEQYILQT
                     DGFDSPKATEWVEIRADLAKMSGNFLLATQLWVGAGRTRLVHQSPDAPEVLSAARSAH
                     YCWTQLQDAARARECGPELISLLRALPSLDRRHLTVAQQRLEFLHDTPDGS"
     gene            complement(461339..462760)
                     /locus_tag="SFLA_RS01895"
                     /old_locus_tag="Sfla_0394"
                     /db_xref="GeneID:11370040"
     CDS             complement(461339..462760)
                     /locus_tag="SFLA_RS01895"
                     /old_locus_tag="Sfla_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014152535.1"
                     /db_xref="GI:503918541"
                     /db_xref="GeneID:11370040"
                     /translation="MYAPTTGPAQAPSHSQAAPGNSRSRVLIASLIGTTIEFYDFYVY
                     ATAAVLVFPKLFFPSSDPTTALLSSFAVFGAAMVARPIGAIVFGHLGDRLGRKGTLVA
                     SLLTMGIATFLIGVLPTYAQAGWVATALLVLMRLAQGFALGGEWSGAALVATENAPAG
                     KRALWGTFPQLGAPLGFIIGNGLFLVIGALLPSAAGADPSQPSDAFLSWGWRIPFLFS
                     AVMVAIGLWVRMRLVESQVFAKTQETGKVRKLPLATVFRHHWTQLVLGSFAMLATYVL
                     FYLMTTFSLSYGRTAEDADVPGLGYSYTTFVLMMIFGVVFFAAFTLISGPLADKYGRR
                     KTLAWVTVGIIVFGLVWVPLIDLGTLGVVLWLVLGFTLMGTTFGPMGAMLPELFPTSV
                     RYTGSGIAYNVSSILGAAVAPFVAVALWEAGDGSPWLVGVYLSVMGVLTLTALLIGKE
                     TKDVALDEGEVPAAPARTEAPSV"
     gene            463083..463727
                     /locus_tag="SFLA_RS01900"
                     /old_locus_tag="Sfla_0395"
                     /db_xref="GeneID:11370041"
     CDS             463083..463727
                     /locus_tag="SFLA_RS01900"
                     /old_locus_tag="Sfla_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase reductase"
                     /protein_id="WP_014152536.1"
                     /db_xref="GI:503918542"
                     /db_xref="GeneID:11370041"
                     /translation="MSRVRVHNFSVSVDGFATGEGQSPDAPFGHAGTRLHEWFFPTRT
                     FQRMLGKPGGSTGADDAIASTWEAGIGAEIMGRNKFGPLRGPWENDDWKGWWGPNPPF
                     HTPVFVLTHHPRPSVEMEGGTTFHFIDATPQEVLRQAREAAGGLDVRIGGGPSTVREF
                     LAEDLVDHLHVAVVPIVLGRGERLWDGLEGLEKRFRAESVTTPGGVTHMTFTRP"
     gene            464050..464718
                     /locus_tag="SFLA_RS01905"
                     /old_locus_tag="Sfla_0396"
                     /db_xref="GeneID:11370042"
     CDS             464050..464718
                     /locus_tag="SFLA_RS01905"
                     /old_locus_tag="Sfla_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_015579974.1"
                     /db_xref="GI:505392872"
                     /db_xref="GeneID:11370042"
                     /translation="MIEGAFALLEALRRCGGEAGLTEIAAACALPKGSAHRLLEQLLL
                     VGAVERRGSRYRVGSQLYRLGQAWEPHPGLRVAARHPLHRLRAATGASALLTVLHDGR
                     ALTVASVPGEAEPLVPVRNGMSFLLDTAAGQVLSGRGRAGSGGRLPGAVLECAEVMDG
                     VCCAALPVRGRDDRTLAAIAVMTLSAQGLQRAAQEAARAAAAVTAALVRAGAPPRLPP
                     VLHY"
     gene            464877..465344
                     /locus_tag="SFLA_RS01910"
                     /old_locus_tag="Sfla_0397"
                     /db_xref="GeneID:11370121"
     CDS             464877..465344
                     /locus_tag="SFLA_RS01910"
                     /old_locus_tag="Sfla_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152538.1"
                     /db_xref="GI:503918544"
                     /db_xref="GeneID:11370121"
                     /translation="MTVRRLTTLALAGALGLTSLVGAAGAAQADPVDYVQIQLVDLYC
                     GDESEGDHDEAYLNIAANGGKAVRLWPANASYQTMGTGYRRALDGSNGNALLVLGRTE
                     SRTLSLWDYDSTSSDDRLGSVTVTGNEVGAETQYRVLEGSGGVYTLAYRVVDI"
     gene            complement(465516..466961)
                     /locus_tag="SFLA_RS01915"
                     /old_locus_tag="Sfla_0398"
                     /db_xref="GeneID:11370122"
     CDS             complement(465516..466961)
                     /locus_tag="SFLA_RS01915"
                     /old_locus_tag="Sfla_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_014152539.1"
                     /db_xref="GI:503918545"
                     /db_xref="GeneID:11370122"
                     /translation="MTDLDGVKSGEYDVVVIGAGPVGENVADRARAAGLSTAVIESEL
                     IGGECSYWACMPSKALLRPVVARADARRVAGLSDAVQGPLDVDAVLAHRDYETSHWKD
                     DGQVGWLESIGADIYRGKGRLTGVRQVSVTGADGTERHLTARHAVAVCTGSRAVVPSL
                     PGIADVRPWTSREATSAKEVPGRLVVVGGGVVGVEMATVWQGLGAEVTMVVRGGQLLP
                     RMEPFAGELVAEALTEAGARILTGVSTTAVSRAGHDGPVTVELDDGERLEADEILFAT
                     GRAPRTDDLGLDTVGLEPGSWLTVDDSCRVDGSDWLYAVGDVNHRALLTHQGKYQARI
                     AGAAIAARAQGTPPMETDPWGAHAATADHAAVPQVVFTDPEAASVGLTLAEAEAAGHR
                     VRAVDHDLAAVAGSGLYAKGYKGRARMVVDLDRRILLGVTFVGPGIGELLHSATIAVA
                     GEVPVERLWHAVPAYPTISEVWLRLLESFRG"
     gene            467077..467457
                     /locus_tag="SFLA_RS01920"
                     /old_locus_tag="Sfla_0399"
                     /db_xref="GeneID:11370123"
     CDS             467077..467457
                     /locus_tag="SFLA_RS01920"
                     /old_locus_tag="Sfla_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_014152540.1"
                     /db_xref="GI:503918546"
                     /db_xref="GeneID:11370123"
                     /translation="MSTVELTKENFDQVVSDNEFLLIDFWASWCGPCRQFAPVYDSAS
                     ERHPDLVFAKVDTEAQQELAAAFEIRSIPTLMIVRDNVAVFSQPGALPEAALEDVIGQ
                     ARNLDMDEVRKSVEEQKQAQQEPQ"
     gene            complement(<467650..467898)
                     /locus_tag="SFLA_RS01925"
                     /db_xref="GeneID:23391311"
     CDS             complement(<467650..467898)
                     /locus_tag="SFLA_RS01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152541.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249378.1"
                     /db_xref="GI:702730746"
                     /db_xref="GeneID:23391311"
                     /translation="MSHPQSYEILLFPEPEEPDAGGPEPGTAIRSAVVAATGKTGASG
                     YPRYEGGGMEADVDPATHTVEALLVDGAEIDYGLTVRIA"
     gene            complement(467948..468976)
                     /locus_tag="SFLA_RS01930"
                     /old_locus_tag="Sfla_0401"
                     /db_xref="GeneID:11370125"
     CDS             complement(467948..468976)
                     /locus_tag="SFLA_RS01930"
                     /old_locus_tag="Sfla_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcription regulator"
                     /protein_id="WP_014152542.1"
                     /db_xref="GI:503918548"
                     /db_xref="GeneID:11370125"
                     /translation="MSQLSPQPAGTSLPTSADVARLAGVSRATVSYVLNNNTTVRISD
                     STRRRVREAAADLGYVPHAAARSLRAGHSRTVLLPAGQAPAGALYQRFLTQLELGLRR
                     LDYTVVRYGGVGQDADEAAMTWAELRPVAVVSPDDLALTPYGIGVLTRSGARAVITLG
                     SQPVDGAHALVVDQREVGAHAVRHLLARGRRSIGVVVPQEPGHALIARPRLAGALRAV
                     EESDADAGVRALPLRYQEDSAQDLASRWRTLGLDAVFAYDDEYAMLLTRALQDAGLVI
                     PGDTAVIGAGDLMLGRLLRPRLSSVAMELTCEQRPAEMIDRLVQNPGGPPERHHLLRP
                     AVVARESS"
     gene            469288..469752
                     /locus_tag="SFLA_RS01935"
                     /old_locus_tag="Sfla_0402"
                     /db_xref="GeneID:11370126"
     CDS             469288..469752
                     /locus_tag="SFLA_RS01935"
                     /old_locus_tag="Sfla_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_014152543.1"
                     /db_xref="GI:503918549"
                     /db_xref="GeneID:11370126"
                     /translation="MTFEHNHSSDSTTDFPGRSGPAATAEAEPREVGTVRTSYAPDRD
                     GDPDPGEIVWTWVPFEENDGRGKDRPVLVVAREDEGTLLAVQLSSKQHYGDHEWVALG
                     AGPWDSSGRPSWVDLDRVLRVHEDGMRREACALDRGRYDLVVGRLRERYGWS"
     gene            complement(469737..470573)
                     /locus_tag="SFLA_RS01940"
                     /old_locus_tag="Sfla_0403"
                     /db_xref="GeneID:11370127"
     CDS             complement(469737..470573)
                     /locus_tag="SFLA_RS01940"
                     /old_locus_tag="Sfla_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152544.1"
                     /db_xref="GI:503918550"
                     /db_xref="GeneID:11370127"
                     /translation="MSARLRGIAGETESIVLAGRYRTSEGREVSIGREVAAALSGTRL
                     HGPGPVPVAALDTDRTPVVEVTGETSLQAARRMTAGATGKVAVLNYASARNPGGGYLN
                     GAQAQEESLCRGSALHATLLRAPDFYAHHRAERSALYTDRVIHSPGVPVFRDDRGRLL
                     EAPYLAGFLTSPAPNAGVVRRRDPELVPLIRTALASRAERVLEVAAVSGYRRLVLGAW
                     GCGVFMNDPAEVAGAFRALLRGDGRFAGHFEQIVLGIPDRDPDSAVRAAFTREFGGQL
                     QP"
     gene            470725..472023
                     /locus_tag="SFLA_RS01945"
                     /old_locus_tag="Sfla_0404"
                     /db_xref="GeneID:11370128"
     CDS             470725..472023
                     /locus_tag="SFLA_RS01945"
                     /old_locus_tag="Sfla_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_014152545.1"
                     /db_xref="GI:503918551"
                     /db_xref="GeneID:11370128"
                     /translation="MPPDTLGQHGPPVDAAPLGEEEAEDLLRGICFKTGPPRTVGVEL
                     EWLVHDREHPEALVPEDRLRAAADAVRATPLDAALTFEPGGQLELSSQPKGSLMECVD
                     ATAADLAAVRDTLGRSGLTLAGIGVDPWNPPRRLLREPRYDAMEAALDRSGSAGRAMM
                     CTSASVQVCLDAGEEEPGPLGYGRRWQLGHLLGAVLVAAFAHSPFRQGRRTGWQSTRQ
                     ALWADLDPARTLAPQGRLDPRDAWAAHVLATPVMCVRNTEGPWDVPEALTFRDWIRGG
                     GPRPPVRADLDYHLTTLFPPVRPRGHLELRMIDAQSGTDGWLVPLAVTTALFDDPEAA
                     ETVYRTVKPLAETAGLPPAPRNPLWTAAARDGLRDPELAAAAAACFTTALEALPRMGA
                     SGHVLGTVAAFHERYVARGRCPADDLPDPAQEPHGKGLVR"
     gene            472020..473360
                     /locus_tag="SFLA_RS01950"
                     /old_locus_tag="Sfla_0405"
                     /db_xref="GeneID:11370129"
     CDS             472020..473360
                     /locus_tag="SFLA_RS01950"
                     /old_locus_tag="Sfla_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152546.1"
                     /db_xref="GI:503918552"
                     /db_xref="GeneID:11370129"
                     /translation="MTDTPAPHTVQETDAEALRERALAALLTARERTALLTDSVDDHE
                     LTAQHSPLMSPLVWDLAHIGNQEELWLLRAVGGREAMRPEIDGLYDAFEHSRASRPSL
                     PLLAPAEARTYAADVRGRALDILGGAPLHGGGRPLERAGFAFGMVAQHEQQHDETMLI
                     THQLRSGPAVLSAPEPPEPTGTVTLPAEVLVPGGPFTMGTSTEPWALDNERPAHRREV
                     DAFHIDTAPVTCGAYQAFIEDGGYTDARWWAPEGWAMVREHDLTAPLFWHRDAGQWLR
                     RRFGVTEPVRADEPVLHVSWYEADAYARWAGRRLPTEPEWEKAARHDPGSGRSLRYPW
                     GDEDPTPERANLGQRHLRPAAAGAYAAGRSPVGVGQMVGDVWEWTSSDFLPYPGFAAF
                     PYREYSEVFFGPGHKVLRGGSFAVDPVACRGTFRNWDLPVRRQIFSGFRTARDA"
     gene            473360..474115
                     /locus_tag="SFLA_RS01955"
                     /old_locus_tag="Sfla_0406"
                     /db_xref="GeneID:11370130"
     CDS             473360..474115
                     /locus_tag="SFLA_RS01955"
                     /old_locus_tag="Sfla_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152547.1"
                     /db_xref="GI:503918553"
                     /db_xref="GeneID:11370130"
                     /translation="MCRHIAYLGPSVPLGELLVSPAHGLVRQSWEPRRQRNGTVNADG
                     FGVGWYAEGDPVPGRYRRSGPVWGDETFADLSRVVRSTALLAAVRDATFAGADGEAAA
                     APFAEGRLLFSHNGAVRGWPGSLAPLAAGLPPERLLALAARSDSALLWALVLHRTAQG
                     DEIGQAVADTVLDAGAAAPGSRLNLLLTDGSTIVATTWGDSLWYLHDPGRRTVVASEP
                     YDDDPYWREVPDRTLLAATRTDVLLTPLKEPTA"
     gene            474112..475074
                     /locus_tag="SFLA_RS01960"
                     /old_locus_tag="Sfla_0407"
                     /db_xref="GeneID:11370131"
     CDS             474112..475074
                     /locus_tag="SFLA_RS01960"
                     /old_locus_tag="Sfla_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014152548.1"
                     /db_xref="GI:503918554"
                     /db_xref="GeneID:11370131"
                     /translation="MSPFLLTRTLPADATDAALRADVLSGLTKQPKTLPPKWFYDARG
                     SDLFEEITRLDEYYPTRAEREILIARAGEIAALSGARTLIELGSGSSEKTRHLLDALP
                     ALHTYVPVDVSESALAGAAEALLAERPGLSVHALVADFTHALELPESPGPRLVVFLGG
                     TLGNLLPAERAEFLRSVRARLSPGDGLLLGTDLVKDEATLVAAYEDAAGVTAAFNKNV
                     LAVVNRELGADFPLDDFAHVALWDPEHEWMEMRLRARRALTVKIRELDLVVQFEQGEE
                     LRTEISAKFRERRVREELAAAGLRLDQWWTDEAGRFALSLATAD"
     gene            complement(475017..475856)
                     /locus_tag="SFLA_RS01965"
                     /old_locus_tag="Sfla_0408"
                     /db_xref="GeneID:11370132"
     CDS             complement(475017..475856)
                     /locus_tag="SFLA_RS01965"
                     /old_locus_tag="Sfla_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_014152549.1"
                     /db_xref="GI:503918555"
                     /db_xref="GeneID:11370132"
                     /translation="MNAWLPVAPCTPRDCARHEGARRAPLPAAALLLAGCVVTLLGVL
                     AVPAVLLLTPAHRDPLTRRWAYTVVRAFGVRIRVTGPAVESARPEAGELVVANHVSWL
                     DIPLVAAVLPARMVAKSEIRKWPLLGPFAALGGTLFIERDRLRALPGAVRTLAGALAS
                     GSRVAVFPQGSTWCGRGGGGRFRPAAFQAAIDAGAAVRPVRISYRTAGTNTAGAAAFV
                     GDDPLAASLWRVVTAAGLTAEIRILPPVPAGREPDRRALARAAQSAVASDRANLPASS
                     VHH"
     gene            complement(475853..476659)
                     /locus_tag="SFLA_RS01970"
                     /old_locus_tag="Sfla_0409"
                     /db_xref="GeneID:11370133"
     CDS             complement(475853..476659)
                     /locus_tag="SFLA_RS01970"
                     /old_locus_tag="Sfla_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152550.1"
                     /db_xref="GI:503918556"
                     /db_xref="GeneID:11370133"
                     /translation="MTVLPLASPASAPAGVPAPRQAAPSGYRVALATCQDDVRAAQRL
                     RHLVFAGELGARLDSAEPGLDSDAFDTHCDHLLVREAATDEVVATYRLLPPEGARRAG
                     GLYAESEFDLGRLAPIRDDLVEVGRSCVHPAHRDGAVIALIWAGLARYMERTGHTWLA
                     GCCSVPLADGGALAARSWDTVRTHHLAPEEYWVTPHRLWDTTGHPGGGAGGRAALPPL
                     LRGYLRLGAWVCGAPAHDPDFGVADLYVLLSMRRTDPRYLRHFLSLAPLR"
     gene            complement(476827..478080)
                     /locus_tag="SFLA_RS01975"
                     /old_locus_tag="Sfla_0410"
                     /db_xref="GeneID:11370134"
     CDS             complement(476827..478080)
                     /locus_tag="SFLA_RS01975"
                     /old_locus_tag="Sfla_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
                     /protein_id="WP_014152551.1"
                     /db_xref="GI:503918557"
                     /db_xref="GeneID:11370134"
                     /translation="MKIRILAGAVALVSSVALTGCGYLPGVDADSGTVTVWLMKGSAS
                     QGFLDRFKESYEAEHPSVELEFVLQEWGGIGPKVLKALDGDDAPDVIEVGNTQVAQYA
                     QSGQLRDLTLESLRDLGGEDWLPGLAEPGKVDGAQYGIPWYAANRVVIYNKDLFAQAG
                     ITELPTTRDEWVEVTERLNTTGQQGIYLAGQNWYVLAGFIWDEGGELADESGGDWQGA
                     LDSPAALRGMDFYKTLQALGDGPRDADEQTPPETDVFAEGTVAQIISVPGSAALIEQQ
                     NPELKGKLGYFPIPGKSAKKPGAVFTGGSDLIVPESADRRSEGVEVVKALAGEEWQTE
                     LARAMSYVPNKPALARVVEGQEGTSAMAQGATEGRATPNSPYWPAVEADNPIKPYMTA
                     VLEGGDPAEEAKKASDRISAKLVTG"
     gene            478307..478522
                     /locus_tag="SFLA_RS01980"
                     /old_locus_tag="Sfla_0411"
                     /db_xref="GeneID:11370135"
     CDS             478307..478522
                     /locus_tag="SFLA_RS01980"
                     /old_locus_tag="Sfla_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152552.1"
                     /db_xref="GI:503918558"
                     /db_xref="GeneID:11370135"
                     /translation="MSNHTYRVTEIVGTSEEGLDAAIRNGVARASETLHHLDWFEMTQ
                     VRGHIEDGRIAHYQVGLKVGFRLDEKA"
     gene            complement(478623..478949)
                     /locus_tag="SFLA_RS01985"
                     /old_locus_tag="Sfla_0412"
                     /db_xref="GeneID:11370136"
     CDS             complement(478623..478949)
                     /locus_tag="SFLA_RS01985"
                     /old_locus_tag="Sfla_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_014152553.1"
                     /db_xref="GI:503918559"
                     /db_xref="GeneID:11370136"
                     /translation="MPAGSSSKRERQYEHIKEGAEKRGTPTKRAKEIAARTVNKERAR
                     SGESGTASPASLRDPKSSSERGGLRSHRGAQGPTRDQLYEEARKRNVEGRSSMNKEQL
                     RKALGR"
     gene            479159..479350
                     /locus_tag="SFLA_RS01990"
                     /old_locus_tag="Sfla_0413"
                     /db_xref="GeneID:11370137"
     CDS             479159..479350
                     /locus_tag="SFLA_RS01990"
                     /old_locus_tag="Sfla_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152554.1"
                     /db_xref="GI:503918560"
                     /db_xref="GeneID:11370137"
                     /translation="MSVAGESGGRVRQLRAKAQELNEAADRATDPEQRQRLQDKARRL
                     REQSEQESSMNDRGMDPMV"
     gene            479445..481871
                     /locus_tag="SFLA_RS01995"
                     /old_locus_tag="Sfla_0414"
                     /db_xref="GeneID:11370138"
     CDS             479445..481871
                     /locus_tag="SFLA_RS01995"
                     /old_locus_tag="Sfla_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_014152555.1"
                     /db_xref="GI:503918561"
                     /db_xref="GeneID:11370138"
                     /translation="MSTPHDPYVRVRGAREHNLRDVDVDIPRDTLTVFTGVSGSGKSS
                     LAFGTIYAEAQRRYFESVAPYARRLIHQVGAPDVGEITGLPPAVSLEQRRSAPGARSS
                     VGTVTTLSNSLRMLLSRAGDYPPGAERLDSDAFSPNTAAGACPECHGLGLIHRTTEEL
                     LVPDPSLSIRDGAIAAWPGAWQGKNLRDVLDALGYDVERPWRELDTADREWILFTDEQ
                     PVVTVHPVRDAGRIQRPYQGTYMSARRHVMHTFADSRSRTLRAKAERFLTSAPCPVCG
                     GGRLRREALAVTFAGRTIAELVALPLTALTEVLLESGGGSDTARVLTADLLARIEPVT
                     ELGLGYLSLDRTAPTLSSGELQRLRLATQLRSGLFGVVYVLDEPSAGLHPADTESLLG
                     VLGRLREAGNSVFVVEHQMDVVRRADWLVDVGPLAGEHGGRVLHSGPPAGLAGVDGSA
                     TRRFLFDEDPAPAREPRVPTGWITLGGVDLHNVRGVDATFPLGVLTAVTGVSGSGKST
                     LVGQVLAGVLADRRPAESADGPAVPVTRGCASAEGLDAVDRLVQVDQRPIGRTPRSNL
                     ATYTGLFDVVRKLFAETETARARKYRAGRFSFNVAGGRCETCQGEGFVSVELLFLPST
                     YAPCPDCHGARYNPATLEVTLRGLTIAEVLDLTVEAAAGFLAGTPAAERSLRALLDVG
                     LGYLRLGQPATELSGGEAQRIKLATELQRARRGHTLYLLDEPTTGLHPADVEVLMRQL
                     HGLVDAGNSVVVVEHDMTVVAGADRVVDMGPGGGDGGGRIVATGTPREVARAAGSRTA
                     AYLAKALRPG"
     gene            complement(481894..482640)
                     /locus_tag="SFLA_RS02000"
                     /old_locus_tag="Sfla_0415"
                     /db_xref="GeneID:11370139"
     CDS             complement(481894..482640)
                     /locus_tag="SFLA_RS02000"
                     /old_locus_tag="Sfla_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018513070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_014152556.1"
                     /db_xref="GI:503918562"
                     /db_xref="GeneID:11370139"
                     /translation="MKLTLRVWRQQNAEAPGAMATYEVDGISQDMSFLEMLDTLNEEL
                     ILGGDEPVAFDHDCREGICGACSLVINGDAHGPERTTTCQLHMRSFDDGDTIDIEPWR
                     ASAFPVVKDLVVDRSSFDRIIQAGGYISAPTGTAPDAHATPVPKPDADSAFEHAECIG
                     CGACVAACPNGSAMLFTSAKVNHLNVLPQGAPERETRVLDMVATMDDEGFGGCTLTGE
                     CATACPKGIPLPSITAMNKEWLRATRKVRR"
     gene            complement(482637..484595)
                     /gene="sdhA"
                     /locus_tag="SFLA_RS02005"
                     /old_locus_tag="Sfla_0416"
                     /db_xref="GeneID:11370140"
     CDS             complement(482637..484595)
                     /gene="sdhA"
                     /locus_tag="SFLA_RS02005"
                     /old_locus_tag="Sfla_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579960.1"
                     /note="part of four member succinate dehydrogenase enzyme
                     complex that forms a trimeric complex (trimer of
                     tetramers); SdhA/B are the catalytic subcomplex and can
                     exhibit succinate dehydrogenase activity in the absence of
                     SdhC/D which are the membrane components and form
                     cytochrome b556; SdhC binds ubiquinone; oxidizes succinate
                     to fumarate while reducing ubiquinone to ubiquinol;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_014152557.1"
                     /db_xref="GI:503918563"
                     /db_xref="GeneID:11370140"
                     /translation="MPDLSDYTNYRTGEPLVDAKAPTGPVAERWDTRRFEAKLVNPAN
                     RRKHTVIVVGTGLAGGSAGATLAEQGYHVVQFCFQDSPRRAHSVAAQGGINAAKNYRN
                     DGDSVHRLFYDTVKGGDFRARESNVHRLAEISVEIIDQCVAQGVPFAREYGGLLDNRS
                     FGGVQVSRTFYARGQTGQQLLLGAYQALSRQIAAGNVELYSRTEMLDLVVVDGKARGI
                     VARDLVTGKIDTYFADAVVLASGGYGNVFYLSTNAMNSNATAIWRAHRRGAWFANPCF
                     TQIHPTCIPRTGDHQSKLTLMSESLRNDGRIWVPKAKGDDRPANRIPEDERDYYLERV
                     YPAFGNLVPRDIASRAAKNVCDEGRGVGPGGQGVYLDFAEAIERMGRKKVEEKYGNLF
                     DMYARITAEDPYETPMRIYPAVHYTMGGLWVDYDLQTTIPGLFAIGEANFSDHGANRL
                     GASALMQGLADGYFVLPSTINDYLARNPHTEEIDAGHPAVAEAVAETEDRLNLLLAVD
                     GDRTPDSFHREIGELMWEFCGMARTEEGLRKALGRIPQIREEFWRRIKVPGTGEQFNQ
                     SLEKANRVVDYLELAELMCLDALHRAESCGGHFREESQTPDGEAARRDEEFSYAAAWE
                     FSATGDAPVLHKEDLVFEYVHPTQRSYA"
     gene            complement(484597..485268)
                     /locus_tag="SFLA_RS02010"
                     /old_locus_tag="Sfla_0417"
                     /db_xref="GeneID:11370141"
     CDS             complement(484597..485268)
                     /locus_tag="SFLA_RS02010"
                     /old_locus_tag="Sfla_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018554204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_030124525.1"
                     /db_xref="GI:662752965"
                     /db_xref="GeneID:11370141"
                     /translation="MTRTLWDSSVGKKTIMAVSGLVMLGYLVVHMLGNLKIFFGSDEF
                     NHYAHWLRTLGEPFLHYEWALWIVRVVLVAAVVLHAVSAYQLSRRDLRARPTAYVHRK
                     ARSSYATRTMRYGGVILALFIVWHILDLTTGTVHSGGFQSGHPYQNVLDTFSTWYGNV
                     IYIVAVLALGLHVQHGFWSAAQTLGVGSATRDRVLKTLANVLAVVLTAGFVSVPVAVM
                     TGVVS"
     gene            485400..486332
                     /locus_tag="SFLA_RS02015"
                     /old_locus_tag="Sfla_0418"
                     /db_xref="GeneID:11370142"
     CDS             485400..486332
                     /locus_tag="SFLA_RS02015"
                     /old_locus_tag="Sfla_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014152559.1"
                     /db_xref="GI:503918565"
                     /db_xref="GeneID:11370142"
                     /translation="MHFQQLAYFVAVAEARHFTRAAEEVHVSQPSLSQQIKALENELG
                     AELFSRARGNIALTDAGEALLPLARRILADADTARHEVQELVQLRRGRVRLGATPSVC
                     TGLLPDVLRAFHGAHPGIQLLIEEGGSHDLVRQLARGALDLALLVLPLPAASPALTTV
                     ELLHEDLVVVSPASRPAPGREGSVHVADLENEPLVMFRHGYDLRELTVAACRAEGFEP
                     SFTVEGGEMDAVLGFVRAGLGIAVVPRMVAVRAGQDLRTTPLASPGLRRTIALAHRSD
                     VEPPRAARELQRMLLGSGHPAVPSAADGPRPADG"
     gene            complement(486344..488518)
                     /locus_tag="SFLA_RS02020"
                     /old_locus_tag="Sfla_0419"
                     /db_xref="GeneID:11370143"
     CDS             complement(486344..488518)
                     /locus_tag="SFLA_RS02020"
                     /old_locus_tag="Sfla_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018955705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014152560.1"
                     /db_xref="GI:503918566"
                     /db_xref="GeneID:11370143"
                     /translation="MSIPSQPSGAPDAEPDGPEGRLRRFATIWSRAIFPSTATSLTRP
                     EFEEHLLPLARELSDTLHRRVFDAAPAHRVGAGLVAAHCTDPDALSSTLGVVDSYLVL
                     YCGGNGPVELSTEDSRARCARIQHALAGGFTQALRERTLAEQEAIARSALTARSHAEQ
                     ALHATEARFRAVFKDAAVGIGIADLDGNILEINDTLTRMFGGLENHVRSHKVNEWVHP
                     EDSPHVWKYYEELVRGEREHYSVEKPYYRNDGTVLWTNLTVSLLRDPEGRPEYQLALL
                     EDTTERRLLNLRLRYEATHDALTGLPNRTLFFERLEKALAPREGMRFGLCYLDLDGFK
                     AINDSLGHAAGDRLLVEVADRLQSCATAPGEMVARLGGDEFVALTTGPRTEDEVHELA
                     GRILLALATPVRLDGRELTVRGSIGVVEGPSGERTPAEVLRSADITMYRAKAAGGNRF
                     ALADAEADARAITRHGLTTALPTALDRGEFFIEYQPLVHLGDGSVHGAEALVRWCHPQ
                     HGVLGPDRFIPLAEHTGLIVPLGRWVLEESVRQANFWKERHTDGGPLRINVNLSPTQL
                     HHPSLVAETVDVLERSGLEPGALCLEVTESALIGADDDLLKPLRQLAEMGVDIALDDF
                     GTGYSNLANLRRLPVSVLKLDRSFTQGMQHHPADPVDLKIVEGIVSLAHSLDLAVTVE
                     GVETGAQAEQLRQIGCDTAQGWYYARPGAPDRIHSLLLADAV"
     gene            complement(488515..489273)
                     /locus_tag="SFLA_RS02025"
                     /old_locus_tag="Sfla_0420"
                     /db_xref="GeneID:11370144"
     CDS             complement(488515..489273)
                     /locus_tag="SFLA_RS02025"
                     /old_locus_tag="Sfla_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249292.1"
                     /db_xref="GI:702730353"
                     /db_xref="GeneID:11370144"
                     /translation="MYDFYLGGSHNFEVDREAARKAMEFMPGLPKVMQANRAFMRRAV
                     HHATTLGVNQFLDIGSGIPTFGNVHEVAQAADPEARVAYVDHDPVAVAHSQAVLEGNE
                     RAVIAAADLRKPKDILDNPEVNALLDLDRPVALLLVAVLHFIEDADGPYAAVAELRDA
                     LAPGSLLVLTHASYEGIPLPQEEAGGTVDVYRTIRNPLIMRTRKEISRFFEGYEMIDP
                     GLVAMPEWRPESAEALAQEDPFTYSGFAGVGRKA"
     gene            complement(489538..490497)
                     /locus_tag="SFLA_RS02030"
                     /old_locus_tag="Sfla_0421"
                     /db_xref="GeneID:11370145"
     CDS             complement(489538..490497)
                     /locus_tag="SFLA_RS02030"
                     /old_locus_tag="Sfla_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152562.1"
                     /db_xref="GI:503918568"
                     /db_xref="GeneID:11370145"
                     /translation="MNTWRNASLAVTAAALLALTTACGQEQGAETPGGQAVGNAAPAR
                     QPADGGYGSDGGYGSEAAAGAAPKEAGQLAVWDSKKLGEVLTDSEGFTLYRFDKDTAE
                     PPASRCEGDCAEIWPAVAARNAEAAAGTDASLIGEVTRGDGTKQLTVAGWPMYRYAQD
                     TGPGEAKGQGVGGTWFAAAPDGKKAVVNADGPSAGEQADLAGLSVRKDPQLGDIVVDK
                     RGMTVYRFKKDSAWPMKSACTGDCLKKWPVVPPVSKNDVEGVTTKGFVTFGRPDGIQQ
                     QSLDCWPLYTFSGDSEPGDTNGQGVGGTWYAVSPGAKLVGAPK"
     gene            490692..491225
                     /locus_tag="SFLA_RS02035"
                     /db_xref="GeneID:23391312"
     CDS             490692..491225
                     /locus_tag="SFLA_RS02035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012999051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825279.1"
                     /db_xref="GI:754214655"
                     /db_xref="GeneID:23391312"
                     /translation="MLPGVYGSRIWRLTAATLLLLLAVPLPAAGDDCAVASIGQGDGG
                     SSVAIAGQGRCGAVIAEPEPEPAPPPPPPPPPEPPPPPPPPPLPPPPPPPPPPPPPPP
                     PPPAPAPEPEPEPEPAPAPARVRPTPPAPSPVALPTYRKPHRKQPRSGPSLVSLTLLI
                     TAPAVFAVAVLRPRSSR"
     gene            491242..492009
                     /locus_tag="SFLA_RS02040"
                     /old_locus_tag="Sfla_0422"
                     /db_xref="GeneID:11370146"
     CDS             491242..492009
                     /locus_tag="SFLA_RS02040"
                     /old_locus_tag="Sfla_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152563.1"
                     /db_xref="GI:503918569"
                     /db_xref="GeneID:11370146"
                     /translation="MSEWLVLTIAMASACAVVLTTAVLSNRRIADDDDPSQTPDVIEY
                     MTMMIGVVYAIVLGLAIAGVWEGRSAAQESVRMEAQALHEVSARSAVYPVEVRDRIRK
                     DVDAYVAHVVGAEWKSMTDDGNLTEEGTRLLDRVRADVTEYKPRTDHEGQAYQPLVDQ
                     VAAADDARGSRGQNAGATMPGVVWFGLITGAVVTVGLIFTLQIRRTFRELLLAGLFSV
                     LIAFLLFLIWDFDAPFGRGISATTAPFVDLFPRATGG"
     gene            492199..492723
                     /locus_tag="SFLA_RS02045"
                     /old_locus_tag="Sfla_0423"
                     /db_xref="GeneID:11370147"
     CDS             492199..492723
                     /locus_tag="SFLA_RS02045"
                     /old_locus_tag="Sfla_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152564.1"
                     /db_xref="GI:503918570"
                     /db_xref="GeneID:11370147"
                     /translation="MRAIRVAPVALLGAAACLLMAPAASADVLNGGTSTSFTPTITPS
                     TVAPGGRVTLGAMGCTSDATAFSGVFDTTTIPSGRSATTTVDQDARRGAVYEVTFRCG
                     TTTRSANLTITSGATSSPTTSSTSSPSGVLGGLGGSVDTMDPTEIAAGSALVAVASAG
                     ALYVLRKRRTGRQH"
     gene            complement(492819..493490)
                     /locus_tag="SFLA_RS02050"
                     /old_locus_tag="Sfla_0424"
                     /db_xref="GeneID:11370148"
     CDS             complement(492819..493490)
                     /locus_tag="SFLA_RS02050"
                     /old_locus_tag="Sfla_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152565.1"
                     /db_xref="GI:503918571"
                     /db_xref="GeneID:11370148"
                     /translation="MRASRALAVTATAFAAVGLAAPLAAAGGGPGSNPSNFPTNVTVN
                     PSSVFQGATMHVSAEGCGRSGGKVWSNAFPTVNLSPGRVGYATARIRDNATPGQYSLS
                     VRCNDSDNNFGGGNGGDGGQGGNGGQSGQSGHGGQGGNGGQGGGNGGNGGQGGNGGQG
                     GGNGDPVATARFTVLPSRGAHGGLGGSMGPSSVEMQVGGGLVAAAAVGGAVFVVRRRM
                     NNAAI"
     gene            493815..494477
                     /locus_tag="SFLA_RS02055"
                     /old_locus_tag="Sfla_0425"
                     /db_xref="GeneID:11370149"
     CDS             493815..494477
                     /locus_tag="SFLA_RS02055"
                     /old_locus_tag="Sfla_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C60"
                     /protein_id="WP_014152566.1"
                     /db_xref="GI:503918572"
                     /db_xref="GeneID:11370149"
                     /translation="MGRDQWGGERSRRTPWGAIALVMLTGLALMRNGAETSPGPPQPA
                     AAASVAGPREAAVSAPLDGEPVQPLAYAPVERIRIPSIEVDAPVVDVNLDPAGWIEAP
                     PAQDPNLAGWYQNGIAPGQRGTAVMVGHVDNLAGPAVFYGLGSLDKGRQIEVSRYDGR
                     VAVFEIYGVEVFSKNDFPGSRVYGDTGYAELRVITCGGGYTKAAGYDGNVVVFARLVE
                     TR"
     gene            complement(494502..495347)
                     /locus_tag="SFLA_RS02060"
                     /old_locus_tag="Sfla_0426"
                     /db_xref="GeneID:11370150"
     CDS             complement(494502..495347)
                     /locus_tag="SFLA_RS02060"
                     /old_locus_tag="Sfla_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide deacetylase"
                     /protein_id="WP_014152567.1"
                     /db_xref="GI:503918573"
                     /db_xref="GeneID:11370150"
                     /translation="MKHDQIPAERRTFLRLALALGAATAVRMIAADPAGTPTRPGGEP
                     PAPAAGPPARAQAGPGSYRLRPMTSGTPPRFRPAPPPVRTRPFEEMPGLGSDAMVLSF
                     DDGPDPRYTPDILATLRRYDVRAMFFVCGEMAADNRDLLREMSDDGHVVGNHSWSHPL
                     IPKLPRGAIRDELGSTSEVVERTLGVPPLWYRAPYGAWNRNSFEIGAALGMEPMAWTV
                     DTLDWTEPGTDTIVRRVEKGAAPGVVVLSHDAGGNRSQSVAALRRYLPALLEKGYRPT
                     VPRRS"
     gene            495526..495987
                     /locus_tag="SFLA_RS02065"
                     /old_locus_tag="Sfla_0427"
                     /db_xref="GeneID:11370151"
     CDS             495526..495987
                     /locus_tag="SFLA_RS02065"
                     /old_locus_tag="Sfla_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015579949.1"
                     /db_xref="GI:505392847"
                     /db_xref="GeneID:11370151"
                     /translation="MTDQQQHRFERGTDGPKVIVAGIDGSQSSMRAAAYAAGLARRQN
                     AMLALVYVQPVLSAGAALGAPVADATGEVAEELVNEIRTAAERLKDTWNVRWEFHTFH
                     GDPYNGLVTASDELKADAVIVGASESAGHRFIGSVAVRLVKAGRWPVTVVP"
     gene            complement(496040..497239)
                     /locus_tag="SFLA_RS02070"
                     /old_locus_tag="Sfla_0428"
                     /db_xref="GeneID:11370152"
     CDS             complement(496040..497239)
                     /locus_tag="SFLA_RS02070"
                     /old_locus_tag="Sfla_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152569.1"
                     /db_xref="GI:503918575"
                     /db_xref="GeneID:11370152"
                     /translation="MTKRIRQGAAIAVAGLLATATACTGQQSSTPGFAGRHLSAGPGA
                     NGAGAGGEDGADSFTLLASGDVLPHSSIIDRAAADAGGAGYDFRPMLKGAAPAVSGAD
                     LAICHMETVYGRNGGPYTGYPDFRSPPEVATALRATGYDSCSTASNHTLDDGTQGIRR
                     TLDALDRAGIAHAGSARSAEESSRPTMLRAGKGKDAAKVAHLAYTYGTNDRTLPDGQP
                     WAVNLIDKDRIVADARTAREAGADVVVVSLHWGTEWQERPDDDQLDLGHALTASTTGK
                     RPDIDLIIGTHAHVPQAYEKVNGTWIVYGMGDQVAGAMVDDAGVRDPRANESSMGRFT
                     FERPAEPGRRWEVRKAEFLPQLFDPEAARVVGLDREAGRLREIRERIQGVVLSRGAAQ
                     DGLVAGK"
     gene            497498..498067
                     /locus_tag="SFLA_RS02075"
                     /old_locus_tag="Sfla_0429"
                     /db_xref="GeneID:11370153"
     CDS             497498..498067
                     /locus_tag="SFLA_RS02075"
                     /old_locus_tag="Sfla_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014152570.1"
                     /db_xref="GI:503918576"
                     /db_xref="GeneID:11370153"
                     /translation="MTTATTDERALAELQREHGPALFHFLLGLTFGDRQRAEDLLQET
                     LVRAWQHPEAFDAPYESMRPWLFTVARRLAIDARRSRQARPTEVSDAVLESAPARDDT
                     AAAAVHSLDVREAVRTLSPEHRAVLVQIYFRGLSVGETAQVLGIPPGTVKSRSYYALR
                     LLSRTLPGYSSRSSTSTSASRDTASTTST"
     gene            498310..498822
                     /locus_tag="SFLA_RS02080"
                     /old_locus_tag="Sfla_0431"
                     /db_xref="GeneID:11370155"
     CDS             498310..498822
                     /locus_tag="SFLA_RS02080"
                     /old_locus_tag="Sfla_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152572.1"
                     /db_xref="GI:503918578"
                     /db_xref="GeneID:11370155"
                     /translation="MRPEHYEESGGDGLLVPMAWMYSEYIADELLVTGDLMEPTTLEY
                     RAGRDALALTIFLSDGAATEELPVARVDELRLLTAYGASWRHWVCARLEALERPTAPA
                     GLPDPGLALARAAWRWLEETELLAADLDAIGPPPWEPSDADDEAGEVRVWTPAWQLGL
                     PLGHLAVHLH"
     gene            complement(498835..500061)
                     /locus_tag="SFLA_RS02085"
                     /old_locus_tag="Sfla_0432"
                     /db_xref="GeneID:11370156"
     CDS             complement(498835..500061)
                     /locus_tag="SFLA_RS02085"
                     /old_locus_tag="Sfla_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="WP_014152573.1"
                     /db_xref="GI:503918579"
                     /db_xref="GeneID:11370156"
                     /translation="MTGAGIAVIALLALLLFGTGFLLGRTARPVRTSDVGTPVEHATF
                     ETLHTASLAAPPLRSGLTEESARRSARRLRSLLGTDALCLTDRDRVLVWDGEGDHHGK
                     DVMEQVEGLLASGRDTAFHSDCGDLDCTLRWAVAVPLTVDHRVLGTLVAYAPRESAVL
                     ARAAGEVARWVCVQLELAELDRSRTQIVEAEIKALRAQISPHFIFNSLAAIASFVRTD
                     PERARELLLEFADFTRYSFRRHGEFTTLADELHSIDQYLALVRARFGARLSVTLQVAP
                     EVLPVSLPFLCLQPLVENAVKHGLEGAVTLPRPHGPVRAVDAPIRVTISALDAGAEAE
                     VVIEDDGTGMDPERLRRILRGEGGASAGIGLLNVDERLRQVYGDDYGLVIETGVGAGM
                     KITLRLPKYRAGVHGS"
     gene            complement(500058..501548)
                     /locus_tag="SFLA_RS02090"
                     /old_locus_tag="Sfla_0433"
                     /db_xref="GeneID:11370157"
     CDS             complement(500058..501548)
                     /locus_tag="SFLA_RS02090"
                     /old_locus_tag="Sfla_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014152574.1"
                     /db_xref="GI:503918580"
                     /db_xref="GeneID:11370157"
                     /translation="MSAPGHPASVVAVALVVLATVLVGGFGLRISRTTSDFYVASRTV
                     RPRLNAAAISGEYLSAASFLGIAGLVLVHGPDMLWYPVGYTAGYLVLLVFVAAPLRRS
                     GAYTLPDFAEGRLESRQVRRLVSVFVVGAGWVYLVPQLQGAGLTLKILTGAPGWLGDV
                     LVASVVVIAVAAGGMRSITFVQVFQYWLKLTALLVPAIFLVLAWQGDGRPRVTFDEQI
                     SVFRADHPLYATYGLIIATFLGTMGLPHVVVRFYTSPNGRDARRTTVAVLALVGLFYL
                     LPPVYGALGRLYAPDFMHGGDADAAVLLLPARVIGGLGGDLLGALLAGGAFAAFLSTA
                     SGLTMAVAGVITQDVLPSRGVRHFRLATVLAIAVPLAGSLLVSRVPVADAVGMAFAVS
                     ASSFCPLLVLGIWWRRLTPPGAIAGLLLGGGSALLSVAITVSGAVRPPGWPHALLAWP
                     AVWSVPVGFLAMILVSLATPGRIPPGTNAAMTRFHLPEALAAGRVR"
     gene            complement(501545..501853)
                     /locus_tag="SFLA_RS02095"
                     /old_locus_tag="Sfla_0434"
                     /db_xref="GeneID:11370158"
     CDS             complement(501545..501853)
                     /locus_tag="SFLA_RS02095"
                     /old_locus_tag="Sfla_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_030124535.1"
                     /db_xref="GI:662752979"
                     /db_xref="GeneID:11370158"
                     /translation="MRPLPRYRAQSEIDEQTALGGAYVRSLMRSQLRAGLTVFAVLAT
                     VAGTLPLLFEALGSDALVWGVLGFATCPPLTLAAWWYVRRAERNERDFARLVEGLPSP
                     "
     gene            complement(501970..502722)
                     /locus_tag="SFLA_RS02100"
                     /old_locus_tag="Sfla_0435"
                     /db_xref="GeneID:11370159"
     CDS             complement(501970..502722)
                     /locus_tag="SFLA_RS02100"
                     /old_locus_tag="Sfla_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014049918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LytR family transcriptional regulator"
                     /protein_id="WP_030124536.1"
                     /db_xref="GI:662752980"
                     /db_xref="GeneID:11370159"
                     /translation="MLRVLAVDDEEPALEELLYLLRADPRIRSAEGATGATEALRRIG
                     AAVDAGPDDPSAIDVVFLDIHMAGLTGLDVAQLLAGFAAPPLIVFVTAHEGFAVHAFD
                     LKAVDYVLKPVRRERLAEAVRRVAEQVGERTASVHDAAADQIAVELGGVIRFVPVDDI
                     AYAEAQGDYARLHTSSGSHLVRIPLTTLEERWRSRGFVRIHRRHLVALNRIDELRLDA
                     GSMSVRIGDAELAVSRRHTRSLRDLLMRQTGR"
     gene            complement(503016..503876)
                     /locus_tag="SFLA_RS02105"
                     /old_locus_tag="Sfla_0436"
                     /db_xref="GeneID:11370160"
     CDS             complement(503016..503876)
                     /locus_tag="SFLA_RS02105"
                     /old_locus_tag="Sfla_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA lyase"
                     /protein_id="WP_014152577.1"
                     /db_xref="GI:503918583"
                     /db_xref="GeneID:11370160"
                     /translation="MPELPEVEALRDFLGDHLVGKEIARVLPLAISVLKTYDPPVTEL
                     EGADVSAVARHGKFLDITAGDLHLLIHLARAGWLQWKDGFPATPPRPGKGPLALRTVL
                     TGGDGFDLTEMGTTKRLAVHLVRDPAEVPGVARLGPDPLADSFDRDAFAAVLGGARRQ
                     IKGALRDQSLIAGIGNAYSDEILHVAKMSPFKLTSALGDEDVTRLYDAMRTTLQDAVE
                     RSRGVAAGRLKAEKKSSMRVHGRTGQPCPVCGDTVLEVSFSDSSLQYCPTCQTGGKPL
                     ADRRLSRLLK"
     gene            complement(503932..504798)
                     /locus_tag="SFLA_RS02110"
                     /old_locus_tag="Sfla_0437"
                     /db_xref="GeneID:11370161"
     CDS             complement(503932..504798)
                     /locus_tag="SFLA_RS02110"
                     /old_locus_tag="Sfla_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_014152578.1"
                     /db_xref="GI:503918584"
                     /db_xref="GeneID:11370161"
                     /translation="MTPPPVVDAHHHVWDLAVRDQDWITGEELAPLRRTFTLADLEPE
                     ARAAGVVSTVLVQTVTVAEETPELLALADAGTLVAGVVGWTDLTAPDVSGTLASLRAL
                     PGGDRLVGIRHQVQGEPDPEWLLRPDVLRGLAAVAAAGLVYDLVVRPHQLPAAVRAAA
                     LLPELTFVLDHAGKPPVARRATHPWADGLRALAALPNTVCKLSGLVTEADPLSWTVED
                     LRPYADTVIEAFGPTRLMYGSDWPVCRLAAGYADVLATARELTDGLGDADRQSVLAGT
                     AQRVYGLREPAG"
     gene            complement(504800..505768)
                     /locus_tag="SFLA_RS02115"
                     /old_locus_tag="Sfla_0438"
                     /db_xref="GeneID:11370162"
     CDS             complement(504800..505768)
                     /locus_tag="SFLA_RS02115"
                     /old_locus_tag="Sfla_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_014152579.1"
                     /db_xref="GI:503918585"
                     /db_xref="GeneID:11370162"
                     /translation="MRRIRIGSSAVEITELSFGAAAIGNLFTEVDPGQAAAAVDAAWE
                     EGIRYFDTAPHYGLGLSERRLGEALRDRPRAEYTISTKAGRLLDPLPPAWTAAHLGLS
                     DGFAVPHTHRRRWDFSADGIRRSIEDSLGRLGLDRVDIVYLHDPDDHAEAAFREGYPA
                     LEKLRAEGVVGAIGAGMNQTAMLTRFLRETDVDVVLCAGRLTLLDHSALDTLLPEAAA
                     RHRDVVVGGVFNSGLLADPRPDAAYDYAAAPAPLLDRALRIRDVAEGHGVPLRAAALH
                     YPLRHPAVAGVLVGTRSPEEVRDAAAQLRRPVPDALWDDLRAEGLL"
     gene            complement(505855..507213)
                     /locus_tag="SFLA_RS02120"
                     /old_locus_tag="Sfla_0439"
                     /db_xref="GeneID:11370163"
     CDS             complement(505855..507213)
                     /locus_tag="SFLA_RS02120"
                     /old_locus_tag="Sfla_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol O-acyltransferase"
                     /protein_id="WP_014152580.1"
                     /db_xref="GI:503918586"
                     /db_xref="GeneID:11370163"
                     /translation="MSTELLAPLDLAFWHLESDAHPMHLGALAVFDPAPGASAPQLLD
                     LLGARAAAIPRLRMRVRDVLLPVGGAAWFTDKDFEVQRHVTRVVLPEGDFLTEAGRLA
                     GELMEQPLGRGLPPWRMYLLDSPGDGPFAVLVKLHHALADGMRAVAIGAGIFDQIASA
                     GAGRGAVNRRTPVPPRSWLPGPYEVAGMARERLGEVGRALGVGASVVRASRLDLRATT
                     ALAARSSGTRRLATAELDAATVQRIRRTEGGTANDVLLAVVAGALRRWMLERGGPLPG
                     ADPRALVPVSRRRPGGAATGNKLSAYLLGLPVGEPDPRERLRLVRTGMNRNKAAGPLR
                     GAGAVAVLADQLPALAHRFGAPLAGNAARMLFDILVTSVPLPRSALSLGGCPLRAVYP
                     MAPLARGQALAIALSTYGGRVQVGLVADGKALPDLDRLATALREELRDLHALVPTVPA
                     PA"
     gene            complement(507334..509400)
                     /locus_tag="SFLA_RS02125"
                     /old_locus_tag="Sfla_0440"
                     /db_xref="GeneID:11370164"
     CDS             complement(507334..509400)
                     /locus_tag="SFLA_RS02125"
                     /old_locus_tag="Sfla_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="WP_014152581.1"
                     /db_xref="GI:503918587"
                     /db_xref="GeneID:11370164"
                     /translation="MDDRVAGSLSLPDDWPAHPDLSLALNRMGSFDWDLDSGLMHMDE
                     PALEVFDLRPEEYDGHPATLSLRVPADEAIRLDGMVSQALKSGRSNYGAYFRRSRRDG
                     SLCWTHTQGFIRRDGTGRPRRIIGIIRDATQELAESTARRTVDEERRRRTSLVEGTTA
                     ALAHARTVEDVTEVLKSSRGLANLGATSLVMGLLESGRIHLVADGPEGAFVQGTRYTR
                     TDEPYPMSEVIRTLTPRFIETPEDFATSYPLLWPHISHLGITAAAYMPLIAQARPIGA
                     LGLLYGNKAGFTGDERNLLVALGSSIAQSLQRAMLYEQEHDLAEGLQQAMLPRRIPDV
                     PGAQVAVRYRSARLGRDIGGDWYDIIPLPGGRVGAVIGDVQGHDTHAAAVMGQLRIVL
                     RAYAAEGHSPATVMARASVFLHELDTDRFATCTYAEADMTTGVVQLVRAGHVDPALRG
                     ADGSCRRLPSDGGMPLGLSAEFGRLEYPVNTVDLDPGQTLILYTDGMVELPGTDLDEG
                     MALLAATVRDGPQDLQKLADRLCEVVDERGGEDDMAVLLLRRDAAHAPHPGGRLQQHV
                     AQNDPEALTSARHMIRAAVRAWGAKDRADEVELAADELITNALMHTDGGAIVTIRVLT
                     GPERRLRVDVEDRSSALPRRRDAGESGVSGRGLMLVDRLADIWGVESRGNGKCVWCEF
                     VVPERR"
     gene            509546..510382
                     /locus_tag="SFLA_RS02130"
                     /old_locus_tag="Sfla_0441"
                     /db_xref="GeneID:11370165"
     CDS             509546..510382
                     /locus_tag="SFLA_RS02130"
                     /old_locus_tag="Sfla_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152582.1"
                     /db_xref="GI:503918588"
                     /db_xref="GeneID:11370165"
                     /translation="MSVLVGSIVMLGMLVIVPLGLGLVQDPALDRVRRLWPLFAVPGA
                     VSLWLPRGDAATALALCYAAGTLLLASHAPRRLARLRSARPAEAAVLTALVTPSVAAL
                     ALVAERFGHELFGFELGILALTVPHFHFAGFAAALVAGLVCRAQDGPAGRFAALSVPL
                     GTLLVLVGYFTGERTELAGAVVLTAGMWTVALLTWRTVRVAGPDRVTRLLLAVSAGVL
                     AATMVLALSWALGEATGLPHPTLTWMAATHGLGNALGFALCALLARRRLQDLTRTEGT
                     TA"
     gene            510379..510888
                     /locus_tag="SFLA_RS02135"
                     /old_locus_tag="Sfla_0442"
                     /db_xref="GeneID:11370166"
     CDS             510379..510888
                     /locus_tag="SFLA_RS02135"
                     /old_locus_tag="Sfla_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152583.1"
                     /db_xref="GI:503918589"
                     /db_xref="GeneID:11370166"
                     /translation="MSTLTYPEVGATRLGPLPEGYNHLHHRAAVGRGRAQFEAAGAAV
                     TEWRMHRAAGAGVKSSASRADPQAAVEVSAGVGRIRVRALCEIVWTAYENDRIGFAYG
                     TRARHPERGEESFVVELADDGTVWFTVTAFSRPACWYARLAGPLVPLAQHWYARRLGK
                     VLRRIVSAA"
     gene            510918..512369
                     /locus_tag="SFLA_RS02140"
                     /old_locus_tag="Sfla_0443"
                     /db_xref="GeneID:11370167"
     CDS             510918..512369
                     /locus_tag="SFLA_RS02140"
                     /old_locus_tag="Sfla_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152584.1"
                     /db_xref="GI:503918590"
                     /db_xref="GeneID:11370167"
                     /translation="MEWFTADGYWLSRLVFQRSLAAVYLVAFVAAALQFRALIGSRGM
                     LPVPDLLRRTSWRDAPGLFRLHYSDRFFALAAWTGAAVSVALLAGLDARLPLGAAMVL
                     WAVPWVLYLSIVQVGQVWYGFGWESLLLETGFLAVFLGNADTAAPVLVLWLLRWLLFR
                     VEFGAGLIKIRGDECWRKLTCLEFHHETQPMPGPLSWFFHRLPRPVHRVEVAANHVTQ
                     LVVPFLLFTPQPVASAAAGLMVVTQLWLVLSGNFAWLNWLTIVLALAAVDWSPLTGPA
                     PAQPDAPLWYEVVVIAVTALVLGLSYRPARNLVSRRQVMNRSFDPLHLVNTYGAFGSI
                     SRVRLEVVVEGTDEAVIHEGTRWLEYGFRGKPGDPRRLPRQFAPYHLRLDWMMWFAAL
                     SPAYARSWFGPFVERLLRGDRDTLRLLRHDPFPGGPPAHIRARVFRYRFTDLRELRET
                     GCWWDRTYVRDFMRPVARPVPLRPPPREGDDRR"
     gene            complement(512997..514484)
                     /locus_tag="SFLA_RS02145"
                     /old_locus_tag="Sfla_0445"
                     /db_xref="GeneID:11370169"
     CDS             complement(512997..514484)
                     /locus_tag="SFLA_RS02145"
                     /old_locus_tag="Sfla_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014152586.1"
                     /db_xref="GI:503918592"
                     /db_xref="GeneID:11370169"
                     /translation="MTVTEDSQEFAPGVVEFGPGIDPERLAVCLSVLDELDTIDVDHP
                     DAITVRRATAGIYRTVKQRRRQERRASKTAHDKAVTEATATGSAERIDDETQGVLPSS
                     SATAEIAGILQRPRSCYICKTRYVEVDAFYHQLCQPCAKENRSRRDARTDLTGRRALL
                     TGGRAKIGMYIALRLLRDGAHTTITTRFPNDAIRRFKAMPDSDEWIHRLKIVGIDLRD
                     PAQVVALADSVAAEGPLDILINNAAQTVRRSPQAYSELVAAESAPLPSGELPAAEVIG
                     TFGSGTVDRVAALPAARKEGEGLSAQDVTGLALVTGSASPARIAAGTAIDAGGLVPDL
                     HDTNSWIQTVEEVEPIELLEVQLCNSTAPFILISRLRPAMAAAAGRAYVVNVSAMEGV
                     FGRGYKGAGHPHTNMAKAALNMLTRTSAQEMFEKDRILMTAVDTGWITDERPHPDKMR
                     LAEEGFHAPLDLVDGAARVYDPIVRGEQGEDLYGCFLKDYAPAGW"
     gene            complement(514621..516084)
                     /locus_tag="SFLA_RS02150"
                     /old_locus_tag="Sfla_0446"
                     /db_xref="GeneID:11370170"
     CDS             complement(514621..516084)
                     /locus_tag="SFLA_RS02150"
                     /old_locus_tag="Sfla_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014152587.1"
                     /db_xref="GI:503918593"
                     /db_xref="GeneID:11370170"
                     /translation="MSDTGTAGGRTVTTRIPARLDRLPWSRWHWMIVIGLGTVWILDG
                     LEVTVVGNIASRLSEDGSGLAITDAQVTGIAAALYVAGACSGALVFGWLTDRFGRKKL
                     FLITLAVYLAATALTAISFSAWWFFLFRFLTGFGIGGEYAAINSAIDELIPSKYRGRV
                     DLIINGSFWLGAVAGSLLSVLALNTDIFPKDIGWRLTFALGVVLGLVILLVRRHVPES
                     PRWMFIHGHDEAAEKLVDGVEREVEAETGSTLPPAEPAITVRQRTSVGFGLIARTVFR
                     SYPKRAVLGIALFIGQAFLYNAITFGFGSILVTFFDVSSGATGYYFAVIAFCNFLGPL
                     LLGRLFDTVGRKPMIAGTYILSGLLLFGTAWLFGVGSLTAVTMTGCWCLVLFVASAGA
                     SSAYLTVSEIFPMETRAMAIAFFYAVGTAAGGITGPLVFASLTSSGVVGDTVLAFCIG
                     AGLMVAAGLVAVFFAVAAEQKSLEDIATPLSVSGSGE"
     gene            516313..517206
                     /locus_tag="SFLA_RS02155"
                     /old_locus_tag="Sfla_0447"
                     /db_xref="GeneID:11370171"
     CDS             516313..517206
                     /locus_tag="SFLA_RS02155"
                     /old_locus_tag="Sfla_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014152588.1"
                     /db_xref="GI:503918594"
                     /db_xref="GeneID:11370171"
                     /translation="MTTSVRTTEAIGAAATRHHEAGTVADTAALPWIEDAGKVAPQDA
                     RAMSKIFFDKLQVLEEGTHEYQYARNTLIEMNLSLVRFAASRFRNRGGDDTEDIIQVG
                     TIGLIKAIDRFDLSREVEFATFAVPYIVGEIKRFFRDTTWSVHVPRRLQELRVELAKA
                     KEQLSTKLDRDPTVAELAAHLDLPEEEIIEGLVAANGYSAGSLDTPNADSDSGSEQRA
                     YADLLGEDDPGMESVENLHTLAPLLRQLDDRERKIVRMRFGQEMTQAQIGAELGVSQM
                     HVSRLLSRIVQRLRAGMSVEA"
     gene            517325..518578
                     /locus_tag="SFLA_RS02160"
                     /old_locus_tag="Sfla_0448"
                     /db_xref="GeneID:11370172"
     CDS             517325..518578
                     /locus_tag="SFLA_RS02160"
                     /old_locus_tag="Sfla_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_014152589.1"
                     /db_xref="GI:503918595"
                     /db_xref="GeneID:11370172"
                     /translation="MSESPLGTSARVRPGVIPEQQGLPDVDASVWDVDATLLLVEDDA
                     GDALLVEEMLSDSELDAPLTWCKTMAEARRFLLGCRTPVCVLLDLHLPDVHGLDAVRQ
                     LVESAPDAAVIVLTGLDESQTGLSAVAQGAQDYLVKGRIDPEVLGRAVRYALQRKHAE
                     RSAAAMRAGQLIAQENARLERALLPIPLLLDNSFLVAARYEAGRAHGLLSGDFYDVVQ
                     TSDGAVHAVIGDVSGHGAAEAALGVCLRVAWRTAVLTGVSQREKIGLLEKILVAERSD
                     PHVFATVTTLVFPPDRDRVFVARAGHPGLLLRRGKDVGWVEPEAGMALGLLPGAGRWT
                     ITELELSPGSELVLFTDGLFEGRTGPTSRLGEDGLLAMAGRYGALEPRAFVDALVAEA
                     TESASPYGGLADDVAVLHLGWKANA"
     gene            518575..520200
                     /locus_tag="SFLA_RS02165"
                     /old_locus_tag="Sfla_0449"
                     /db_xref="GeneID:11370173"
     CDS             518575..520200
                     /locus_tag="SFLA_RS02165"
                     /old_locus_tag="Sfla_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014152590.1"
                     /db_xref="GI:503918596"
                     /db_xref="GeneID:11370173"
                     /translation="MSTEEPASGRSGPIAGLSVQNWVHLILAGFVVVVCGCLVVGGLV
                     LSRISDRTTELVDHIQPARSASFQLQNSLLDQETGVRGYALTGDTTFLEPYEEGMRAE
                     RERLARLRSLTGDEQPYAGDVERIERAAQQWRTLRAEPLIAAVRENGPTAATSAPIMR
                     SKADFDSLRALYNTQQSHLDDARDTARAELGDTRTTRDWVLVALVVGFVLAVVSLSLL
                     LHRVVGRPLGALTAASDRVRAGAFTEKIDVRGPSDVRAVSEAAEAMRSRLVAELAESQ
                     ERETLLAEQTTELRRSNSELEQFAYVASHDLQEPLRKVASFCQLLEKRYSAELDDRGR
                     QYIDFAVDGAKRMQVLINDLLTFSRVGRVQQSWKPVDLDASLDRALTNLTLAVEESGA
                     VVVREEPLPELLGDSTSLTMVWQNLVGNAVKFRRPDVPCRITVGCVREGDVWHLTVAD
                     NGIGIAPEFADKVFIIFQRLHARDEYEGTGIGLSLCRKIIEFHGGRIWLDPKPPEGTL
                     IHFTLPVLPEAPTHTTAELLAPAALTPRSGDTP"
     gene            520197..520640
                     /locus_tag="SFLA_RS02170"
                     /old_locus_tag="Sfla_0450"
                     /db_xref="GeneID:11370174"
     CDS             520197..520640
                     /locus_tag="SFLA_RS02170"
                     /old_locus_tag="Sfla_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_014152591.1"
                     /db_xref="GI:503918597"
                     /db_xref="GeneID:11370174"
                     /translation="MNDAVKPIEVLLVEDDPGDELMTREAFEDNKIRNTLHVVRDGQE
                     ALDFLYRQGEYTEAPRPDLVLLDLNLPRYDGRQVLERIKTDPELALIPVVVLTTSSAE
                     EDILRSYKLHANAYVTKPVDLEQFIGAVRQIDDFFVSVVRLPRRA"
     gene            520739..521194
                     /locus_tag="SFLA_RS02175"
                     /old_locus_tag="Sfla_0451"
                     /db_xref="GeneID:11370175"
     CDS             520739..521194
                     /locus_tag="SFLA_RS02175"
                     /old_locus_tag="Sfla_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_030880028.1"
                     /db_xref="GI:664352378"
                     /db_xref="GeneID:11370175"
                     /translation="MNEQAISRPDGPVQGPPSTEVLLAAEVFDGEPGCIAQARALADR
                     FLARLVAEWLAELGENTRSDLMLAVSELVTNADRYSHGPYLLELEGDARRISVTVYDS
                     STALPVLYSPDPARLGGHGMEIVVALCDRLTAERVPVGKRIRAEFMLST"
     gene            521430..522587
                     /locus_tag="SFLA_RS02180"
                     /old_locus_tag="Sfla_0452"
                     /db_xref="GeneID:11370176"
     CDS             521430..522587
                     /locus_tag="SFLA_RS02180"
                     /old_locus_tag="Sfla_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_033249303.1"
                     /db_xref="GI:702730405"
                     /db_xref="GeneID:11370176"
                     /translation="MVYMSSLAFSVLLSLVSAVAYAAGAIVQERVAAAGDSRPYAPLR
                     NGAWWVAVALNGVGAVLHVMALAYGPLSLVQPLGALTIVFALPMAALFVHRRAGRTAW
                     RGAVMATVGLAGLLALTGSTGSHTLAGPEQFALATGTAGAVLVLLVLAKGFHRPMLRS
                     VVLATGAGIAFGMASVFTKTVAVEWTSGSVTSGLPTLLVIAGLAAAGLLLSQAAYRGA
                     GLTAPLATVTVVNPVVAAAVGLTMFGERFRFGTTGTLIALGCGALAAAGLVLLTTERV
                     GAERNAQRGTESGGRRTDEHVDAPAGDADGSRTVVLPEPAKPVVPQGAAVLPDPFPAP
                     TALSLPLTLPLDHGGGRVEFDGRQAASGPARRGDLEGRAGNVQTLTPPALR"
     gene            complement(522557..523822)
                     /locus_tag="SFLA_RS02185"
                     /old_locus_tag="Sfla_0453"
                     /db_xref="GeneID:11370177"
     CDS             complement(522557..523822)
                     /locus_tag="SFLA_RS02185"
                     /old_locus_tag="Sfla_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_014152594.1"
                     /db_xref="GI:503918600"
                     /db_xref="GeneID:11370177"
                     /translation="MAATGRHRRYQPSRINRASLTVTAGGAGIALPLLTAASAGAATT
                     DVWEKVAACESTGNWHINTGNGYYGGLQFTRSTWAAYGGTAYAARADLATKDQQIAVA
                     EKVLDGQGPGAWPTCSVRAGLEQGGDAPDLAPQSKRQVAVDGGKGKAPESGPAARTAR
                     DGATVKASPTAVPGARESYTVARGDSLSGIASAERVRGGWQRLYAANRTVVGSDPDLI
                     IPGQRLSLDGAGTPSTAAERKATPRSTAPEAAGKKAPKAAERARPATPKPAPEATEKT
                     RRAAEKKASKPRSGFTAPVSAGTGTPYHQAGSWSSGYHTGVDFPVPTGTSVKAVASGK
                     VVSAGWAGAYGYEVVVRHDDGRYSQYAHLSSLHVRAGQQVGTGQRIARSGSTGNSTGP
                     HLHFEIRTGPGYGSDIDPLAYLRAGGVSV"
     gene            524022..525092
                     /locus_tag="SFLA_RS02190"
                     /old_locus_tag="Sfla_0454"
                     /db_xref="GeneID:11370178"
     CDS             524022..525092
                     /locus_tag="SFLA_RS02190"
                     /old_locus_tag="Sfla_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcription regulator"
                     /protein_id="WP_014152595.1"
                     /db_xref="GI:503918601"
                     /db_xref="GeneID:11370178"
                     /translation="MTDALRPAGTAPTLEDVARTAGVSRATVSRVVNGVRNVDPAIQE
                     AVRRAVSVTGYAPNRAARSLVTRRTDAVALVVSGAGAEPDDEGAAGRGSFTAQVFADP
                     FFGRVVTGVVDSLRPRGMHPVLMFAETSRARQEVVEYLRQGSADGALIVSTHAEDPLP
                     RLVTEAGLAAVLYARPARPVGISYVDLAHRDGARLAAEHLLARGCRRIATIAGPLDVA
                     AGQERLAGFQEALARQGASVPPVVEGRFTQQSGEIAMERLLAEHPGLDGVFAANDLMA
                     TGACHVLREHGRRVPEDVAVIGFDDSSAASACRPPLTTVRQPVEDMAAEMTGLLLDRL
                     AAPGRPVTSVVFEPVLIVRDSA"
     gene            complement(525165..526430)
                     /locus_tag="SFLA_RS02195"
                     /old_locus_tag="Sfla_0455"
                     /db_xref="GeneID:11370179"
     CDS             complement(525165..526430)
                     /locus_tag="SFLA_RS02195"
                     /old_locus_tag="Sfla_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family transcriptional regulator"
                     /protein_id="WP_041825280.1"
                     /db_xref="GI:754214657"
                     /db_xref="GeneID:11370179"
                     /translation="MYFDGPLSRQELGPATGLSSGSISNVVAELASEGLLEEAGVVDS
                     DGGRPRTLLRIAPGGGLFVGIDIGETRVRVELFDLSLTELARTDRLLAQHGYDVERIV
                     GHVRSGVSDVLRDAGADPRMLLGIGIGVPGIIERDAPEAVGGPGAVVHGQTIGWSAVP
                     FERLLREAVQIPPEVPFFIDNGAKTLGQAEMWFGGGRGAGAAAVALIGSGVGASVSRG
                     DILDEDLSNAALEWGHTTVQLRGRRCRCGSIGCLEAYAGAEAMRERWHEAGGPLPPDA
                     DDETALAALLAAAYPGPGGAAPDPVAVAILDETAECLGAALADLVNLFLPERILLGGW
                     AGLLIGPHLLPQIRRYAQEYALEHAVARTTIGLGHLGPDAVTVGAATLPLSDFLARGG
                     TRPAPTVRPGAGVASARAAAPARGRSAAG"
     gene            526643..527956
                     /locus_tag="SFLA_RS02200"
                     /old_locus_tag="Sfla_0456"
                     /db_xref="GeneID:11370180"
     CDS             526643..527956
                     /locus_tag="SFLA_RS02200"
                     /old_locus_tag="Sfla_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014152597.1"
                     /db_xref="GI:503918603"
                     /db_xref="GeneID:11370180"
                     /translation="MRHLRAAAAITLAASVVAGVTACGGGTSSDGGSNESPKTLTYWA
                     SNQGPSIEADKKILTPELKKFEKETGIKVKLEVVPWADLLNRILAATTSGQGPDVLNI
                     GNTWSASLQSTGALLPWDDENFEAIGGRDRFIDSAVASAGKEGEPPAAVPLYSLSYAL
                     YYNKKMFADAGITAPPATWDQLVEDGRKLSKDGKWALGAEGSNLSNNIHQTFVLGQQH
                     GADFFDEQGKADFTSDGAVAAVKQYVDFMAKDRIIAPGNAEYAQNQSLTDFAKGRTAM
                     VLWQAAATTFAAQGMKPEDWGVAPVPVPAGAPGAGKQTNSMVAGINMAVFRNTRNIDG
                     AKKFVKFMTSDAEQKILCKTYGSIPPVKAAQSDPAFAAPELKVLRDTLATSAAPLPQV
                     PNESQFETAVGTAVKELFADAAAGSPVTTESVKARLEKAQQTMQS"
     gene            527967..528977
                     /locus_tag="SFLA_RS02205"
                     /old_locus_tag="Sfla_0457"
                     /db_xref="GeneID:11370181"
     CDS             527967..528977
                     /locus_tag="SFLA_RS02205"
                     /old_locus_tag="Sfla_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014152598.1"
                     /db_xref="GI:503918604"
                     /db_xref="GeneID:11370181"
                     /translation="MTATVTTDPGTGKQARGTTRGSEGARRGIPRIPDRIRRGGLPYL
                     LLLPAVLLELLIHLIPMVVGIVMSFRQLTQFFIGNWGAAPWTGLENYEIAVDFDAPIG
                     EALLHSFFVTCVFTFFAVGLAWLFGVTAAIMLQESFRGRGFLRTLFLVPYALPVYAAV
                     ITWAFMFQRDNGLVNHVLHDQLGITDQPSFWLIGDNSIYALIVVSVWKGWPFAFLMLM
                     AALQNIPRELYEAAAIDGAGVWQQIRRITMPSLRPVNQVLVLVLFLWTFNDFNTPYVL
                     FGKAAPAGADLISIHIYQSSFVTWNFGTGSAMSVLLLLFLLVVTAVYLFLTSRGRKGS
                     HA"
     gene            529009..529848
                     /locus_tag="SFLA_RS02210"
                     /old_locus_tag="Sfla_0458"
                     /db_xref="GeneID:11370182"
     CDS             529009..529848
                     /locus_tag="SFLA_RS02210"
                     /old_locus_tag="Sfla_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_030636865.1"
                     /db_xref="GI:664099045"
                     /db_xref="GeneID:11370182"
                     /translation="MAAPRSFLWTRRVVLTLLAGFVLLPVYVMISSSLKPLQDVSGKF
                     RWIPRGLTVQPYVDIWDTVPLARYFVNSLIVAGAATVCSVVIAVFAAYAVSRYGFRGK
                     RVFTVTVLSTQMFPGILFLLPLFLIFVNIGNSTGVALYGSRGGLILTYLTFSLPFSIW
                     MLIGYFDSIPRDLDEAAMVDGCGPLRALFRVVVPAAVPGIVAVSVYAFMTAWGEVLFA
                     SVMTNDATRTLAVGLQGYATQNDVYWNQVMAASLVVSVPVVAGFLLLQRYLVAGLTAG
                     AVK"
     gene            530082..530465
                     /locus_tag="SFLA_RS02215"
                     /db_xref="GeneID:23391313"
     CDS             530082..530465
                     /locus_tag="SFLA_RS02215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_030124556.1"
                     /db_xref="GI:662753009"
                     /db_xref="GeneID:23391313"
                     /translation="MEQSEVLKRVIGILTEAGEMQRHAEGDSEGVDPDVGGNMVTTLL
                     NETMPHIAIPSDATVEEMAALVGREVGGAVEQLVGAFTLAFIALAQIHDSGQQDVSSS
                     DVLQDLALRAEELSSGDEGPEGPPE"
     gene            530600..532606
                     /locus_tag="SFLA_RS02220"
                     /old_locus_tag="Sfla_0460"
                     /db_xref="GeneID:11370184"
     CDS             530600..532606
                     /locus_tag="SFLA_RS02220"
                     /old_locus_tag="Sfla_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152601.1"
                     /db_xref="GI:503918607"
                     /db_xref="GeneID:11370184"
                     /translation="MPLHPPPLRPLGPGARLGVKEAEAALVEHYPRLVRLAYLTLPPS
                     LGRHRRVLAAHTAVQRALHGRARPAPGPGTEGIPAPRSGGGTNDSTRTPAYAAVRLRV
                     VRSALAYGHRPRWWPGRVPAPAALLPSMPVVRGLRLFPRAGGMDEFALDRALADVRAP
                     VRAALGLRLLESLSPEAAQALLADAGVRDPGDAVRAAARVAGSDHERVRRMLGSGEFD
                     PCTVQTRPGDLLRRRHRVRAGAATLALLTVAGGLALTAGPDSDDVASRAAARSVAVPG
                     GALDPTALVRTSAEQWADTSRVDFSAWPSRGGRLDDRELLRRALDTWAAPRPDVTVTR
                     TPGTAVVAPAQPPQLLFAGDLDGRAVVLFHDGGVRVVRYTETLSGRSAPALDFARADG
                     ADVTTAAALAVSRTAASARYLLAPWVAESATRDLLAPDSPARPLDVDGDGVTAAVPRP
                     AEGGGCGSWPAMQLRSSEKIVEKHAFLVTDLGDLAPVHLTQTPAPGSGAPARQPREAT
                     GADALVGWARTACSLRDLRRSGVRAVNNWHFAVQPLPGTRATADWVCTRADTWRGPGR
                     VLVQFVPPAASPSARAEVVADRRNSALCSRFGQHVVAGTHWRSPAGAWYVLAAGSRAV
                     KRLELEGSVRGSTAGTTLAVRAPQDAVFRVTAALHDGGTAPSAR"
     gene            complement(532755..534521)
                     /locus_tag="SFLA_RS02225"
                     /old_locus_tag="Sfla_0461"
                     /db_xref="GeneID:11370185"
     CDS             complement(532755..534521)
                     /locus_tag="SFLA_RS02225"
                     /old_locus_tag="Sfla_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152602.1"
                     /db_xref="GI:503918608"
                     /db_xref="GeneID:11370185"
                     /translation="MKLPRLTPSARGRRRTTARLAVAALVAAGAATLPVPAAQAAGSV
                     VKVEGSQGAWKLTVDGAPYTVKGLTWGPAVADAGTYMPDVRSMGVNTIRTWGTDATTK
                     PLLDSAAGQGIKVIAGFWLQPGGGPGSGGCVNYLTDTQYKNDMLAEFPKWVETYKDHP
                     GVLMWNVGNESVLGLQNCYSGDALEQQRDAYTTFVNDIAEKIHAVDRNHPVTSTDAWT
                     GAWPYYKENAPDLDLYAVNSYGAVCDIRKTWQDGGFDKPYIVTEGGPAGEWEVPDDAN
                     GVPDEPTDLAKADGYSRAWQCVTGHTGVALGATLFHYGTEYDFGGVWFNLLPAGQKRL
                     AYYAVKKAYGAGTSGDNTPPVITGMTVDDASAVQAGRPFTVKASVSDPDGDRITHQML
                     LGSKYVDGSGQLDDVRFSDKGNGTFEVTAPDRLGVWKVYLKSSDGKGNVGIETTSFKV
                     VPPKVGGTNLAAGKPAAASTSQPGGTGCPCPAGKAVDGSFDTRWASDWSDRQWIQVDL
                     GTRTAFDHVQLAWETAYAKGYTVQTSDNGQDWRTVHTVTEGNGGIDDIDVTGEARYVR
                     VDASVRGTPWGYSLYEFGVYRR"
     gene            complement(534608..535732)
                     /locus_tag="SFLA_RS02230"
                     /old_locus_tag="Sfla_0462"
                     /db_xref="GeneID:11370186"
     CDS             complement(534608..535732)
                     /locus_tag="SFLA_RS02230"
                     /old_locus_tag="Sfla_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152603.1"
                     /db_xref="GI:503918609"
                     /db_xref="GeneID:11370186"
                     /translation="MAERISRSTLVSALVVIAALALVVTGFTAITRAGAPAEAVPGAG
                     APAQVSRVMQGTQHTQGHAVAAAPVPSGDDPDGDGYIPAIPPVTGVQPSTEIPPHRYF
                     HEFQANCSVDHTGSVDPIVYPGQTGKSHHHTFMGNDTTDENSTTASLGAGGTACKAPG
                     DLSAYWMPTLYKGDQEVRPVGPQTIYYKAGVTDYRTVRPFPKGLRFVVGSPTQTAAEF
                     RDHPGMVEGYECGESYHNYEFPATCPTSRDTQLNLRMQAPSCWDGKHLDTPDHKAHMA
                     YPIVMGANQDVCPASHPVALPMIEFKMAWPVNGDMSQVRLASGTGHSFHYDFFNAWDG
                     ATLDAMVGHCIVGGLQCDARGYDQNNPGEGAALDENYELP"
     gene            complement(536469..537602)
                     /locus_tag="SFLA_RS02235"
                     /old_locus_tag="Sfla_0463"
                     /db_xref="GeneID:11370187"
     CDS             complement(536469..537602)
                     /locus_tag="SFLA_RS02235"
                     /old_locus_tag="Sfla_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_014152604.1"
                     /db_xref="GI:503918610"
                     /db_xref="GeneID:11370187"
                     /translation="MVRTGLSALLIIGTWATAGLTQATAADSRSSAEPQASAGIITAM
                     QRDLGLTKSQAEARLTAEKKATALEGTARSAAGASYGGSWFDASSGRLTVAVTDDAKA
                     GAVRAAGAQVRVVEHTARELDAVKNRLDALTAPSGVSSWHVDPRANSVVVTVVASEQG
                     DNDVRSFVAKAREAGPVTVEQTSEAARTFAAGTVGGDPYYTGNVRCSIGFSVHGGFVT
                     AGHCGQAGGAVRGWDGSAIGNFQGSSFPDNDYAWVNVGSGWWTVPVVLGWGTVSDQLV
                     RGSNEAPIGASICRSGSTTHWHCGNVLAKNETVNYSQGAVRQMTKTSVCAEGGDSGGS
                     FISGDQAQGVTSGGWGNCSSGGETWYQPINEILNRYGLTLHTA"
     gene            complement(537845..539359)
                     /locus_tag="SFLA_RS02240"
                     /old_locus_tag="Sfla_0464"
                     /db_xref="GeneID:11370188"
     CDS             complement(537845..539359)
                     /locus_tag="SFLA_RS02240"
                     /old_locus_tag="Sfla_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_041825558.1"
                     /db_xref="GI:754215114"
                     /db_xref="GeneID:11370188"
                     /translation="MNVFTTAAGAVAGRRAVRDPGVVVLRGIPYAAPPFGADRFRAPR
                     PAAPWNGVRDCASFGAVAPQSAELPGAPVWSPGDEDVLSLNVWTPDGDGGRLPVLVWI
                     HGGAYVFGSSAQPDFDGTFLAGHGVVVVTLNYRLGFEGFGHVPTADGEEARPDNRGLL
                     DQIAALRWVRDNIASFGGDPGRVTVAGQSSGATSVACLMAMDAARGLFRRALAHSAVN
                     ACATPESAARTTAEVAAAAGVPATYAGLASASPKALVEASDRVAEGYRRDPGSGHRHY
                     DPAIYGPVAGVAGLPADPLTACAAGASREVDLMVCHTAEEYWLLDAVGSCAKVTTEQQ
                     LTAFAADHRLSRSLPADYRALMPGASVNEIYLAVYGDLMFGEYSSRLAESHARAGGRA
                     YLARFVRRRDGHGAPVRAWHCADIPFAFGTLDDENVRFLVGGTPGAADRELAGRMAQA
                     WADFAATGDPGWQPVGSVTGDAVRIWDTSPESGGSGWDDFREPWRAPGLPLRAP"
     gene            539585..540232
                     /locus_tag="SFLA_RS02245"
                     /old_locus_tag="Sfla_0465"
                     /db_xref="GeneID:11370189"
     CDS             539585..540232
                     /locus_tag="SFLA_RS02245"
                     /old_locus_tag="Sfla_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_014152606.1"
                     /db_xref="GI:503918612"
                     /db_xref="GeneID:11370189"
                     /translation="MAADPSAAAGVRVPDTKLAVEATELVRDTTDDLVYHHSRRVFLF
                     GALQGHRRDLSFDPELLYIGALFHDLGLGERFRSSGRRFEVDSADEARGFLRARGVPE
                     DGVRRVWTAIALHTTPGIPAFMEPEVALVTAGVEYDVLGIGYGDISDADRAAVVALHP
                     RPDFKRRILASFTEGIRPKPETTFGNVKADVLQHYVPGFERGDFVRTVLESPWPE"
     gene            complement(540265..541812)
                     /locus_tag="SFLA_RS02250"
                     /old_locus_tag="Sfla_0466"
                     /db_xref="GeneID:11370190"
     CDS             complement(540265..541812)
                     /locus_tag="SFLA_RS02250"
                     /old_locus_tag="Sfla_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramyl peptide synthase"
                     /protein_id="WP_014152607.1"
                     /db_xref="GI:503918613"
                     /db_xref="GeneID:11370190"
                     /translation="MKLSELLAGQNHHIRQGDPEKALITAGTAFDADRVVPGSLFIAV
                     PGHLEGGPGAVAPALARGAAAVVVEDGCVVPTAAGDVCVVQVPDARRTAAVAASRYFG
                     EPGRRMDMVAITGTNGKTSVSYMVESALRISEGARAGVIGTAGSRIGDELIPMPRSVL
                     STPESPDLQYLLGYMRDRGVGTVVLEATSMGLLTHRIDRTFIDVGVFTNLSQDHLDDH
                     GTMENYRDAKLRLFQGLCEHAVVNADDPVGARIGAMMPGAVTTYALDAEADFRATDLT
                     ADASGTRFTLHHQGRKYPAAIPTPGRFSVSNALAAMAACHTLGHDLAGLVSALGRMPQ
                     IPGRFERLTTVGGTSVIVDYAHSPDSLEKVLGAVRGFARSAVVTVFGCGGDRDTTKRT
                     DMGRIAGTHSDLVVLTSDNPRTEDPEVIMDQVVPGIEATGTPYERFTDRRTAIEFALS
                     AAGPDDIVLIAGKGSEPYQIVGDVLLPFSDVATVRDLADIRVAATRSSPAPAKVFPSP
                     TGLPPQR"
     gene            complement(542147..543694)
                     /locus_tag="SFLA_RS02255"
                     /old_locus_tag="Sfla_0467"
                     /db_xref="GeneID:11370191"
     CDS             complement(542147..543694)
                     /locus_tag="SFLA_RS02255"
                     /old_locus_tag="Sfla_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_041825281.1"
                     /db_xref="GI:754214659"
                     /db_xref="GeneID:11370191"
                     /translation="MKENPVIAAVTGLTVEVDGRALVDRVSLRIRPGTVTALVGASGS
                     GKTTTGLALLGAFPAGARVTGEVTVHGTRVGHVPQHPAAVLNPARRAGALLRDMARQQ
                     VRDLPRSRRRAAARQRVARALADAQLDDAGKLLSRYPHQLSGGQQQRLVLAQALLLGA
                     GIIVADEPTTGQDALTTRRIVEQLAAVAGRGIAVLLLSHDLDVVRALADEVLVMRGGR
                     VVEQGPAYRVLDAPADPWTKELLAEPRTLPYADSGQAGTELLTVEGLTARHRTGGARV
                     PVLSVDRLTLRSGECLALVGRSGSGKTTLGRCLAGLHRDHTGRITLDGTELPRSLRDR
                     SRAQLAAVQYVFQDARAAFDEHRPVLDQVARTAVRLRGAEPREAVARARRVLTDLGLA
                     GELVRRRPGLLSGGELQRAALARALLAEPRVIVCDEITSGLDPVTRRSLLDLLGALMS
                     RQDAPAVVLITHDLDTAAPADRVAVLDGGAVVEEGTSEQILNAPRHPFTVALVGASGR
                     RGAAVRR"
     gene            complement(543691..544500)
                     /locus_tag="SFLA_RS02260"
                     /old_locus_tag="Sfla_0468"
                     /db_xref="GeneID:11370192"
     CDS             complement(543691..544500)
                     /locus_tag="SFLA_RS02260"
                     /old_locus_tag="Sfla_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014152609.1"
                     /db_xref="GI:503918615"
                     /db_xref="GeneID:11370192"
                     /translation="MKRLGGYGPGAAVVAVPLGIALAGPLLVGEPTARAASFTLDAGH
                     RLGTDFVGRDVVQQVLLGGRPVVLVALAATVLVYLVALPIGLACALTHRRWLEEVLMR
                     PLDVLLAVPSLLMILLVAAAFPPGKAGLALLVAFVSAPDATRIVRAAAAEAASRPAVE
                     ALRMQGESWWRLAVGYVGRSILRTLAADAGIRLTGVLYLVATAAFLGIGVAPDAADWA
                     VMVDRNRTGLIVQPWAVVVPALLIVALTMGGNLLVDAAMERRTPVRKGRRT"
     gene            complement(544497..545450)
                     /locus_tag="SFLA_RS02265"
                     /old_locus_tag="Sfla_0469"
                     /db_xref="GeneID:11370193"
     CDS             complement(544497..545450)
                     /locus_tag="SFLA_RS02265"
                     /old_locus_tag="Sfla_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014152610.1"
                     /db_xref="GI:503918616"
                     /db_xref="GeneID:11370193"
                     /translation="MNALRSWIARRLLLGVLQTAAVVLLVFGLTEALPGDAAVAFAGD
                     QPDPQRIAAVREAMGLDRPAHERLTDWVVGLLHGDFGTSLTSGRPVAGFLADGFGPTL
                     LLATLTVLVLVPVSVGLGVLAARHEGRLTDRLISSATLGVYAVPEFALGVLLVSVLAL
                     RLGWLPPTAVGYGTDLLAHPAALVLPVLVLLARPVCSLARLVRAGMIDALAAPWTAHA
                     RRYGIPGARIRYGHALPNALAPATQQLARTIDWLLCGVIVVEALYVIPGLGTVLMNAV
                     ADRDIPVVQGLAVVFGVATVLLNLGADLVTHRLAPRSGAAA"
     gene            complement(545447..547042)
                     /locus_tag="SFLA_RS02270"
                     /old_locus_tag="Sfla_0470"
                     /db_xref="GeneID:11370194"
     CDS             complement(545447..547042)
                     /locus_tag="SFLA_RS02270"
                     /old_locus_tag="Sfla_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014152611.1"
                     /db_xref="GI:503918617"
                     /db_xref="GeneID:11370194"
                     /translation="MTESADRHDRFPGLRRRGFLAAAGGAAGFGALALAGCSGPEATG
                     STAGKGDGTPRRGGRVRAAFAGGGASETLDPHLGNLFADAARSKALFDKLADYGADLA
                     AVPRLAEAWEPNAGLDRWNVTLRQAQFHDGKPVTAADVLYSYRRIADPDKAYRARASL
                     EPIDLRASRATGERTVEFVLKRPTAEFPNVMAAFGTYIVQDGATGFDRAPIGSGPFRF
                     VSFAPGRSTVLRRHDAHWDGAPHLDELEFVVANEESARINALLGGQVEYAHELNPATG
                     RAHEKSGGITIVRLRNSAMQAFAMKTDRPPFDDPRVREAFFLLADREELVKGALSGAG
                     ETGNDLFGKGYEYYADELPQREQDIDRARHLLRKAGAEKLRVTLDTSAVAAGFTEAAG
                     IFRDQAARAGVTVDVRMGSKDSYWKDILDSGTLCCYRSGAMPIESHISQRLLTDSTTN
                     ATKWQDKNFDALYRQAQSTRDRTARAALYTRMQRRLHAEGGFLVWGFGDWILGTASSL
                     RGVAREAPANTLDWARFDKVWLA"
     gene            complement(547039..547890)
                     /locus_tag="SFLA_RS02275"
                     /old_locus_tag="Sfla_0471"
                     /db_xref="GeneID:11370195"
     CDS             complement(547039..547890)
                     /locus_tag="SFLA_RS02275"
                     /old_locus_tag="Sfla_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014152612.1"
                     /db_xref="GI:503918618"
                     /db_xref="GeneID:11370195"
                     /translation="MRDRTGNLLTDHPELYEARFPDPEHLAGRWAQDVLCRHAAGPTV
                     LDLGCGTGRDAAWLHRAGRRVTAADLSGTMLAHARAHHPGPAYVTADLSRFDFGQRVF
                     DAVVCLDSSLLYCHTNEQLDGFLRSCRRTLVPGGLLVAEMRNGAYFLGRDEPPAAPST
                     ARFTWHGTTYRSTTALRVDRAAQLLRRTRSWTADDGSSPVVEHSAWRLLLPQELRHFL
                     AVHGFDVLALHDGPGPRTEPAWQPGAGTGDTADGDRLHLVARKSTGNPARTPAGDPAH
                     PATGERP"
     gene            complement(547887..549158)
                     /locus_tag="SFLA_RS02280"
                     /old_locus_tag="Sfla_0472"
                     /db_xref="GeneID:11370196"
     CDS             complement(547887..549158)
                     /locus_tag="SFLA_RS02280"
                     /old_locus_tag="Sfla_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014152613.1"
                     /db_xref="GI:503918619"
                     /db_xref="GeneID:11370196"
                     /translation="MNTWNEIRGFPLAIRLLLVNQLGVNTGFYLLVPYLATHLGDDLG
                     MSAAVVGIVLGVRNLSQQGLFLIGGSAADRLGARGVIIAGCAIRTVGFALFALGDGLL
                     VLLAASVLSGLAGALFNPAVRTYLAQEAGERRAEAFALFNVFATTGALIGPLLGSALL
                     LVDFRASALTAAGIFALLTVAQALVLPARQVPPATGSVTADWREAVGNRAFLAFALAM
                     VGMFTLENQLYLLLPAGARHATGWDGAAGLVFLVGTIAGIAFQLRITRALSRRGTRGR
                     WIAAGLVLMGLAFVPPMLVAGTGTPPDGPLDATLRALPVLAGALLLHLGVMVAQPFVM
                     ELIPGFGRKELTGTYFGIFYAVSGIAAAVGNAAVGRAMDAAPGGGGGPAALLPWACCL
                     AAGLVSAGAVTWLHRNGTLPTTRPVPVAVAA"
     gene            complement(549155..550222)
                     /locus_tag="SFLA_RS02285"
                     /old_locus_tag="Sfla_0473"
                     /db_xref="GeneID:11370197"
     CDS             complement(549155..550222)
                     /locus_tag="SFLA_RS02285"
                     /old_locus_tag="Sfla_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="muconate cycloisomerase"
                     /protein_id="WP_014152614.1"
                     /db_xref="GI:503918620"
                     /db_xref="GeneID:11370197"
                     /translation="MKLTQHTVRLTLTEPLRISRSTMTARDAVCLTLEHDGSSGHGEA
                     VTSHFYGLDTPTLQRLAVRTGERLARFADPETALHALHAGELDEPGTPAAMTAATESA
                     LLDLVGKRTATPVHRILGAAAAPRTATARTISLTSPGVAAAQARLLSRAGFSVIKIKA
                     GDRDHATDLDRVRAVRAAAPAARLLLDPNGAWSESRARALLPRFAELGVEAVEQPLAP
                     GDPEALARLAARSPVPVIADEDAVTYEDARRLAGRVHGINVKLAKCGGVHAALRIAAL
                     LEGSGTDLMLGCLTASTLGIAPAVHLGDRARWTDLDGHLLLAHDPWTGIGGADGFVAA
                     AERPGLGVHPRSEARIGSAAP"
     gene            complement(550219..551304)
                     /locus_tag="SFLA_RS02290"
                     /old_locus_tag="Sfla_0474"
                     /db_xref="GeneID:11370198"
     CDS             complement(550219..551304)
                     /locus_tag="SFLA_RS02290"
                     /old_locus_tag="Sfla_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-5'-phosphate-dependent protein subunit
                     beta"
                     /protein_id="WP_014152615.1"
                     /db_xref="GI:503918621"
                     /db_xref="GeneID:11370198"
                     /translation="MTTASLPALAPNRELLALIGRTPLARITTGLPLSHPGFWAKLEG
                     HAVGGMKARAAVSMLLGAEERGELLPGAPVVESTSGTLGIGLAFAGQALGHPVVLVGD
                     SELEPSMRQLLRSYGARLELVDRPKANSGWQGARLDRLHDLLARLPGAYWPDQYNNPD
                     NTAGYASLAAELAGRLAHLDILVCSVGTGGHSAGIAAPLRRHWPGLRLIAVDSTGSTI
                     FGQTAAPRLMRGLGSSIHPRNVAYDAFDEVHWIGPAEAADACRRLARGNFVSGGWSTG
                     AVARVAAWAARTHPGAAVATVFPDGPHRYLGSVYDDDFMTAHRLDPDLAAVRPVDVRH
                     PRVPHSGGWTRCTTVTDPLADSMERQP"
     gene            complement(551301..552179)
                     /locus_tag="SFLA_RS02295"
                     /old_locus_tag="Sfla_0475"
                     /db_xref="GeneID:11370199"
     CDS             complement(551301..552179)
                     /locus_tag="SFLA_RS02295"
                     /old_locus_tag="Sfla_0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152616.1"
                     /db_xref="GI:503918622"
                     /db_xref="GeneID:11370199"
                     /translation="MTTTSHPPALCFDALLDQALRGELGPDPSARRISVAFTTSQAVR
                     HDGRRGGYRNEVLSLRLGRAVGSCAVEPGALPAGAVEDCAGADVAGLLAHPLLPVRVA
                     ALDAYLTDVTPHAPHHGAQPVTVPAGSSLERSQARATAVVDLLEVPPGGTVLVVGVVN
                     SLLYELRSRGLTVVPCDLKGGTTDWGEPIGTDALQEIERCDAVLASGMTLGNGTFDAL
                     RGSALRHRKPLVMFAQTGSAVLPRFLGAGVSAVCAEPYPFFWLDGGPGTIHRYRAGDG
                     GHGTVHRGRPDDGGTS"
     gene            complement(552176..553432)
                     /locus_tag="SFLA_RS02300"
                     /old_locus_tag="Sfla_0476"
                     /db_xref="GeneID:11370200"
     CDS             complement(552176..553432)
                     /locus_tag="SFLA_RS02300"
                     /old_locus_tag="Sfla_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate--amine ligase"
                     /protein_id="WP_014152617.1"
                     /db_xref="GI:503918623"
                     /db_xref="GeneID:11370200"
                     /translation="MAHLLVVESWVGSMSRLLPRALGEGGHHFTFLTRDLQHYLRAAP
                     EGTDHPLLTARNVVTAPTNDLGALLPQVERLHEALRFDGVVTSCDYYLPTAARIAGLL
                     GLPGPSAEAMEKACRKDATRRVLGAAGVPGPRFAVCADGAEAAVAAHDLGYPLVVKPV
                     DLCAGMFVRRVDDEDQLAEACAALAAFPYNARGQRRTPHVLLEEYLRGPEVSVETVTC
                     KGVAHVVGVTDKSVGGAPAFVETGHMFPAALSPDDLAAATGTALSAGAALGLDDVVAH
                     TEIKLTEDGPRVVEVNPRPAGNRITELVRHVTGIDLAAACVDVALGREPDLRPRDTGT
                     RSAAIGFLVPGRAGTLASVEGADRVRDADGVLEVQTAEPGRTVEAADSNNAYLGHVMA
                     GDATGLGARDRVETLLAELRPRLVRS"
     gene            553646..554122
                     /locus_tag="SFLA_RS02305"
                     /old_locus_tag="Sfla_0477"
                     /db_xref="GeneID:11370201"
     CDS             553646..554122
                     /locus_tag="SFLA_RS02305"
                     /old_locus_tag="Sfla_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152618.1"
                     /db_xref="GI:503918624"
                     /db_xref="GeneID:11370201"
                     /translation="MTDSDRGDDVYQPQEPEASDPADLLDLEDTLDTSGLADVLDEGY
                     SPPERPWAVDDEGTTASEQHTGESLDHRLTREVPEGDEPVPDGPGDLADGDGELYDTE
                     VGTDRAGRLTQEGDGHVPSTLTAQDVGIDGAAASAEEAAMHLIPEETYPFGEEPVR"
     gene            554525..556357
                     /locus_tag="SFLA_RS02310"
                     /old_locus_tag="Sfla_0478"
                     /db_xref="GeneID:11371562"
     CDS             554525..556357
                     /locus_tag="SFLA_RS02310"
                     /old_locus_tag="Sfla_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014152619.1"
                     /db_xref="GI:503918625"
                     /db_xref="GeneID:11371562"
                     /translation="MGSQQSHGTGPGNGPVRLALRHYLGELSRQRGLSVFALALPALG
                     NIGITYVAPLVVAKLVGRIAEDGAVGVREALPYVGVFAAVLLLAEAMWRAGLHCLNRV
                     DARGIEHLYVTGMDALFAKDASFFQDNFAGSLTKRVLSFASRFEEFVDTLTFNIVGSL
                     APLLFGAVVLWSYDPLLVAGLLLMITLTAVCAAPLIRRRQKLVNRREEAIARVSGHVS
                     DALMNMDTVRAFAAEEREAAEHRARVAESRRLTLRSWDYGNLRIDTLVAPLSVLTNGL
                     GLLLAVGIGAGGGSVEAIVVAFTYYTGSTRIMFEFNQIYRRLESSMTEAAQFTELLLA
                     PPTVLDPATPEPLAPRAADISFEHVTFAHDGGDPIFEGLQLDVPSGARIGLVGRSGGG
                     KTTLTRLLLRMSDVQSGRIMIGGQDISRLRQSDLRSLIAYVPQEPAMFHRTLRENIRF
                     ARPDATDAEIRAAADAAHVTEFADHLPSGFDTMVGERGVKLSGGQRQRVALARAILRD
                     APILLLDEATSALDSESETLVQQALWQLMEGRTALVVAHRLSTVAAMDHLIVLDHGRI
                     VEQGTHHELLHTDGAYAKLWHHQSGGFLVDTANGEAAATADQAR"
     gene            complement(556424..557422)
                     /locus_tag="SFLA_RS02315"
                     /old_locus_tag="Sfla_0479"
                     /db_xref="GeneID:11371563"
     CDS             complement(556424..557422)
                     /locus_tag="SFLA_RS02315"
                     /old_locus_tag="Sfla_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_014152620.1"
                     /db_xref="GI:503918626"
                     /db_xref="GeneID:11371563"
                     /translation="MLIGEVARRSGVSARMLRHYESLGLVRPTGRSGNGYREYSGDDI
                     RRIFHVESLRSLGLSLRDVGRALEDPGFTPSELVDDLILRTRERIESETELLTRLRRI
                     GAAEPADWQDVLQTVTLLHALGSTSAGTRQRAALSSVDEVPVEALVEAVLGESDQNVA
                     GALRWALAQSGDRGPELLAQGLASPAPEVRKRAVRSLAGIPGGRTTELLGDALTHPDV
                     VVRRYAALELGARGVPDAVPTLVDMVAEEANDADAADVLSALAGSAESAEHIASRLVG
                     RLARGVAGPTARRRLTEALAGIPGSTASRALADLSRDEDRAVALTAAYVLGLREGR"
     gene            complement(557429..558097)
                     /locus_tag="SFLA_RS02320"
                     /old_locus_tag="Sfla_0480"
                     /db_xref="GeneID:11371564"
     CDS             complement(557429..558097)
                     /locus_tag="SFLA_RS02320"
                     /old_locus_tag="Sfla_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152621.1"
                     /db_xref="GI:503918627"
                     /db_xref="GeneID:11371564"
                     /translation="MTTQKQDGPTTRALQGLGDPRPSVRLRAALAVGTSPDPRFVGML
                     VERCAVETEFHVRDMLTWALTRHPAPVTVPVLVEEVRAERAQARSQALHTLSKIGDRR
                     AWPAITRELLSDADDEVARSAWRAAVVLVPEGEEHELAAVLSTQLGRGERETQLSLSR
                     ALVALGDTILPVVHAARTDPDPRVRAHAIATDRLVRDPDSRFEFAIEEAKRVVALGVT
                     GQEG"
     gene            558634..559728
                     /locus_tag="SFLA_RS02325"
                     /old_locus_tag="Sfla_0481"
                     /db_xref="GeneID:11371565"
     CDS             558634..559728
                     /locus_tag="SFLA_RS02325"
                     /old_locus_tag="Sfla_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_014152622.1"
                     /db_xref="GI:503918628"
                     /db_xref="GeneID:11371565"
                     /translation="MSPKFLWYIPNTVEPGHRGDDTTAGWGSVEYSTALAHAAEAHGW
                     SGALLGTGWGRPDTFTVATALAARTTTFEPLIAVRPGYWQPAQFAGAAATLDQLSRGR
                     ALFNIVSGADDVGAYGDTTVEPARRYARTREFLYLLRRLWTEEDVTYGGEFFQVTGST
                     VAPRPYAAGGRAHPTLYFGGASPAAERVSAAEADVQLFWGEPLDGVARRIERLRALSG
                     EVGRRHKPLEYGLRITTLVRDTTEEAWQAAEEKVAALAASDGAAWTGHRGAVGQRRLL
                     DLATRGEVLDTCLYTTPGRYGAAGAATTWLVGSPGDVATALEGYRKLGITHFILSDTP
                     YQQEISRIGDQVLPLLREGSRPREGGVRTP"
     gene            559933..561372
                     /locus_tag="SFLA_RS02330"
                     /old_locus_tag="Sfla_0482"
                     /db_xref="GeneID:11371566"
     CDS             559933..561372
                     /locus_tag="SFLA_RS02330"
                     /old_locus_tag="Sfla_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="WP_014152623.1"
                     /db_xref="GI:503918629"
                     /db_xref="GeneID:11371566"
                     /translation="MSSTAQIGVTGLAVMGRNLARNFARNGYTVALHNRTAARTRELV
                     EQFGDEGDFIATESAEDFVAALERPRRLVVMVKAGEATDAVIAEFAPLLEPGDVIIDG
                     GNAHFADTRRRERELRERGLHFVGTGISGGEEGALDGPSIMPGGSRESYDSLGPMLEQ
                     ISAKAKDGAPCVTHIGPDGAGHFVKMAHNGIEYADMQLIGEAYQLLRDVAGYSPAQIA
                     DIFRTWNTGRLDSYLIEITADVLSHTDAATGKPFVDVVLDQAEQKGTGRWTVQIALDL
                     GVPVSGIAEAVFARSVSGHAALRAASRHLAGPTARPRGKDEAAAFADQVEQALYASKI
                     VAYTQGFHEIAAGSEQYDWNIDLGRVAAIWRGGCIIRAAFLDRITSAYEAQPRMPSLL
                     SDKGFAEEIAAAQDDWRSVIATAVTQGVPTPAFATTLAYYDSLRAERLPAALTQGQRD
                     YFGAHTYHRVDRDGTFHTLWGGDRSEVES"
     gene            561487..562359
                     /locus_tag="SFLA_RS02335"
                     /old_locus_tag="Sfla_0483"
                     /db_xref="GeneID:11371567"
     CDS             561487..562359
                     /locus_tag="SFLA_RS02335"
                     /old_locus_tag="Sfla_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="voltage-gated sodium channel"
                     /protein_id="WP_014152624.1"
                     /db_xref="GI:503918630"
                     /db_xref="GeneID:11371567"
                     /translation="MSERTAARLRRRLAAHSRRVVDSGAFTTTVFCLITANAALLGVE
                     TYTGVVHAWHAALKAAEHLFLAAFTAEILLRAAAHADRPGDFFRDPWNVFDLLVVTVA
                     FVPFARENATVLRLLRLARVLRAARFLPQLRIVIVAVGKSLPGTLSFLLVGALLLYVY
                     AMVGWVFFADDDPEHYGSLGRAILTLFLLMTLDGLGDAVRAGLEISRWSILYFASFVL
                     LGSFVLVNLLIGVVINSLQEASALEAGQDRPVPAQPPPAEESILALRARIADARRTLD
                     DLEAGLEPSVPPRR"
     gene            <562620..563045
                     /locus_tag="SFLA_RS02340"
                     /db_xref="GeneID:23391314"
     CDS             <562620..563045
                     /locus_tag="SFLA_RS02340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018955648.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin"
                     /protein_id="WP_041825560.1"
                     /db_xref="GI:754215117"
                     /db_xref="GeneID:23391314"
                     /translation="ECHAAAGATGLPDGSAHPPLPLPADARDCPTAVSQALNRLRPAG
                     VDGPNRLLLGAEATGTSDHGYPVATHPARQLDGPILWAPAVKGGVPLSTRGGDVELCL
                     GQDLSIGYLDHDATSTRLHFHQPFTFRMPTPEAVVSLIA"
     gene            563192..564478
                     /locus_tag="SFLA_RS02345"
                     /old_locus_tag="Sfla_0485"
                     /db_xref="GeneID:11371569"
     CDS             563192..564478
                     /locus_tag="SFLA_RS02345"
                     /old_locus_tag="Sfla_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_014152625.1"
                     /db_xref="GI:503918631"
                     /db_xref="GeneID:11371569"
                     /translation="MAEGLLGEQRPLAGFLDADGIRDSVDALRAAFAAEPGVRVLHTF
                     AAKAASLVPVLRLLADCGMGCEVASPGELRLAVEAGFPPARIVLDSPAKTRAELRLAL
                     ALGVAVNADSFGEIRRIEELRSPGSPSVLGLRVNPQVGGGSIGAMSTATATSKFGVAL
                     RDPGARERVVQTFAERPWLTRLHAHVGSQGCSLELITAGIAETYRLAEEINEALGTRR
                     ITGMDIGGGLPVNFSDDESRPAFAEYVTALRAAAPGMFDGRYELVTEFGRSLLAKNGF
                     IGARVEYTKEAGGRRIALTHAGAQVATRTVFMPDAWPLRVGAFDGEGNPRSGRTMVQD
                     IAGPCCFAGDLVAQARELPELHEGDFVVLYDTGAYYFSTPWSYNSLPRPAVYGFAGGS
                     GGLRFAPVREAQSLDSMAAESGLRHADALRDLRAQP"
     gene            complement(564938..565363)
                     /locus_tag="SFLA_RS02350"
                     /old_locus_tag="Sfla_0486"
                     /db_xref="GeneID:11371570"
     CDS             complement(564938..565363)
                     /locus_tag="SFLA_RS02350"
                     /old_locus_tag="Sfla_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate decarboxylase"
                     /protein_id="WP_014152626.1"
                     /db_xref="GI:503918632"
                     /db_xref="GeneID:11371570"
                     /translation="MMRTMFKSKIHRATVTQADLHYVGSVTVDADLMDAADLLPGELV
                     HIVDIDNGSRLETYVIEGERGSGVIGINGAAAHLVHPGDLVILISYAQVDDAEARALV
                     PSVVHVDAANRIVALGTDASAPVPGTRTERSPQAVPART"
     gene            565690..566070
                     /locus_tag="SFLA_RS02355"
                     /old_locus_tag="Sfla_0487"
                     /db_xref="GeneID:11371571"
     CDS             565690..566070
                     /locus_tag="SFLA_RS02355"
                     /old_locus_tag="Sfla_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding domain 1 protein"
                     /protein_id="WP_014152627.1"
                     /db_xref="GI:503918633"
                     /db_xref="GeneID:11371571"
                     /translation="MRWGKTVCTIGLVGVLSVPAAGVSTAAPVETRTAAAVSCRLLDF
                     IGYYCGYHLSNTYADRGDSGAKVQELQALLVFKGFSVGSSGVDGQFGAGTESAVRRFQ
                     TSRGISSDGVVGPTTWHYLRTPGL"
     gene            complement(566184..567617)
                     /locus_tag="SFLA_RS02360"
                     /old_locus_tag="Sfla_0488"
                     /db_xref="GeneID:11371572"
     CDS             complement(566184..567617)
                     /locus_tag="SFLA_RS02360"
                     /old_locus_tag="Sfla_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum metabolism regulator"
                     /protein_id="WP_014152628.1"
                     /db_xref="GI:503918634"
                     /db_xref="GeneID:11371572"
                     /translation="MPRTTTYLELSQDGAGAHKFYEVAVEGTEVTVRYGRIGADGQSQ
                     TSAFPSEAKAQAAAVKKIGEKVRKGYAPAVRGQRAARAVTRRQVTSAPSTARAVAPVL
                     WRFRTGQAAFGIHVGEDRCWVGNQAGDVYTVSHGGEVLAHYKLPDGVKCLVADDFWIY
                     AGCDDGKVYDLSSKLPFAAYDIAADVDIFWLDIREGVLNVSDRAGGLTVIDHEDEYQW
                     ARRSTGEHGWMVRADERAVYHGHHQGVTAYAPDGSGELWHTPTSGQVLFGWQEDDSVY
                     AGTARNVVQRLSKATGVVEATFRCDTAVYACATAPGGRFVFAGDSSSSVYCFDADGTR
                     LWKLGTGGGSALSMQFFEDKLYMVTTDGSLVCLDASPAAVAAAQQGTVPVAADIKSAA
                     ALPTYTPAATVTTVTLPPPGAVVVECVQDAGRLRVHVVSDGFEPSWNVQFPRAMRQPG
                     ARYVVDALHPAEAGFYRVRGEIRRLVR"
     gene            complement(567768..568802)
                     /locus_tag="SFLA_RS02365"
                     /old_locus_tag="Sfla_0489"
                     /db_xref="GeneID:11371573"
     CDS             complement(567768..568802)
                     /locus_tag="SFLA_RS02365"
                     /old_locus_tag="Sfla_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152629.1"
                     /db_xref="GI:503918635"
                     /db_xref="GeneID:11371573"
                     /translation="MLGLLLRLLPFWVREPLFIVIGSVFGVRIMYLAVRDEAWVPGAI
                     GVAFLLATAVRVHTVARALRARRNPAPAVSEGGAVSGAVVRSQPQPQPQPQGPAGQRP
                     APAAPRKEPNAWGQAVAAVAVFAALGAALWLGPNLLPSGDNSSPRAPSCPSGEDEELP
                     SAYTGASRAVTGGQLCEALNRTDLARLLGTPTETATVVSGTSDTALLTDGKVARPEAE
                     VRFDTYTVNVSATYNELSIAQYVKLMEFGEETDVKTLSVLGRPAVLSSDHTMSIDLDL
                     DLGLGSGGSGGPVGQGPPARTLTVALDGKDPGGYYEITVWSTSGALPDDGALVDIAET
                     VLPAVPEQAV"
     gene            complement(568943..570751)
                     /locus_tag="SFLA_RS02370"
                     /old_locus_tag="Sfla_0490"
                     /db_xref="GeneID:11371574"
     CDS             complement(568943..570751)
                     /locus_tag="SFLA_RS02370"
                     /old_locus_tag="Sfla_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_014152630.1"
                     /db_xref="GI:503918636"
                     /db_xref="GeneID:11371574"
                     /translation="MTTPHASVPEELIALRQRYRLERERRVRPDGAGQYRDTEAEFGY
                     YAADPYTAEPAERAPLHDTVDVAVVGGGFGGILAGARIRQQGVRRVRVVEKGGDFGGT
                     WYWNRYPGIHCDIESHVYLPMLDETGYVPEWKYAPGEEIRRHAVRIAEKSGLYPDALF
                     STAVTSLTWDEDSETWIVATDRGDEFRATYVVTATGTLSEPKLPGIPGIEDFTGHTFH
                     TSRWDYAYTGGTPDGGMTGLARQRVGIVGTGATGIQVVPMLAEDAGHVYVFQRTPSTV
                     DVRANCRTTAADVGADRAGWAHDRRENYLRIVSGETAERDLVADRWTASAGLLEKLLP
                     SFRRQGDREAFEAAYELADAAKMNELRARVEETVADPDTAEALKPWYRYACKRPTFSD
                     AYYPAFNRDNVTLVDTADTHGIERITENGVMVGDTTYELDCLIFATGFSVGASGITSG
                     KLPVHGRGATQLLHAWAKEGPRTLHGFTSNGFPNLIQMGSLQNASSVNFTHILDEQAV
                     HAAALVAAAEAEGALIEPSREVQDAWIAVLAEGAPDHEWFHADCTPGYYNREGRGRPN
                     GPIAYPHGAFAFHELLARWRKESMAEVLRARTAARG"
     gene            570963..571982
                     /locus_tag="SFLA_RS02375"
                     /old_locus_tag="Sfla_0491"
                     /db_xref="GeneID:11371575"
     CDS             570963..571982
                     /locus_tag="SFLA_RS02375"
                     /old_locus_tag="Sfla_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152631.1"
                     /db_xref="GI:503918637"
                     /db_xref="GeneID:11371575"
                     /translation="MRRHLIRPLAVFAALGTLTLTGCGTETGEPGGRTASAGTDRTIR
                     AHEVMQLTQVHKETGMTLLEGPTFDRNGKLIVVDVTAPAGKPKVMRVDVRKKTSSALH
                     TDSRGAYTSAQFSPYDGRLYLTDYAHGEVVSLAPDGSDPRTFFTGEVDGARMNPDDIA
                     FDEAGHLYVSDSRGLSEGEAQGRVVRIDRDGTKATTLADGLAATNGISFDADYRGLWI
                     SELTQNRISYLRTDDKGGVTSKHTAVRVDGGIAQTDSIAVDADGNLYQALHGRAAMAV
                     YDRNGKRLATVEVPTRAAGLESATNVAITPGGTKAYMTVSGPAGGYLYTFDAMAEGTR
                     QSNGG"
     gene            complement(571998..572588)
                     /locus_tag="SFLA_RS02380"
                     /db_xref="GeneID:23391315"
     CDS             complement(571998..572588)
                     /locus_tag="SFLA_RS02380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_033249383.1"
                     /db_xref="GI:702730765"
                     /db_xref="GeneID:23391315"
                     /translation="MIQHSSPDERRPANDGPKAAARNRTALVVAAREVFSAGGLDAPL
                     SAIARRAGVGQGVLYRHFPDRGALVTAVLEENVRQIEQAAAVDGATLAGVLGVLTWHA
                     VESAAFIGLMHADEAGGRSGIRAHASMLSERVERSLRGRLPDGHRLGAADDLMLAVAM
                     VTGAVTGPTREERERRALAAWRLLGVEVGPVRPYDG"
     gene            573302..574537
                     /locus_tag="SFLA_RS02385"
                     /db_xref="GeneID:23391316"
     CDS             573302..574537
                     /locus_tag="SFLA_RS02385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041825282.1"
                     /db_xref="GI:754214661"
                     /db_xref="GeneID:23391316"
                     /translation="MPRSGDLAQRRATLEDEWSRVIPGLSSPGSLRRAGRVLSREVAD
                     SWARSLASVDPARTHAPESSDGAAHHRWNGSPLRGPVDGLADELRSVADDAGFVTAVT
                     DASGTILWTCGGRTMRRRAERVNFAPGGRWDEEAMGTNALSLALRTGRPSTVFSAEHL
                     VTALHGWVCYCAPLHGPDGRVLGVLDLSTTWDRSHPLAMATVRGLASAVEAGLRIGTS
                     GAPLLADAPALRLTCLGAEDAVRAGARLRLRPRQLEILTLLALEPEGYAPERLRASLY
                     GDRPVTASTLKAEISHLRRALGGTVATRRYALTAPVSCDAVDVLRALRSGDTGTALRL
                     YRGPLLPRSQAPGIEEWRTCLEVAVREAVLTSDRPEHALRYGERAPYDTEVHRHALRL
                     LDAGDARRAIATGRLASTA"
     gene            574655..576172
                     /locus_tag="SFLA_RS02390"
                     /old_locus_tag="Sfla_0494"
                     /db_xref="GeneID:11371578"
     CDS             574655..576172
                     /locus_tag="SFLA_RS02390"
                     /old_locus_tag="Sfla_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005311948.1"
                     /note="catalyzes the oxidation of acetaldehyde,
                     benzaldehyde, propionaldehyde and other aldehydes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_014152634.1"
                     /db_xref="GI:503918640"
                     /db_xref="GeneID:11371578"
                     /translation="MVYAQPGTEGSIVAFAPRYDNFIGGEWVAPVEGRYFDNPSPVNG
                     KVFCEVARSSAADVELALDAAHAAADRWGRTSATERANILNRIANRLEEHLEKIAVAE
                     TWENGKPVRETLAADIPLAIDHFRYFAGVVRAQEGSIAEIDADTVAYHFHEPLGVVGQ
                     IIPWNFPILMATWKLAPALAAGNCVVIKPAEQTPASLLLVVELIADLLPPGVVNVVNG
                     FGIEAGKPLASSSRVAKVAFTGETTTGRLIMQYASENIIPVTLELGGKSPNIFLPDVM
                     AADDDFLDKAVEGLVMFALNSGEVCTSPSRALVHSSIYDEFMARCVERTRAIVSGDPL
                     DPATMIGAQASNEQYEKILSYVDIGRKEGAEILTGGTPRTVAGLEDGFYIEPTVFRGT
                     NDMRIFQEEIFGPVLSVTTYDSVSEALKIANDTLYGLGAGVWSRDGNTAYRLGREIKA
                     GRVWTNCYHAYPAHAAFGGYKNSGIGRENHKMMLDHYQQTKNLLVSYSPKKLGFF"
     gene            576429..577634
                     /locus_tag="SFLA_RS02395"
                     /old_locus_tag="Sfla_0495"
                     /db_xref="GeneID:11371579"
     CDS             576429..577634
                     /locus_tag="SFLA_RS02395"
                     /old_locus_tag="Sfla_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041825283.1"
                     /db_xref="GI:754214662"
                     /db_xref="GeneID:11371579"
                     /translation="MVFDVELAAERLPPEWAEGPLPALRADAPAADRERRLTYFEPRV
                     GESLFGTPAHPSRWHLHNPAEADEPAVKAMELLRVPAAAGLGRRTAGLCVLHVHLGDD
                     PRTELTALAALPTDHARLARLLPSGVRVADGASRAWTLTHMTFDQGPPPAVMPAPYAS
                     WDTHDQWLWLLASRTPLERFAPDPEDTALFAGRVRFSADWQALVLRDGTAFVGLSADP
                     GGDQTFHATAAHHVHTIYLDVFLLGRLQHLGANSLANTVSALTAREADVHRLLRLEGR
                     LIELRRALWSSHITTRGKADELLERFQEQHRLDRLLTHTGTTLAETARYVEAARSRRA
                     SVALGLLSAVGLPFGVAYAAGALWGTPGPWTLLVATVVALLLTVAAFVSLPPLRGLVS
                     DTAWDRVED"
     gene            577638..579428
                     /locus_tag="SFLA_RS02400"
                     /old_locus_tag="Sfla_0496"
                     /db_xref="GeneID:11371580"
     CDS             577638..579428
                     /locus_tag="SFLA_RS02400"
                     /old_locus_tag="Sfla_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152636.1"
                     /db_xref="GI:503918642"
                     /db_xref="GeneID:11371580"
                     /translation="MALVALYRSAPLRQRISKGYSVYVPGHGRGAEELVGSLLAGPPP
                     LPAGPSGQPHTVRGSARARGALWVDTGRVSLHDPATRARTAEALAVSVARVAADVRRR
                     GGLLLPTGWQQQPDPLAGLCADLHSAEVLNPVQREVFTNLVREHTASLIALGGRQLYG
                     PGGVAPGGSARLSRSFDQVSTRYLDSCAPEHLERVRTRLRQEERVGRLEVMDVSPLGM
                     PEAHTGEDVTVRLFDAQVTVAGTLAHALLVQALSMWSRDLERTGRRVRQVPQFLLEQN
                     RARAVAHGLAAELRVDQTRRTEEPPRTQSAGRAVRTLLSELLPYLRQLDATTDELAPL
                     FLGVEMAGSAAASGFVRNENDLLAHWHREDRTALAPERLAQGLATPDWLTADHCGASN
                     KAVGHGSWAAARVWLTDRLAGPAPQPDRRHEAQPDRRHEAQRDRREPGRPAPLTADQL
                     LDRLARPDLPAPEVMDALRSYCRAGGTLDLTRPLRSRGRDEARALRRVLRPRAGQRVR
                     CEKPPVSWDDATATRALRAAGEQGVALMHWDLPAQDRARVREALRGMGRAPGGVRTVL
                     LTDTNYTAREDEKRGTVEVLLVAPREGTDR"
     gene            579425..580705
                     /locus_tag="SFLA_RS02405"
                     /old_locus_tag="Sfla_0497"
                     /db_xref="GeneID:11371581"
     CDS             579425..580705
                     /locus_tag="SFLA_RS02405"
                     /old_locus_tag="Sfla_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152637.1"
                     /db_xref="GI:503918643"
                     /db_xref="GeneID:11371581"
                     /translation="MTQETPVVPVTLDLREFRDVPRSTDACVSLWERLEPAVLTLDPQ
                     AGPRVRFDLGDEGEVGVWFLDPASAPRPLGATTRFAIRGVLEAPEIRHACTTCLTAHT
                     TTYAPYKCPGCDEGRRMGRACEEHAVFLEGSLRASCLGHTPVCRCGARAKVWCGGPKC
                     RTRTAWCETHLRRHPGDPTVAYCEDCYAERFPACEHEHCTGSGYIRCEHRTLSGMKPC
                     GRRICTEHARRWQVYGSYNRGLALCTPHHLRLSSTPPEGLIDMILAGTVARSSRGRSA
                     TRRRVQLPRISIVRHILINTRRAVLDMEAIDLLFTALEQGLRGRTPRDTNLSTALDLL
                     SRHRVSRREDVERFRKQHVEGRGHYDRLVQELRRGGRYELAEAVEFSDFRPRSGILFV
                     RVPERLQGLFRGKGGSSVRQLEQRVGVKIQVERG"
     gene            580702..582687
                     /locus_tag="SFLA_RS02410"
                     /old_locus_tag="Sfla_0498"
                     /db_xref="GeneID:11371582"
     CDS             580702..582687
                     /locus_tag="SFLA_RS02410"
                     /old_locus_tag="Sfla_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="WP_014152638.1"
                     /db_xref="GI:503918644"
                     /db_xref="GeneID:11371582"
                     /translation="MTAFKLSAAGTRLVTATGPGLVADNRLAVSPSQLTDETAGVLRV
                     HDSGGTRSVAVRLLPAAGVPADVVVVPAALVQEHRVTPEEGWELESADATVPAALELE
                     LPPGPSLDEATTVLRGAPLLCGHVFAHGFETSPDVWIEASGSLFRVRAALDRGGLPLQ
                     GLLRVGPETALTLFAPGERSGVDIVVLADCSGSMSIEDIPAAPSDGGRWFNRGRTSAG
                     ISRMNALKDALGAMIDARMRYDGVGTRFALVRFDHDHEPMFPSRWGMEEVSDAHSVQR
                     LREAVSLLNYRQSGTDIGKALHKAGELLHRYGVPGNERLVVLVSDGAHYAPIPDERSG
                     ESVSGTQDPVSLMEDLHAGLDIRLHAVGISDDALFDRWWQAQRHRPGWAPQAHESMVP
                     NHRMLVDLVTVAGGDRQRIGGLDVLEKYFAELGSGVVRAVGRPARPRLPALQLTPERL
                     AAEPLRRAATDPRQRRTWDAAAEDTLVAYSRVCEASRARLGYQLLRSSPPDDFTRLRR
                     QCGDRADFTAWLSVAYQVFNERLHAPLRIPRKDPAKVLDLPQLAAAFWDGRMSQLHEL
                     RNFYHHDRDMEERAERNRVAGGIIHKHTGSYAPSENDADAWRALQLGLVRDLAALLNE
                     AHAILDAAPAPEAAPQEPAESGPASAGGIRVKSQGYE"
     gene            582882..583220
                     /locus_tag="SFLA_RS02415"
                     /old_locus_tag="Sfla_0499"
                     /db_xref="GeneID:11371583"
     CDS             582882..583220
                     /locus_tag="SFLA_RS02415"
                     /old_locus_tag="Sfla_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152639.1"
                     /db_xref="GI:503918645"
                     /db_xref="GeneID:11371583"
                     /translation="MSRRTNRSAARPRSGRTRVVAAALTGALAVVTLTGCAGFAYQED
                     ICGGGEYPVLSVGGTGSACVPDAEEPPAGYARYPEGKVPQQVDDKWDVYWDTHTLDKD
                     GNTVVAPDAA"
     gene            583389..584312
                     /locus_tag="SFLA_RS02420"
                     /old_locus_tag="Sfla_0500"
                     /db_xref="GeneID:11371584"
     CDS             583389..584312
                     /locus_tag="SFLA_RS02420"
                     /old_locus_tag="Sfla_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="WP_014152640.1"
                     /db_xref="GI:503918646"
                     /db_xref="GeneID:11371584"
                     /translation="MPTRPSDAAQEPRTVVGVDGSEHARAAVLWGAADASAHRRSLLL
                     VHAADLDRLDRFASFETSEHLRDAGNSLLTTAAEEIRERFPELDVAVKLSRRKPVPAL
                     HASARPGSSIVVGSRGSGGFGPLLLGSTGLEVVVGSPAPVVVVRGGAGREDAPVTAAV
                     RDVHDARWLVRAGREAQARERALRLVNVHSLLARFDGTARDANGRAGDRGEELMAELA
                     SRVRESAPGLTVETEVVAARSAASALVEASGHAGLLVMGSHERRSVSVLGLGHVVHAL
                     LHHSRCPVQIVPYRRDDESGVVEEGLRDDEG"
     misc_binding    584475..584659
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            584689..585399
                     /locus_tag="SFLA_RS02425"
                     /old_locus_tag="Sfla_0501"
                     /db_xref="GeneID:11371585"
     CDS             584689..585399
                     /locus_tag="SFLA_RS02425"
                     /old_locus_tag="Sfla_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-specific component CbiM of cobalt ECF
                     transporter"
                     /protein_id="WP_015579777.1"
                     /db_xref="GI:505392675"
                     /db_xref="GeneID:11371585"
                     /translation="MHIAEGFLPPAHAIAWGVASAPFVVHGVRSLSREVRENPESTLL
                     LGASGAFTFVLSALKIPSVTGSCSHPTGTGLGAILFRPPIMAVLGTITLLFQALLLAH
                     GGLTTLGANVFSMAIVGPWAGYAVFRLLRRYDVPLMVAVFFGAFVADLSTYCVTSVQL
                     ALAFPDPSSGFPGALGKFGSIFAVTQIPLAVSEGLLTVLVMRLLVQSSKGDLTRLGVF
                     LTRKQARTEKAETEAVAR"
     gene            585396..585764
                     /locus_tag="SFLA_RS02430"
                     /old_locus_tag="Sfla_0502"
                     /db_xref="GeneID:11371586"
     CDS             585396..585764
                     /locus_tag="SFLA_RS02430"
                     /old_locus_tag="Sfla_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transporter CbiN"
                     /protein_id="WP_014152642.1"
                     /db_xref="GI:503918648"
                     /db_xref="GeneID:11371586"
                     /translation="MNKNTKINALLLVVVAALAVLPLALGLGDGEKEPFTGADAQAET
                     AITEIDPDYEPWFSPLYEPPSGEIESALFALQAALGAGVLAYYFGLRRGRRQGELRAT
                     TGQERRGAGGGAEEPTVRKA"
     gene            585771..586520
                     /locus_tag="SFLA_RS02435"
                     /old_locus_tag="Sfla_0503"
                     /db_xref="GeneID:11371587"
     CDS             585771..586520
                     /locus_tag="SFLA_RS02435"
                     /old_locus_tag="Sfla_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transporter"
                     /protein_id="WP_014152643.1"
                     /db_xref="GI:503918649"
                     /db_xref="GeneID:11371587"
                     /translation="MLPIDAAAHSSRWRRRHPVDKAALGLGLTALAVSLPPWPGAALV
                     LVAALAVLLGPAGVTARHLWRAYRVPLGFCVTGAATLLVQVGGPRGLVALDPGGPVRA
                     GELLLRTSAASLGVLLFAFTTPMSDLLPRLVRAGVPAPVVDVALVTYRMSFLLLDAVR
                     RIREAQAARLGHTTRAAAWRSLAGLGATAFVRAFDRAARLQTGLAGRGYDGTLRVLVP
                     EARVSARFVALSVLLLAVLTILTFALERPLS"
     gene            586517..587392
                     /locus_tag="SFLA_RS02440"
                     /old_locus_tag="Sfla_0504"
                     /db_xref="GeneID:11371588"
     CDS             586517..587392
                     /locus_tag="SFLA_RS02440"
                     /old_locus_tag="Sfla_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter"
                     /protein_id="WP_014152644.1"
                     /db_xref="GI:503918650"
                     /db_xref="GeneID:11371588"
                     /translation="MSEPVLLALRGASFAYEDGPAVLSGLDFEAREGRALALLGRNGS
                     GKTTLMRLLSGGLRPREGQLAVEGSPVTYDRKGLTRLRTTVQLVVQDPDDQLFAASVS
                     QDVSFGPLNLGLPDAEVRARVDEALAALDITALADRPTHLLSYGQRKRTAIAGAVAMR
                     PRVLILDEPTAGLDPDGQERLLGTLGALRDGGTTVMMATHDVDLALRWADDAALLTPA
                     GVRAGPAPTMLARTDLLGEAGLRLPWGVAASQLLRSHGLLEDSAPGPRTAEQLAAHVA
                     APTAAGSATTDGRRP"
     gene            587863..588255
                     /locus_tag="SFLA_RS02445"
                     /old_locus_tag="Sfla_0505"
                     /db_xref="GeneID:11371589"
     CDS             587863..588255
                     /locus_tag="SFLA_RS02445"
                     /old_locus_tag="Sfla_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152645.1"
                     /db_xref="GI:503918651"
                     /db_xref="GeneID:11371589"
                     /translation="MRAATVRFVLAFLMSFLLAPYSGTASADAHTYGPGMRADGVPDA
                     TTGAAHLAHGPCGTAERGSEPSGLLRHRDRHRTATAPASETPPRSVVTRDADGAVAPA
                     AFAALGNAPHSSRSSGAHSSPALQVFRC"
     gene            588521..590005
                     /locus_tag="SFLA_RS02450"
                     /old_locus_tag="Sfla_0507"
                     /db_xref="GeneID:11371591"
     CDS             588521..590005
                     /locus_tag="SFLA_RS02450"
                     /old_locus_tag="Sfla_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_014152647.1"
                     /db_xref="GI:503918653"
                     /db_xref="GeneID:11371591"
                     /translation="MDRVRTFPYLRQDFAASLVVFLVALPLCVGVAVASGVPAELGLV
                     TGIVGGIVTGLMRGSSLQVSGPAAGLTVLVFEAVQSFGLPALGVIVLTTGLLQVGMGA
                     LRLGRWFRAISVSVVEGMLAGIGLVLIAGQLYAAAGVDAPASGTGKVTGIPGLLVDAV
                     SSPAALTSLALGACTIALVVGWSRMPKRVRAVPGALAAVVLATLATLAFDLPVETVRV
                     QGLLDAVQVPALSEFGGLATLSLLGTIAAFTLIASAESLFSAAAVDRLHDGPRTQYDK
                     ELMAQGTGNTVCGILGALPMTAVIVRSSANVQAGARTRASRVLHGVWLLLFAALLPSA
                     LALIPLPALAGILIHAGWKLIPLRSLVPLWREHRGEALILVVTAVAIVTINMFEGVLI
                     GLALSVAKAAWDASHIKLEVVDSSPDGVRARLSGNATFLRLPKILDSLEALPDDRPVS
                     LDLSGLHHLDHACRTALENWAERHSSSGTEPVRLTRDDVVTTAP"
     gene            complement(590092..591132)
                     /locus_tag="SFLA_RS02455"
                     /old_locus_tag="Sfla_0508"
                     /db_xref="GeneID:11371592"
     CDS             complement(590092..591132)
                     /locus_tag="SFLA_RS02455"
                     /old_locus_tag="Sfla_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014152648.1"
                     /db_xref="GI:503918654"
                     /db_xref="GeneID:11371592"
                     /translation="MKAVQYRTVGAAPEVVEIPEPVAGPGQILLKVTAAGVCHSDIAV
                     MSWPAEGFPYELPLTLGHEGVGTVAALGEGAVGVSVGDSVAVYGPWGCGTCVNCAEGR
                     ENYCLRAADLGINPPGLGNPGAMAEYMIVDDARHLTPIGDLDPVKTVSLTDAGLTPYH
                     AIKRSLPKLLPGATAVVIGTGGLGHVAIQLLRAMTAVRVVALDVTEEKLSLARAVGAH
                     EAVLSDENAAAKVRELTGGIGAKVVFDFVGAEPTVKAAGAMASVDSDVTIVGIGGGLL
                     PVGFGVLPFSTSVTAPYWGSRKELAEVIELAHAGAVDVHVETYSIDEAPLAYERLHAG
                     KINGRAVILPNG"
     gene            complement(591196..591972)
                     /locus_tag="SFLA_RS02460"
                     /old_locus_tag="Sfla_0509"
                     /db_xref="GeneID:11371593"
     CDS             complement(591196..591972)
                     /locus_tag="SFLA_RS02460"
                     /old_locus_tag="Sfla_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014049826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014152649.1"
                     /db_xref="GI:503918655"
                     /db_xref="GeneID:11371593"
                     /translation="MSTHLPTAYEAEFAGKVALVTGGASGIGLALSRRLAASGAAVVV
                     ADHNEESARKAAAELEATGARAAAVALDVTDPASVEAGVRFVVDTFGGLHLAVNNAGI
                     GGPSLPTGEYGIEDWNRVVATNLSGVFYSMRYELPAILAAGGGAVVNISSILGTNGFA
                     GSPAYAAAKHGVVGLTKSAALEYAAQNVRINAVGPGFIDTPLLRDTDGPARDHLVSLH
                     PAGRLGTSEEVAELTAFLLSDRASFIHGSYHLVDGGYSAS"
     gene            complement(591969..592637)
                     /locus_tag="SFLA_RS02465"
                     /old_locus_tag="Sfla_0510"
                     /db_xref="GeneID:11371594"
     CDS             complement(591969..592637)
                     /locus_tag="SFLA_RS02465"
                     /old_locus_tag="Sfla_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014152650.1"
                     /db_xref="GI:503918656"
                     /db_xref="GeneID:11371594"
                     /translation="MPETGKAPERRSRKARRTRDALARSAFDLVLDRGLRDVTVEEIA
                     QAADVDRRTFSRYFPSKEAAVLDTVRGDGDRINRALRERPPAEPPLTAYRRAVLAWLS
                     DAEAEPWHLRPRVFDLLAMAEEEPTLYAAYHHIRVDAQEESVAILAERLGVDPRQDLR
                     PAVTVAAGAGALLAAQAAWVRGGRPAALPEFVVHAFDALSTDLLESRQDGPAPHSTTQ
                     GSTS"
     gene            complement(592802..594928)
                     /locus_tag="SFLA_RS02470"
                     /old_locus_tag="Sfla_0511"
                     /db_xref="GeneID:11371595"
     CDS             complement(592802..594928)
                     /locus_tag="SFLA_RS02470"
                     /old_locus_tag="Sfla_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152651.1"
                     /db_xref="GI:503918657"
                     /db_xref="GeneID:11371595"
                     /translation="MSTASKPVRRLFLVPVFLVLAWLVVGGAFGSYAGKLGEVATNDQ
                     ASFLPQSAESTRVVEAQKAFSSQETVPAVVVWTSAEGEELGPQQQKEATAALASVKGG
                     TGVTGEVSPALLSDDRKALEGVVQLKPDLGDELPDALAEIRSAAEKVPGTVVGLAGPA
                     ASQADLSDAFAGIDGLLLGVALVTVLVILLLVYRSVLLPLIIIVGAVFALGVSCAIVY
                     VLADHDIVRVDGQVQGILSILVIGAATDYALLLTARFREELGRCPDRWTAMRAALRES
                     AGPIAASAATVALGLLALLLSDLTNNRALGPVGAIGIVCSVLSALTFLPAVLVLLGRA
                     AYWPSGPKKGQAEPEAGSTGIWSRVAGLVDRSPRKVWAVTLVGLVACAAFMPTLNSKG
                     VPLEEIFVNEAPSVTAQETLGRHFPGGSGNPAVVIAGADRSKQVAAAAEEVPGVASVS
                     VMSSSGRPGAGEPLVVDGRVRIDATLSAAADSDAAKETITKLRDAVHAVPGADALVGG
                     YTAQQYDTQKTAEHDRNIIVPVVLVIILVILIGLLRSLLMPLLLVATVALNFLATLGI
                     SSLVFEHVFGFSGTDSSVPLYGFVFLVALGVDYNIFLMSRVREESLIHGTRQGVLRGL
                     TTTGGVITSAGVVLAATFAALGVIPLAFLVQIAFIVAFGVLLDTLVVRSLLVPALVRD
                     IGPTAWWPGVLSRSREETPEKAESLT"
     gene            complement(595024..595548)
                     /locus_tag="SFLA_RS02475"
                     /old_locus_tag="Sfla_0512"
                     /db_xref="GeneID:11371596"
     CDS             complement(595024..595548)
                     /locus_tag="SFLA_RS02475"
                     /old_locus_tag="Sfla_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_014152652.1"
                     /db_xref="GI:503918658"
                     /db_xref="GeneID:11371596"
                     /translation="MSSGAPYHGAVDSADDPRDGPGVQATGVQELQALAVELRRMNGE
                     INRLVHAFAHAQGLHATDVQALGAILDSDTPLTPGRLREHLGLTSGAVTACLDRLERA
                     GHIRRARESSDRRVVHLYYESGARSAARSFFMPLAEAAAGARAASGPQELEAALRFLA
                     RMNGELSRMQVPRR"
     gene            595666..596673
                     /locus_tag="SFLA_RS02480"
                     /old_locus_tag="Sfla_0513"
                     /db_xref="GeneID:11371597"
     CDS             595666..596673
                     /locus_tag="SFLA_RS02480"
                     /old_locus_tag="Sfla_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="WP_041825284.1"
                     /db_xref="GI:754214664"
                     /db_xref="GeneID:11371597"
                     /translation="MDATMVFKKLLGSLGVGGPTVDTVLRPGAVVPGGGLSGEVRLRG
                     GSTDSTIEHITLELVAHVEAEHEDGEAEGAVVFERFTVAGGFVLAEGEERDVQFTLTL
                     PWETPVTELYGQDLGIVLGVRTELSVSGARDKGDLDRLTVGPLPAQEAVLEAFGQLGF
                     GFRSADLELGHIGGSGQRLPFYQEIELSPAPQYADRINEIEVTFLAGPDALDVVLEAD
                     KRGGRFSGGGDALGRHTVGHHEVQGRDWATEVDGWIRPLAEAHASYGAHETYGAHETY
                     GHGGGHEQHRSGPGMGTVVAAGAAGVAVGVVGGLVAAEVVDEVGDFFEGDEEEEEGDE
                     G"
     gene            596801..597040
                     /locus_tag="SFLA_RS02485"
                     /old_locus_tag="Sfla_0514"
                     /db_xref="GeneID:11371598"
     CDS             596801..597040
                     /locus_tag="SFLA_RS02485"
                     /old_locus_tag="Sfla_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase"
                     /protein_id="WP_014152654.1"
                     /db_xref="GI:503918660"
                     /db_xref="GeneID:11371598"
                     /translation="MFGISEIAIFLIIAILIFGAKKLPELARSMGKSARILKSEAQAL
                     KSDGKPPVVHPEPYAEGADDPRVIRGTATEKPGPR"
     gene            597171..598682
                     /locus_tag="SFLA_RS02490"
                     /old_locus_tag="Sfla_0515"
                     /db_xref="GeneID:11371599"
     CDS             597171..598682
                     /locus_tag="SFLA_RS02490"
                     /old_locus_tag="Sfla_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_014152655.1"
                     /db_xref="GI:503918661"
                     /db_xref="GeneID:11371599"
                     /translation="MESKDDDGGLRCLVTGATGYIGGRLVPELLEAGHQVRCLARTPE
                     KLRDYPWAGEVEVAEGDVTDAESLGAAMRGIDVAYYLVHALASGPGFEKTDRDAARTF
                     GEQAKAAGVRRIVYLGGLTPADVPERDLSPHLRSRAEVGHILLASGVPTTALRAAVII
                     GSGSASFEMLRYLTERLPVMVTPSWVSTRIQPIAVRDVLRYLVGSARMPADVNRTFDI
                     GGPDVMTYRDMMQKYAEVATLRKRLILPVPMLSPGLSSHWVGLVTPVPASIARPLAES
                     LRYEVVCHEHDIAEHVPDGPGQPFSFATALSLALQRVREAKVSTRWSSASTPGIPSDP
                     LPTDPDWAGGSLYTDERELDVDASPEALWRVIEGIGGVNGWYSFPLAWAVRGWLDRLV
                     GGVGLRRGRRDAQRLRVGDSLDFWRVEEIEPGRLLRLRAEMRLPGLAWLEMYAEEGRD
                     GRSHYRQRALFHPFGLLGHAYWWSVSPFHAVIFGGMARNIAQAADRQTESTQR"
     gene            598679..600058
                     /locus_tag="SFLA_RS02495"
                     /old_locus_tag="Sfla_0516"
                     /db_xref="GeneID:11371600"
     CDS             598679..600058
                     /locus_tag="SFLA_RS02495"
                     /old_locus_tag="Sfla_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="WP_014152656.1"
                     /db_xref="GI:503918662"
                     /db_xref="GeneID:11371600"
                     /translation="MTVAIVLFTSDLRLHDHPPLHAALASSDEVVPLFVLDPGVEAAG
                     FAAPNRRAFLADCLRDLDSGLRDRGGRLVVREGEVAEEVRRIVSETEAGVVHMAAGIS
                     GYAQRREERLREALSSVGCRLSVHDAVVTAVAPGSVVPSGAGRDHFAVFTPYFRRWSG
                     EGLRSPFGAPRKVRVPEGPGSAALPSRAGTRGLSPGLAEGGETEGRRLFTAWRRDGLA
                     SYEDRHDDMAGDATSRLSPHLHFGTLSPTELVHRARATGGPGAEAFVRQVCWRDFHHQ
                     VLATRPAVSRSDYRPKQDRWRTGRAAEADTAAWKEGRTGYPVVDAAMRQLLHEGWMHN
                     RGRLLTASFLAKTLYVDWRTGARHFLELLVDGDIANNQLNWQWVAGTGTDSRPNRVLN
                     PVTQAKRYDPEGAYVRRWVPELAGIPGSAVHEPWKLPREDRRRYDYPEPVVGLSDGLA
                     RFKEARRLD"
     gene            complement(600080..600856)
                     /locus_tag="SFLA_RS02500"
                     /old_locus_tag="Sfla_0517"
                     /db_xref="GeneID:11371601"
     CDS             complement(600080..600856)
                     /locus_tag="SFLA_RS02500"
                     /old_locus_tag="Sfla_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_030879919.1"
                     /db_xref="GI:664352269"
                     /db_xref="GeneID:11371601"
                     /translation="MDVGARAGFVARGVIYLLVGILALRIGFSDGGGKQADRGGAIAE
                     IAEKPFGNVLLWALGIALAGMALWRLSEAAFGQAGPDGDKATKRAMAAGRFVFYAFVS
                     YSVISYAAGDKGSGSGSSDKQTDDVTARALEWPGGPWIVGIAGAVVAGAGLWIAFRAL
                     ARKYHKHLKMAEMSKRVRQAVDVVGVFGGTVRGVVFATAGGFAIAAAVQHEPGRAKGM
                     DDTLRSFAETPAGPWLLVLVALGLAAFGLFSWANARWRKV"
     gene            complement(600965..601504)
                     /locus_tag="SFLA_RS02505"
                     /old_locus_tag="Sfla_0518"
                     /db_xref="GeneID:11371602"
     CDS             complement(600965..601504)
                     /locus_tag="SFLA_RS02505"
                     /old_locus_tag="Sfla_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_014152658.1"
                     /db_xref="GI:503918664"
                     /db_xref="GeneID:11371602"
                     /translation="MACINRRDFGLLVLRVGTGAVLAAHGSQKLGGWFGGGGIQGTTA
                     AMEAMGFHPPKHSALAAGLGEAGGGLLLALGLATPAAGAAAAGTMAGAVAVHAPAGFF
                     AMGGGYEYPAFLGFTAAAIGVTGAGRYSLDHATCHVLDRPWVVALAFAGSALAAAAVV
                     GRRAKDQAAAQSGPEGDGA"
     gene            601712..603727
                     /gene="fadH"
                     /locus_tag="SFLA_RS02510"
                     /old_locus_tag="Sfla_0519"
                     /db_xref="GeneID:11371603"
     CDS             601712..603727
                     /gene="fadH"
                     /locus_tag="SFLA_RS02510"
                     /old_locus_tag="Sfla_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579767.1"
                     /note="catalyzes the formation of trans-2- enoyl-CoA from
                     2,4-dienoyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="WP_014152659.1"
                     /db_xref="GI:503918665"
                     /db_xref="GeneID:11371603"
                     /translation="MSPYPTLLSPLDLGFTTLPNRVLMGSMHIGLEEVEHGFERMAAF
                     YAARARGGVGLMVTGGIAPSERACSFPGGARMTTEAEAEQHREVTAAVHAAGGRIAMQ
                     ILHFGRYAHHPDLVAPSALKAPISGFTPHALTDDEVEETVEDFVRAAELARSAGYDGV
                     EIMGSEGYLINEFIVAATNHREDRWGGSYENRIRFPVEIVRRVRERVGPDFILIYRLS
                     MLDLVPGGSTLEEVVQLAREVEAAGATIINTGIGWHEARIPTIATSVPRGAFTWVTER
                     VRGAVSVPLVTSNRINTPELAEEVLASGRADMVSMARPFLADPDFVAKAAEGRADAIN
                     TCIGCNQACLDHIFSLQITSCLVNPRACHETELVLAPTRLRKRVAVVGAGPAGLACAV
                     TASERGHAVTLFDAADEIGGQLNVARRVPGKEEFDETLRYFRTRLAEEGVELRLGARA
                     GSADLDGFDEVVLATGVEPRTPAIPGVGHPSVVSYLDVLRDGAEVGDRVAVVGAGGIG
                     FDVAEFLTDGGDGASLDPEVFFRQWGVDTGYADRGGLRAPERPKPGRTVHLIQRKATK
                     VGAGLGKTTGWIHRTELRHRGVTMIAGASYDLIDDEGLHLTVDGEQHLLPVDTVVLCA
                     GQEPRRELYEELRAAGRPVHLIGGADVAAELDAKRAIRQGTELAAEL"
     gene            603762..604301
                     /locus_tag="SFLA_RS02515"
                     /old_locus_tag="Sfla_0520"
                     /db_xref="GeneID:11371604"
     CDS             603762..604301
                     /locus_tag="SFLA_RS02515"
                     /old_locus_tag="Sfla_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_014152660.1"
                     /db_xref="GI:503918666"
                     /db_xref="GeneID:11371604"
                     /translation="MSLPHAILTALLEKPSSGLELTRRFDRSIGYFWPSTHQQIYREL
                     GKLEKAGHIRVLSAAQPARGQRKEYEVLPAGREELMAWVSLAEDPRPVRDPLLLRMRA
                     AAVVGSAGLAGQLRRHLALHRAQLAEYLEIEERDFPPERTSDEDRLRRLVLRGGIDLE
                     TFWTGWLTRAIDDLDGPGS"
     gene            604515..605075
                     /locus_tag="SFLA_RS02520"
                     /old_locus_tag="Sfla_0521"
                     /db_xref="GeneID:11371605"
     CDS             604515..605075
                     /locus_tag="SFLA_RS02520"
                     /old_locus_tag="Sfla_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_014152661.1"
                     /db_xref="GI:503918667"
                     /db_xref="GeneID:11371605"
                     /translation="MVKARIARTGISLVAAAAAVVATTSSAQANSGFSAEKYEQIQFG
                     MTFDEVWEIGGGEAACDTGGVIGDSILCFTESGDYAPYGGFSFTDEGELWSKRNEYLY
                     KAKTPSVRLSHYNRTALGMTEAQLWAAVPKDSCVSQGESYPNWPAKTGFEEKYYCAAA
                     TGLFPPSASFHLTDGVLTYRYQRSLT"
     gene            complement(605104..606108)
                     /locus_tag="SFLA_RS02525"
                     /old_locus_tag="Sfla_0522"
                     /db_xref="GeneID:11371606"
     CDS             complement(605104..606108)
                     /locus_tag="SFLA_RS02525"
                     /old_locus_tag="Sfla_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152662.1"
                     /db_xref="GI:503918668"
                     /db_xref="GeneID:11371606"
                     /translation="MNATLAAVALSLVSAGAYAAAAVAQARLAGRTDPSAGVLRLLGR
                     GAWWSAVGLNAGGALLHVAALKYGPLTLVQPLGALTLVAAVPLGARSAGRRVSRTEWR
                     GTLLTLVGLGALLLAAGGTSPRDTLSLPEALGVGAVTMALVAVLGRPGTRPGLRHAAA
                     SGITSGVASALTQTLTVAATDHSGPLLSWRLVTVAVLVSFFALGGLMLSQTAYRGGLG
                     APLAVVTLANPVAAAVIGLILLGERLQGGVLGLVPALIGAAAAGQGVLLLSRAQAGGP
                     SAVPAPVPAGRPSRVVASGPAPSVPHAPEAPAPRAAPAGPPGGFPVGRAVAREKTAAG
                     "
     gene            complement(606105..606917)
                     /locus_tag="SFLA_RS02530"
                     /old_locus_tag="Sfla_0523"
                     /db_xref="GeneID:11371607"
     CDS             complement(606105..606917)
                     /locus_tag="SFLA_RS02530"
                     /old_locus_tag="Sfla_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative integral membrane protein"
                     /protein_id="WP_015579763.1"
                     /db_xref="GI:505392661"
                     /db_xref="GeneID:11371607"
                     /translation="MMHTRSEPAEREPDTSARPPLVRELLLVAGLFLVYKLGRQAANG
                     HVEEAFHNAGHVWSFERAVGLPGEGAVQGVLLHSHTLVQAANTYYATVHFPATLAFLV
                     WLYWRRPRHYVWSRRVLAALTGAALALHLLFPLAPPRMLRAAGLVDTGQVYGPTVYGD
                     TPATDSMANQFAAMPSLHVGWAMAVAVGLIVATRSRWRLLWLLHPLLTLLVVVGTANH
                     YWLDAIVVGALLAVAYAALRLPRTPVRAHLPWPAAPARNYASPAYARSGAQR"
     gene            607080..607724
                     /locus_tag="SFLA_RS02535"
                     /old_locus_tag="Sfla_0524"
                     /db_xref="GeneID:11371608"
     CDS             607080..607724
                     /locus_tag="SFLA_RS02535"
                     /old_locus_tag="Sfla_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014152664.1"
                     /db_xref="GI:503918670"
                     /db_xref="GeneID:11371608"
                     /translation="MPSPGSAQESAPASRRSKITPERAQELYTAVLDLLRESGYDSLT
                     MEGVASRTRCGKSTLYRQWGSKPELVVAALHGTRRTLFSDIDTGSLSGDLREAARVVD
                     AASGQDTALMHALSHAALQNPDLLCAMRSTLIAPAITAIDAMVERAVRRGEIAADNPA
                     AEYVAAQVLGIMRARPLLEGRYADDAFLARFIECAVLPALGLPVPPPAPGVSGT"
     gene            607936..608949
                     /locus_tag="SFLA_RS02540"
                     /old_locus_tag="Sfla_0525"
                     /db_xref="GeneID:11371609"
     CDS             607936..608949
                     /locus_tag="SFLA_RS02540"
                     /old_locus_tag="Sfla_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152665.1"
                     /db_xref="GI:503918671"
                     /db_xref="GeneID:11371609"
                     /translation="MADITRRFGWRHLRSAPTAHIRHHKRGRLTHDGPGLSFWYRSLS
                     AALSEVPVDDRELAMAFHARTADFQDVTVQATVTYRVSDPAAAAARLDFSVDPDTGVW
                     RGTPLEQTATLLTETAQQHTLDVLARTPLAAALVDGVAAVRERVAAGLSAEPRLPDTG
                     IDVVAVRVVAIRPEAEVERALRTPAREQIQQEADRSVYERRAVAVERERTIAENELAS
                     KIELARREEQLVDQRGTNARREAEEKSAADGVRSAAEAARTVRLARAEAEAAREVGAA
                     RAEAQSAWLRAHADVDPATLHALAATRLAENLPRIDSLTLSPDVLSGLLARLGRPEPE
                     ARA"
     gene            608946..609845
                     /locus_tag="SFLA_RS02545"
                     /old_locus_tag="Sfla_0526"
                     /db_xref="GeneID:11371610"
     CDS             608946..609845
                     /locus_tag="SFLA_RS02545"
                     /old_locus_tag="Sfla_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="WP_014152666.1"
                     /db_xref="GI:503918672"
                     /db_xref="GeneID:11371610"
                     /translation="MSLAPRAVLVHRTTEYEELLARHGTHGQAAFVLAGRGRSIDEVA
                     ERHRRNEQALAEVAAAVPLRWRRSRVERADLDRFLFGPEDVVVVVGQDGLVANAAKYL
                     SGQPVVGVDTDPGRNPGVLVRHRARDTAALCRAAVSPGARVDALTMTEAVADDTQRLL
                     ALNEIYLGSPGHQTARYRIDTRGGPPSGESQASSGVLVGTGTGSTGWLRSLWLERGSP
                     LPLPAPSDRRLVWFVREAWPSPATGTSMTVGELGLRDGLRLTVESDRMVVFGDGMESD
                     ALELTWGQSIRLGVSDTTLNLVA"
     gene            609910..610413
                     /locus_tag="SFLA_RS02550"
                     /old_locus_tag="Sfla_0527"
                     /db_xref="GeneID:11371611"
     CDS             609910..610413
                     /locus_tag="SFLA_RS02550"
                     /old_locus_tag="Sfla_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_014152667.1"
                     /db_xref="GI:503918673"
                     /db_xref="GeneID:11371611"
                     /translation="MTADPRGALPRNTRPPAAQASLGVGVVVQDGQGRILLGRHHGGT
                     WELPGGKVDPTHESVAAAAARELREETGLRVAADDVTVFAMVHDVVAGINRISMAALV
                     QVDTAVPRVTEPELIRTWRWIAPEELPRPLFDPSAQILAVWRPDLAIEHPAAHHLPIA
                     HAPQALP"
     gene            610464..610958
                     /locus_tag="SFLA_RS02555"
                     /old_locus_tag="Sfla_0528"
                     /db_xref="GeneID:11371612"
     CDS             610464..610958
                     /locus_tag="SFLA_RS02555"
                     /old_locus_tag="Sfla_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152668.1"
                     /db_xref="GI:503918674"
                     /db_xref="GeneID:11371612"
                     /translation="MRAVSEQDIRASFVNCSKGEAKRLPLPRDLDERRWEDLDFLGWR
                     DLSAPDRSYIVTELRGELTGITLRFPSQQRGFLHRSMCSVCLTTHPGSGVSLMTARKR
                     GQAGRDGNSVGIYLCTDLDCSLYVRGRKSPAPGGRFEESLTVEQQIERTRGKLTAFLD
                     LLAA"
     gene            611030..611437
                     /locus_tag="SFLA_RS02560"
                     /old_locus_tag="Sfla_0529"
                     /db_xref="GeneID:11371613"
     CDS             611030..611437
                     /locus_tag="SFLA_RS02560"
                     /old_locus_tag="Sfla_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152669.1"
                     /db_xref="GI:503918675"
                     /db_xref="GeneID:11371613"
                     /translation="MDDYPLLNLFLTMMYVFLWVLWFFLLFKVVTDVFQDHSLGGWAK
                     AAWVIFVIVLPYVGVFVYLIARGRGMGRREAEQAREREAAFKQYVKQAARDEGGTDTG
                     TGHVSDLAKLADLKDRGHLSQEEYEKAKQKLLV"
     gene            complement(611499..612167)
                     /locus_tag="SFLA_RS02565"
                     /old_locus_tag="Sfla_0530"
                     /db_xref="GeneID:11371614"
     CDS             complement(611499..612167)
                     /locus_tag="SFLA_RS02565"
                     /old_locus_tag="Sfla_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014152670.1"
                     /db_xref="GI:503918676"
                     /db_xref="GeneID:11371614"
                     /translation="MTSNQATGRAGRSAVAGGIKEALAAGDMVPGQRLVEQELSEVFG
                     VTRSSVREALQDLAAEGLVELIPRRGARVRVISVEEAVQITECRALLEGLCARRAAEY
                     ASDTVRRELQDIGADMRRAVADGDPDAYSVLNRRLHERVGEVSGQKVAQALLDRMNGQ
                     MVRYQFRLALRPGRPAQSLPQHLAIIDAVVAGDPDAAEAAARAHVDSVVEALRDTPAP
                     VRPG"
     gene            612375..613400
                     /locus_tag="SFLA_RS02570"
                     /old_locus_tag="Sfla_0531"
                     /db_xref="GeneID:11371615"
     CDS             612375..613400
                     /locus_tag="SFLA_RS02570"
                     /old_locus_tag="Sfla_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalomesaconate hydratase"
                     /protein_id="WP_014152671.1"
                     /db_xref="GI:503918677"
                     /db_xref="GeneID:11371615"
                     /translation="MIIDCHGHYTTAPPALEAWRNQQITGLQDPSAAPRRADLRISDD
                     ELRESVESNQLRLMDERGIDMTVFSPRASFMAHHVGDVATSSAWAALCNELCFRVSRL
                     YPERFVPAAMLPQSPGVDPATCVPELTRCVEEYGAVALNLNPDPSGGHWTAPPLTDRS
                     WYPLYEKMAEYDVPAMVHVSTSVNPAFHTTGAHYLNADTTAFMQLVQGDLFRDFPTLR
                     LVIPHGGGAVPYHWGRFRGLATALGKPPLEEHVLGNVFFDTCVYHQPGSDLLFDVVPT
                     RNILFASEMIGAVRDVDPRTGHHFDDTRRYVEAAGLSPEELAGVQEHNARAVYPRLDA
                     LLKRQGR"
     gene            613429..614112
                     /locus_tag="SFLA_RS02575"
                     /old_locus_tag="Sfla_0532"
                     /db_xref="GeneID:11371616"
     CDS             613429..614112
                     /locus_tag="SFLA_RS02575"
                     /old_locus_tag="Sfla_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152672.1"
                     /db_xref="GI:503918678"
                     /db_xref="GeneID:11371616"
                     /translation="MYELGVVHRTVRRPDPADVEALKPFGVSTVHEAMGRTGLMRPYI
                     RPVYPGAELRGTAVTVLLQPGDNWMLHVAVEQLQPGDVLVAACTTECEDGFFGELLAT
                     SVRARGGAGLVIDGGCRDVGELREMDFPVFSRAVNSKGTVKATLGSVNVPVVCANAPV
                     NPGDVVVADVDGVVVVPAGRVAEVADASRRREDNEESKRRRLAAGELGLDMYGMREPL
                     EAAGLRYVD"
     gene            614230..615150
                     /locus_tag="SFLA_RS02580"
                     /old_locus_tag="Sfla_0533"
                     /db_xref="GeneID:11371617"
     CDS             614230..615150
                     /locus_tag="SFLA_RS02580"
                     /old_locus_tag="Sfla_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-pyrone-4,6-dicarboxylate hydrolase"
                     /protein_id="WP_014152673.1"
                     /db_xref="GI:503918679"
                     /db_xref="GeneID:11371617"
                     /translation="MSVPSPRTPGWLDWYRDPSVPAFRLPAGTVDTHCHVFGPQAQFP
                     FAPERKYTPCDAGKDELAALHARLGVSRAVVVQATCHGADNTALTDAVRAAGDRARGI
                     ATVRPDVSGAELRALDAAGVRGVRFNFLRRLVDTSPKEDLTTIAAKIAPLGWHIVLYF
                     ESADLPELEGFFGSLPTPLVVDHMGRPDVTQPVDGPQFARFLRFVDTNDVWVKVTCPE
                     RLSVTGPAALHGERNAYTDVVPFGRRVVEEFGDRVLWGTDWPHPNLTGHMPDDGLLVD
                     HVPHIAVTPEQQRRLLVDNPMKLYWPGEGV"
     gene            615194..616552
                     /locus_tag="SFLA_RS02585"
                     /old_locus_tag="Sfla_0534"
                     /db_xref="GeneID:11371618"
     CDS             615194..616552
                     /locus_tag="SFLA_RS02585"
                     /old_locus_tag="Sfla_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly protein HesB"
                     /protein_id="WP_014152674.1"
                     /db_xref="GI:503918680"
                     /db_xref="GeneID:11371618"
                     /translation="MQHANAANRLDRLPISRFHKTTLLAVAFAYFFEFADINSFATTA
                     PKLIDLWGVTVDQVAYVTSLSFVGMFLGSIAAGAVADRWGRKKTLLRTTLFFGFFSFV
                     SVFSWDVFSLGVFRVLTSAGLSAMTVVAVIYVNEMYPAAVRGKYQAYAMVIGICGTPA
                     TNLVASLVVPLSDWSWRLVYLWGALGVLLVLFSKHLRESPRWHESRGDHAAADAVLRE
                     IEASVSAEKGPLAEPAAPVEEPPAVKAPLRLLLRKRYLAPTLLLTVLWVTQTIGFFGY
                     SSFAPTLLAKEGFSVEKSVFYIALTTVGAPLGSFLASLVTDRFERKWCLVAFGTVIAL
                     CGLLYGLTFDPVLIVVFGFLVNLFERGYTALAYAYSPELFDTRSRSLGTGITYGIGRL
                     SNAAGPLIIASLYNRTGYQSVFYFIAGVWMVGAVALAVFGPRTRPRRPAVRKPKAVTS
                     AS"
     gene            complement(616618..617244)
                     /locus_tag="SFLA_RS02590"
                     /old_locus_tag="Sfla_0535"
                     /db_xref="GeneID:11371619"
     CDS             complement(616618..617244)
                     /locus_tag="SFLA_RS02590"
                     /old_locus_tag="Sfla_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylated DNA repair protein AlkB"
                     /protein_id="WP_015579752.1"
                     /db_xref="GI:505392650"
                     /db_xref="GeneID:11371619"
                     /translation="MSVHLQGSLFDQADRPHLGRLTGLRRTVLGDGAWIDLLPGWLSG
                     ADELFSVLAEGVPWRAERRQMYDRTVDVPRLLAFYRADDDLPSPVLDEARDALSRHYG
                     DELGEPFTTAGLCYYRDGRDSVAWHGDLTGRSSHQDTMVAILSLGAPRDLLLRPCRGG
                     ATVRRPLGHGDLIVMGGSCQRTWQHAVPKTAQARGPRISVQYRPRGVR"
     gene            complement(617284..618060)
                     /locus_tag="SFLA_RS02595"
                     /old_locus_tag="Sfla_0536"
                     /db_xref="GeneID:11371620"
     CDS             complement(617284..618060)
                     /locus_tag="SFLA_RS02595"
                     /old_locus_tag="Sfla_0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_014152676.1"
                     /db_xref="GI:503918682"
                     /db_xref="GeneID:11371620"
                     /translation="MSARPAAPALRRRDADRRFGIRLFGSAAAAAVAAVLFGLVLVLV
                     ESGWHPLRRLDAGAARWLNRTALDHPAWTGTLRFFSDVVWDPVTLRAAVAVLTLWLVY
                     RRAWRLAAWSAVTAVAGGLIGLLAKTVVERARPALPDPVAHAPGFSFPSGHAMTATTS
                     FAILLLVLLPLVRRGWRPLLWAVAVVSVLGVGFTRVALGVHWFSDVAGGWTLGLAVVA
                     LTGWSFEAWRADAGLGHADVAEGLEPELSGDDPEATGPNP"
     gene            complement(618061..619014)
                     /locus_tag="SFLA_RS02600"
                     /old_locus_tag="Sfla_0537"
                     /db_xref="GeneID:11371621"
     CDS             complement(618061..619014)
                     /locus_tag="SFLA_RS02600"
                     /old_locus_tag="Sfla_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease BN"
                     /protein_id="WP_014152677.1"
                     /db_xref="GI:503918683"
                     /db_xref="GeneID:11371621"
                     /translation="MGTATRVPQTRDMIGSELSGDEALVTLRRYGRWPLLRDSFVRFR
                     YADGFSHSRALALQTVLAVVPLVIAFVGLSTALHTENLGRVAELTIQRITAGPSAEVV
                     EDALDRSRRRADDGAQLALWFGLVFSLTNTTTAMCQIERGANRIYGVERDRVFHRKYL
                     RGLVMSLTAGIPLGIGFVAMVAGGDLVAAVVDVYDLGAGARSAWDMLRWPAGVLLVIL
                     SASAIFRRSPRRRQPGYTWLAFGAAVYLVLWTTLTWLLSLYLEVSGSFDTVYGPLTAF
                     MSLLLWAYLTSIALFLGLSFAAQLEAVRAKRPGPVQPDPGA"
     gene            complement(619016..620770)
                     /locus_tag="SFLA_RS02605"
                     /old_locus_tag="Sfla_0538"
                     /db_xref="GeneID:11371622"
     CDS             complement(619016..620770)
                     /locus_tag="SFLA_RS02605"
                     /old_locus_tag="Sfla_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_014152678.1"
                     /db_xref="GI:503918684"
                     /db_xref="GeneID:11371622"
                     /translation="MPTDIPERPAVLAAGRSRPLPAPAGPERPHGVAERPARAPETAG
                     GMSRAVGIIASTAVCQAALMVGLGLLITGPGARVWPLTSEDEVNEALERARTGTLDTV
                     SLVVSEAGNTVTVVVGTLLTCLLLLLVPRLPRWRDALFLAVAVSLQSLVFLVITEAVD
                     RTRPDVERLDASPPTSSYTSGHTGAATALYAGLAVLVLHRVRGPWRKPVAVLLFLVPL
                     LVGLARAYRGMHHPTDVAGGLLNGGLSLLIVGRALLAGPHVPAAAPAVDTPAAGLPAA
                     TEAGPTTVVYNPTVTDEAERARLRRVLEDHGRPGADFVPTTADDPGEGQTARAVRDGA
                     SLVVVCGGDGTIRAAADALAGTGVPLAVVPCGTGNLLARNLGLPVKPADALAGALGGT
                     PHRIDLGRVEGDGMEAAHFTVMSGAGLDAAMLESTSDRAKAVLGWPAYVMAGLRELRA
                     PRMRLTVGIDGARPLRRTARMVLVANTGKVQGGAALVPAARPDDGLLDLMILDPRGPA
                     GWLSAVASVVRPRPTGENDHAGTHRAVEYFTFRRAEIRFETPQQRELDGDPVTPGRRL
                     VAEVRPGALTVLMPAGGE"
     gene            621116..622405
                     /locus_tag="SFLA_RS02610"
                     /old_locus_tag="Sfla_0539"
                     /db_xref="GeneID:11371623"
     CDS             621116..622405
                     /locus_tag="SFLA_RS02610"
                     /old_locus_tag="Sfla_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152679.1"
                     /db_xref="GI:503918685"
                     /db_xref="GeneID:11371623"
                     /translation="MTTPLADYAQFAGKRIAIVEHMQNHPFVLGLRQAQEHGLEVWLL
                     TGDRSWYTHGHDWDTHPLAIVDRVIDVDTTDLDAVLAVVTGEDGAPLVDGLTSFSDYH
                     TELAARAAQRLGLPGPDPEAVRTANIKDHLRIALGDEPFNIPHVLVGHRGQLDEAARR
                     LGFPMIAKPPAEAISYGVRRVDDMAGLVEAWEELSAVRHSLRGQPRSGDVLLEQYVEG
                     EEVSVETMTVDGHTHVFGVTSKDLFGDPAYIECGHTFPVPLSDEERDELYHVVRTTLE
                     MIGYRHGPCHTEVRRTESGWRIIEANPRTPSSCMTMLVTDVTGRSPILDAWLLTIGVT
                     PPIEPVVHRGGAAVRMIYPTRRGTLSHIDGLEAAAAVENVQVLLHVEKGDHLLQRMDN
                     SSCVGFTYCNGPDRLAAQELADKAAALLDFVVEEDLR"
     gene            622402..623577
                     /locus_tag="SFLA_RS02615"
                     /old_locus_tag="Sfla_0540"
                     /db_xref="GeneID:11371624"
     CDS             622402..623577
                     /locus_tag="SFLA_RS02615"
                     /old_locus_tag="Sfla_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152680.1"
                     /db_xref="GI:503918686"
                     /db_xref="GeneID:11371624"
                     /translation="MSPYTEGPDAQGPDAVRAVADAAGLEAAGWSSLLGAEDFFQTPR
                     WLAVQEVNSGTAMDFLLRERAGAPVAGLVTAWADTSVAWLLARPDAMLRRALEQEVPE
                     AAGVLRDVAGGDPDRLLPSLVCGGRHLGRTRTLASPDATADDLSALLDRAEAMAADRG
                     AATVCFPHVDVRDTSLTGLLESRGYRHHPSDHYAWLDIPSGGFEQFVEEMSAHRRRRV
                     RLERRALAEAGVEVNVEPLTQALCPRLGELDANLLRKYGNPASDEGSARMIGRIAEIM
                     GDDVLVSVARQHGSIIGFGMVLRSRARGEEQWYGHRAGFDYEAQGKLPLYYDVLYYQV
                     LDAAAKEGATVLHAGIGSVKAKLARGCQASEQRSYLLPVHRTEGAADAPSDDRETTT"
     gene            623577..625280
                     /locus_tag="SFLA_RS02620"
                     /old_locus_tag="Sfla_0541"
                     /db_xref="GeneID:11371625"
     CDS             623577..625280
                     /locus_tag="SFLA_RS02620"
                     /old_locus_tag="Sfla_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014152681.1"
                     /db_xref="GI:503918687"
                     /db_xref="GeneID:11371625"
                     /translation="MSDATNLREGAGWNAAVGAVVAPSGRRGGTLRLVSSADVDSLDP
                     ARTYYVWVWLLQRLLNRTLMAYPTDPGPAGLVPVPDLAEGPGVASDGNRTWTYRLREG
                     VRFDDGTPVTSADVRYAVQRIFAQDVLPGGPTYLVPLLDDPDRPYAGPYRDGEDGLPS
                     VLTPDARTIVFRLRTPFSDFDHLMAQPCVSPVPRHADTGARYGEDPRCTGPYRVAEHR
                     AGSRLLLERNPHWDRATDPVRPALPDRVDVAIGFDPDEMDERLIAGEFDINLEGRGLQ
                     HAAQDRLAGDPVLRSRTDNPKTSFLHFVSLQPHIPPFDNVHVRRAVHHAADKILLQEA
                     RGGPVTGGDLTTALFPPGLPSHQALDRYPTGPDLRGDLDAARAELEAAGLPDGFDAVI
                     GTQRGKFRLVADAVVESVARVGIRLTVKELDVATYFSQGAGSPETIRKHGLGMIVTDW
                     GADFPTEYGFLAPLVDGRLIRPGGGNWNIAELDDPKINELIDTGLHTADPAARTELWR
                     EVERRVMDHAVILPLVHDKTLHYRGPRATDVFVHPAFGLYDIQAMGVTDTRTDRETDT
                     A"
     gene            625277..626308
                     /locus_tag="SFLA_RS02625"
                     /old_locus_tag="Sfla_0542"
                     /db_xref="GeneID:11371626"
     CDS             625277..626308
                     /locus_tag="SFLA_RS02625"
                     /old_locus_tag="Sfla_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_014152682.1"
                     /db_xref="GI:503918688"
                     /db_xref="GeneID:11371626"
                     /translation="MNDTAADLRFVPLEADDVPTVDAWLRLTTESAEDVPLSAAPHCA
                     ADLTGSVRFAPPDTSLAGEVAFLGGQAVGALRLVLPDGAPVAVVDQLLTAPKERRQGI
                     GTALFRRARSLAAEHGRTLLVADVVQALPGGPVRDEGPAAFAAALGATVSDGPEGVHQ
                     WLDLDRHDPSADGVPEVPAGYRLQRWGTVTPDAFAIAVSELGQSLGASPPETWGEGPD
                     AVRTSHVRRYERMRVGRGRRAYHVGAVHEATGELAGFTSASKTTGNPEHLLQGMTVVA
                     AAHRGHGLGLVLKLANLAHVREYEPRVRLIETANADDNRPMIALNEAMGFVPQERFVS
                     WEAPVAPAV"
     gene            complement(626260..627243)
                     /locus_tag="SFLA_RS02630"
                     /old_locus_tag="Sfla_0543"
                     /db_xref="GeneID:11371627"
     CDS             complement(626260..627243)
                     /locus_tag="SFLA_RS02630"
                     /old_locus_tag="Sfla_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152683.1"
                     /db_xref="GI:503918689"
                     /db_xref="GeneID:11371627"
                     /translation="MTARDRSLAVLVAVLWGLNFLAVRVGLDHFPPFFLAALRYLVLA
                     VPVVLFVPRPGVPLRWLLGYGLGFGVAQFGLLFLAIEQGMPSGLASVVVQASAPFTVL
                     LGALLLRERVTGRQLAGIGLAVLGMVVIAVDRSRTAPLMPLVLTVLAALGWAVGNLAS
                     RQAKPEYPLRFALWMAVVPPLPLLALSAVMEGPATGWRALGSAFGPEGWPGLVALVYI
                     AVLGSVVGSGIWTALLKRYPAGVVAPFSMLVPVVGLVGAWLALDERPTGWAVAGGAVV
                     VAGVLLGTGWLPRFARERAAAPRLPEEGGGGRPTGTQTAGATGASQETKRS"
     gene            complement(627240..628538)
                     /locus_tag="SFLA_RS02635"
                     /old_locus_tag="Sfla_0544"
                     /db_xref="GeneID:11371628"
     CDS             complement(627240..628538)
                     /locus_tag="SFLA_RS02635"
                     /old_locus_tag="Sfla_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_014152684.1"
                     /db_xref="GI:503918690"
                     /db_xref="GeneID:11371628"
                     /translation="MIDLPGSDASARARAALDGDDTPLGSRTRWAAELLTAPEAPRDD
                     DLSEHFVPVFLARHPQGFAATLEQWRGLGPFTVTEYQPVAHKSWVTLEGPSGTRSTLS
                     LTLDSTGLIRVLHLGPEVVTPAVHGWDDLEAALEQPGVTWSALVTREEGGTTETLYAR
                     EADRPMPNGSSYKLYLMRALADAVASGSVRWDDEVTVTPALRSLPTGDMQELPDGARV
                     SVRETAYKMIAMSDNTAADLIQDLLGRDAVERAVVEGGHSDPALLRPFLSSHEVFEIG
                     WGAPGLRAEWVAADEDGRRRLLDRIAGPMTVRGSDLGATVHQLGLDWHMSAWDVARVL
                     GALADDGTRDTSGAVEDILTAYPGVPVDAARWPRVVFKGGSCPGVMMFCWLLQDPDGV
                     RYTLVLQQRADDQKLIGDGQFLRGMGGRVIGSGLLSGTSR"
     gene            complement(628574..628786)
                     /locus_tag="SFLA_RS02640"
                     /old_locus_tag="Sfla_0545"
                     /db_xref="GeneID:11371629"
     CDS             complement(628574..628786)
                     /locus_tag="SFLA_RS02640"
                     /old_locus_tag="Sfla_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_014152685.1"
                     /db_xref="GI:503918691"
                     /db_xref="GeneID:11371629"
                     /translation="MSAGRLRVSVDTDACCSMGRCAATEPRVFEQDDESGTVVLLQAA
                     PPPELHETVRLCADLCPCTAITVTED"
     gene            complement(628783..630015)
                     /locus_tag="SFLA_RS02645"
                     /old_locus_tag="Sfla_0546"
                     /db_xref="GeneID:11371630"
     CDS             complement(628783..630015)
                     /locus_tag="SFLA_RS02645"
                     /old_locus_tag="Sfla_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_014152686.1"
                     /db_xref="GI:503918692"
                     /db_xref="GeneID:11371630"
                     /translation="MTQDAASPKATAVPSYPMERVSPIDPPPPLALLRSGPAASRITM
                     WDGSQVWLVTAHAHVRAVLGDRRFTAVTSAPGFPMMTTTSPLVRDKPHTASFIRMDDP
                     DHARLRSMLTRDFLHGRAEAMRPVLREHLDEMLGELTRGERPVDLVRGLTIPVPSRVI
                     ALLFGVSDEQRELIENRAGILIDRGYPPAQVAAARDELDGLLRDVVEERMRMPEPGDD
                     LLSRLVVDQVRTGKLTVEEMVPMCRLLLVAGHGTTTSQASLSLLSLVTDQGLADALDK
                     DPELLPKAVEELLRYHSIVQNGLARAALEDVELGDVTIRAGEGVVVSLSAGNRDASVF
                     PDPDTLDPGRDARRHLAFGHGIHQCLGQWLAKVELEEMLAAVLRWMPGARLAVPFAEL
                     DFRHEVSSYGLGALPVTW"
     gene            630257..631000
                     /locus_tag="SFLA_RS02650"
                     /old_locus_tag="Sfla_0547"
                     /db_xref="GeneID:11371631"
     CDS             630257..631000
                     /locus_tag="SFLA_RS02650"
                     /old_locus_tag="Sfla_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014152687.1"
                     /db_xref="GI:503918693"
                     /db_xref="GeneID:11371631"
                     /translation="MSSSLEGHVALVTGAGSGIGRATARALASAGASVAVAGRRVDRL
                     EELRDELEAEGGTVLVLELDVTDEQAVGAAVRAAVETLGRLDILVNNAGLMLLGPVEN
                     ADTTDWTRMMDTNVMGLMYTTHAALPELIRNQGTIVQISSIAARVVGRGSAVYNATKF
                     AVNGFSEGLRQEVTERGVRVVVIEPGTVETELREHITHAPSKAAIAERVAKIRQLQSE
                     DIAAAVLYAVTAPPHATVNEIFIRPTDQA"
     gene            631163..632629
                     /locus_tag="SFLA_RS02655"
                     /old_locus_tag="Sfla_0548"
                     /db_xref="GeneID:11371632"
     CDS             631163..632629
                     /locus_tag="SFLA_RS02655"
                     /old_locus_tag="Sfla_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014152688.1"
                     /db_xref="GI:503918694"
                     /db_xref="GeneID:11371632"
                     /translation="MPSAIPVPSVPDRLTRLPLSRPDLRLLDAIGQCGDLAEAARRAG
                     LRAAAAERRLDRLDQATGLRLTLRDARTARLSTEGARVLVAGRRFFRQVDQAVQTEIY
                     GRGTEALNAPRILDIATAEPLMEDLVEDAADTLGILLSVSHDTPLQVLRQLDGYRVDA
                     AHTWGLDVLSHAVDRTVRTYDVLDDPLWVTLPVGHPLAGRDTVSLADLRDENWVSEAG
                     PRGEVLVSRVYQSAGLTPPARIQVAGASVARGMLRRGDAVGLGSPACPAVFAPSLVRR
                     SLRERPRRAAGLLVDPAVVPGALAQQLAALLTDRCLSRFTERHGDLLRDPWWADWLRG
                     QRGELARRTEDAAHSLRTPPALPAESAQIDVEDLHLLRAVADHGSINRAAAVLSISQS
                     ALTRRIHRLELRLGASLLVRSSRGTDLTAPTRQFLDRLASFEAELHAVGLTGQRDTVP
                     PAEPGTTQRRAHRSSRGAVGRPGRAERGAARPAVAGRG"
     gene            complement(632681..634342)
                     /locus_tag="SFLA_RS02660"
                     /old_locus_tag="Sfla_0549"
                     /db_xref="GeneID:11371633"
     CDS             complement(632681..634342)
                     /locus_tag="SFLA_RS02660"
                     /old_locus_tag="Sfla_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014152689.1"
                     /db_xref="GI:503918695"
                     /db_xref="GeneID:11371633"
                     /translation="METEQSGTTGFDAAVDGVVAPTDELGGTLRLVRTDDFDSLDPGN
                     TYYAYTWNFLRLIGRTLVTFDTAPGKSGQRLVPDLAESLGESSDGGRTWTYRLRPGLL
                     YEDGTPVVAADVKYAIARSNYGTDVLGVGPTYFRHLLGTDYGGPWREPEVDGPVTVET
                     PDDRTLVLRLAEPFAGMDLLATMPSTTPVPRDRDTGIGYRLGPVATGPYRVESYERGK
                     LVVLERNPHWDPETDPVRRQRAERIEVHLGKDPHEVDRMLLSGEAHIDLAGFGVQPAA
                     QERILADPELRANTDNPLTGFTWIYCLSSRIAPFDNVHCRRAVQFATDKAAMQEAYGG
                     PVGGDIATTILPPTIDGYQPFDRYPVGEDATGDLEAARAELALAGMPDGFRTKIAARK
                     DRLKEYRAAEALSAGLARVGIEAEVLDFPSGDYFDRYGGSPEYLREHGIGIIMFGWGA
                     DFPDGYGFFQQIVDGRAIKERGNQNMGELDDPEINGLLDKGAVSGDPEERAAIWHRID
                     RLTMDHAVIVPYLYPRSLLYRHPDARNVLVTGSFGMYDYVALGAK"
     gene            634626..638639
                     /locus_tag="SFLA_RS02665"
                     /old_locus_tag="Sfla_0550"
                     /db_xref="GeneID:11371634"
     CDS             634626..638639
                     /locus_tag="SFLA_RS02665"
                     /old_locus_tag="Sfla_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NocE"
                     /protein_id="WP_041668343.1"
                     /db_xref="GI:753980868"
                     /db_xref="GeneID:11371634"
                     /translation="MAGYPSLSVAKTPTPPPGAAQGWSQKDEAKAAKPGPAELPEAVP
                     AKDRAAVLGSGHRTSDDLAWTTSGDATGFHVMVAAADDGYRWRTAATLSEPGFDTDTW
                     IGNACLTASGKRAAVTYAPRTFTNKPALMTRGAFTAIVDLATGTVTKLPVQSSLSYFS
                     PGCGASEKAVFSQFSDDESERNETRLVGVDTASGKAAKPLELPGQVTSAVPLADGYAA
                     AQGARLVKVAASGKVRVAARTAGVPFQLTAAGDGSVVYIDRPGSTTKAAKTKVTTERA
                     EVRRAPAALLGASEAAGRTQRLATGALTDFDLARSARTGKVYVTGTAEAAGTLPSSVR
                     MPAGVAKGAALSTRGEAAVTTAWADGKDSRIAPQEAASARTARTEMQILKTGRKVTLD
                     SRPGTTVGSTAKTAGGLATSPALTGGSTTDAPRLAAASPTNPVEDERYCSVPRGDVKK
                     QAFQPTPRQVEWAVDQAVVGKLNSHISRAANWKNTGMSAYQPQSLFPLKTMAGDPNGT
                     PDASDGYHIPAQVMLGITAQESNMWQATRFAVPGVTANTLIGNYYGISHGSDGQSSDP
                     WAINWASADCGYGIVQVTDGMRKAGREKPGETALSVQKQEAIALDYTANIAAGVNILV
                     DKWNQTRGAGMTVNGGSPEYIENWFFALWAYNSGFYPQSSAGSHGGHWGVGYTNNPAN
                     ALWKANRTPFLESAAGGDDYTHAAHPQDWPYQEKVIGWAARPISAMFAPGDFQPGYRA
                     AWWTATDQRTLAKPPVGLFCDSSNNCDPSKIKEGDTGTNGACQLNNPADEFYLHCWWN
                     KKAEWKSCQAGACGYALHRFDATYPEQPDGNAYPPRCSSGLPSGTYVIDDVASGVTPT
                     GSSGRSCGATTSPGTFGFTFTADGANYPGKIDTHQIGAGYGNHFWFGHTRNQATAEGA
                     RMKTTGTWTLTNGMTGWARVWVHLPDHGAHTRQASYTISGTTSTSPVRVHPQRVLENK
                     WVSLGVFQFTSTPKISLSTHSADGSGSEDVAWDAAGFQPLSAKPKDMVVAMGDSYSSG
                     EGASAAGGVDYYRETNYRDSSNPSTRNACHRSKQTWSRQATIPGRSASVGSMDDNRSA
                     AMDYHLIACSGARTYNIASVGENGELPQLSKGYLDQNTSLVTISIGGNDARFAYIIQK
                     CIFGGVGWPTLCQDQKFEDDDSHVDDAAYQGLNIGVAAERLAKERVRPAITDALKKIQ
                     AKAPNAKIVLMGYPPLLEKSGQCIPGIGTGEAPWLNGMAATLATEMQGAVDDAKAAGT
                     KAWYSNPAQNFAGKAVCGDPEQVHGIVLDLVESDEPAIDWPILQLGASAQSFHPKVGG
                     ARLYADSLERTMQGMGL"
     gene            638711..639004
                     /locus_tag="SFLA_RS02670"
                     /old_locus_tag="Sfla_0551"
                     /db_xref="GeneID:11371635"
     CDS             638711..639004
                     /locus_tag="SFLA_RS02670"
                     /old_locus_tag="Sfla_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014152691.1"
                     /db_xref="GI:503918697"
                     /db_xref="GeneID:11371635"
                     /translation="MRHVSRRGDIGAALALLLLDAALLTVLLLGVVVSGGLTGSPDRA
                     AVSGEASDAALVCLVALLVSAGTAAAVRAWTTVAVQVVVLGGAAAVAWTGFGP"
     gene            complement(639094..639882)
                     /locus_tag="SFLA_RS02675"
                     /old_locus_tag="Sfla_0552"
                     /db_xref="GeneID:11371636"
     CDS             complement(639094..639882)
                     /locus_tag="SFLA_RS02675"
                     /old_locus_tag="Sfla_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014152692.1"
                     /db_xref="GI:503918698"
                     /db_xref="GeneID:11371636"
                     /translation="MVGVQIRILGPISMISQNVPVPLAGQRQLRVLTALALVSGRTVN
                     TPELIAQLWGEHPPRTAPGQLQTSVWMIRRALASVGAPQETVLSTASGYQLDPAYCEI
                     DSDIFRRNVATAKKLVRADLKEEALDLLRDALALWRGPALATISSSALQTRAARLEEE
                     RVAALQQRIGLEITLGQYEEAIVELTDLIVLHPLREELYAHLMQALYLSGRQADALAV
                     FRRARSTLTDELGIYPGPRLTTLERAILRQDADMLSAVPGLARR"
     gene            complement(640499..641506)
                     /locus_tag="SFLA_RS02680"
                     /old_locus_tag="Sfla_0553"
                     /db_xref="GeneID:11371637"
     CDS             complement(640499..641506)
                     /locus_tag="SFLA_RS02680"
                     /old_locus_tag="Sfla_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_014152693.1"
                     /db_xref="GI:503918699"
                     /db_xref="GeneID:11371637"
                     /translation="MSQSRRSVLQGVLGAGAAGLLVGGAASLPAARPRAVAKGAELGL
                     RWLGVAGWELSFAGRSVLFDPYLSRMPYADADGGLDPALPLRLDTDAVDHVAEKELAG
                     VPELILVSHGHFDHLADVPHLLSRPGWSGRRVRTLCDTTSRHLLEAMGTPAHRMADVV
                     AVSGGDHLQFDGYSVEVFRSLHSRQQDYTSFAPGTRDAVPARPRTLGDLVEGQTLAFQ
                     VSVEGGPSVLLTGTSNVAERELAGARPDVAVIGMSGYSAVHGYPDRLLAALGSPSLLL
                     PCHHDDMVTPLGSSGISGTSSSDAVTALTKAVERQGWAGGTRVLTPRHLELLDVTDAA
                     V"
     gene            complement(641606..642784)
                     /locus_tag="SFLA_RS02685"
                     /old_locus_tag="Sfla_0554"
                     /db_xref="GeneID:11371638"
     CDS             complement(641606..642784)
                     /locus_tag="SFLA_RS02685"
                     /old_locus_tag="Sfla_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine acetyltransferase"
                     /protein_id="WP_014152694.1"
                     /db_xref="GI:503918700"
                     /db_xref="GeneID:11371638"
                     /translation="MTGTTDRDPAGFVVHTAPAGLSDDGRDDFTVLASTVPTQVSAVF
                     TKSRFSGPSVVLSRAAVADGQARGVVVLARNANVATGVEGESNAREIRDTVAAVAGLP
                     EDELLIASTGVIGLQYPMEQIREHIKTLSWPFPDGGFDRAARAIMTTDTRPKEVRVRC
                     GEATLVGIAKGVGMLEPDMATLLTFFATDALLPQDTQDRIFRGVMDRTFNAVSIDTDT
                     STSDTAVLFANGLAGEVDPAEFEEALHEVALALVKNIASDGEGASKLIEVRVTGARDV
                     AQAKRVGKTVVNSPLVKTAVHGSDPNWGRVTMAIGKCTDDTDILQENVSVQFGGTTVY
                     PQRADGPGDAELRKAVAEHMSGSEVVIGIGLGIGDGEFTVYGCDLTEGYVRLNSEYTT
                     "
     gene            642997..644712
                     /locus_tag="SFLA_RS02690"
                     /old_locus_tag="Sfla_0555"
                     /db_xref="GeneID:11371639"
     CDS             642997..644712
                     /locus_tag="SFLA_RS02690"
                     /old_locus_tag="Sfla_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018090800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="WP_014152695.1"
                     /db_xref="GI:503918701"
                     /db_xref="GeneID:11371639"
                     /translation="MSRVSTKPSGNPTAAHALLKRLHEHGVETVFGVVGREAASILFD
                     EAPGIDFVLTRHEFTAGVAADVLARITGRPQACWATLGPGMTNLATGVATSILDRSPV
                     IALAAQSESHDIFPNDTHQCLDSVSVMRPMTKYAVELQRPDEITDLVDSAVAAAMTEP
                     VGPSFISVPVDLLGADIDASVTHPAAHTPAKPVGAVHADWKTAADEAAALVAGAEHPV
                     FVVGAAAIRSGAVDAIRSLAERLDVPVITTYIAKGVLPHGHPLNYGAVTGYMDGILSF
                     PALETLFGPADVIVTLGYDYAEDLRPSMWDRGGEKKTVRISPTVNPIPRVYRPDVDVV
                     TDVLAFVEHLDSATAEVAKKTPHDIAPLRERVAEFLADPTEYDDGMRVHQVMDSMNTV
                     MEETAEAGEGTIVSDIGFFRHYGVLFARADQPFGFLTSAGCSSFGYGIPAAIGAQMAR
                     PGQPTFLIAGDGGFHSNSADLETIARLNLPIVTVVVNNDTNGLIELYQNLGHQRSHDP
                     AVKFTGVDFTELARANGVEAVKAGTREDLLAALRKGAGLGRPFLIEVPVNYDFTSGGF
                     GALSI"
     gene            644712..646244
                     /locus_tag="SFLA_RS02695"
                     /old_locus_tag="Sfla_0556"
                     /db_xref="GeneID:11371640"
     CDS             644712..646244
                     /locus_tag="SFLA_RS02695"
                     /old_locus_tag="Sfla_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyethyl-arginine beta-lactam-synthase"
                     /protein_id="WP_033249333.1"
                     /db_xref="GI:702730538"
                     /db_xref="GeneID:11371640"
                     /translation="MMAHTLPAATGFLVSARKGGGQAPGPVFATRGAHESVAEALRNQ
                     TFDAVLVHSGSPGDAVARAGDTALVLAGELYNREELLTLLPSGGDVRTDAQLVLALLG
                     IYDLHAFRLLNGRFAAAAALGDRLLLATDHAGSVPLYTLPAPGRVLAATEIKALVPAT
                     AGTPPAGRPVADARRVRRVPGVHQVPAGTVLDLDVRTGTAVPHRTWAPALSRRVRSEA
                     DATDAVRRTLERAVEARTGGTTPLVVLSGGIDSSGVAALAAAHTDGPLDTLSMGTDTA
                     NEFAEARVVATHLGSAHREITVPTADLLGQLPYAIWASESVDPDIIEYLLPLTALYRA
                     LDGPARRILTGYGADIPLAGMHREDRLPQLDTAVAFDMATFDGLNEMTPVLSGIQGHW
                     STHPYWDRDVLDLLVPLEAGLKRRYGRDKWVLREAMSALLPQETVTRPKLGVHEGSGT
                     TSSFSLLLMDAGVPDADVHRAKSLVVREIFDRVVVEGLPPAEVRTADAVHQVAARLKE
                     TE"
     gene            646288..647238
                     /locus_tag="SFLA_RS02700"
                     /old_locus_tag="Sfla_0557"
                     /db_xref="GeneID:11371641"
     CDS             646288..647238
                     /locus_tag="SFLA_RS02700"
                     /old_locus_tag="Sfla_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_014152697.1"
                     /db_xref="GI:503918703"
                     /db_xref="GeneID:11371641"
                     /translation="MERVDTTISPRYAQIPTFMRLPHDPNPSGRDVVVIGAPYDGGTS
                     YRPGARFGPRAIRNESGLIHGVGIDRGPGTFELIDCVDGGDIDLTPFNMHIAMETAHR
                     HLRDLLQDNAAFLMLGGDHSLTLAALRAVAEQHGPVAVVHLDAHSDTNPAFYGGEFHH
                     GTPFRHGIDEGLIDPARTVQIGIRGHNPRPDSLDYARGKGVRVVTTDEFVETGVAGTH
                     ALIQELIGDRPVYVSVDVDVADPAFAPGTGTPAPGGLSSREVLALLRCVGELRPVGFD
                     VMEVSPLYDHAGITSVLATEIGAELLYQYARAHIKGRNDA"
     gene            647235..648209
                     /locus_tag="SFLA_RS02705"
                     /old_locus_tag="Sfla_0558"
                     /db_xref="GeneID:11371642"
     CDS             647235..648209
                     /locus_tag="SFLA_RS02705"
                     /old_locus_tag="Sfla_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="clavaminate synthase"
                     /protein_id="WP_014152698.1"
                     /db_xref="GI:503918704"
                     /db_xref="GeneID:11371642"
                     /translation="MTVIDCSSLRDELLELASRLPAVPRADLPAFLEAAKEASADLPA
                     SLAEALDSFNVSGNEDGYLLLRGLPVEEEGRLPRTPESTPAPAERPLLTMEAMLGIVG
                     RRLGLHTGYQELRSGTVYHDVYPSPGAHHLSSETSETLLEFHTEMAYHRLQPNYVMLA
                     CSRADHERRAATLVGSVRKALPLVPEGFRTHLFDRKVPCCVDVAFRGGVEDPGAIAEV
                     KPLYGDASDPLLGYDRELLAPEDPRDVEAVESLSKALDEVTEAVHLIPGDVLIVDNFR
                     TTHARTPFTPRWDGADRWLHRVYIRTDRFGQLSGGERAGDVVAFTPRR"
     gene            648446..650083
                     /locus_tag="SFLA_RS02710"
                     /old_locus_tag="Sfla_0559"
                     /db_xref="GeneID:11371643"
     CDS             648446..650083
                     /locus_tag="SFLA_RS02710"
                     /old_locus_tag="Sfla_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PbsX family transcriptional regulator"
                     /protein_id="WP_037815374.1"
                     /db_xref="GI:739965104"
                     /db_xref="GeneID:11371643"
                     /translation="MARHDRGGRRGRSRGPVLGVAVAVVLAAGAGWWGYRAWSEDGAE
                     KDPEVVAATASLQAFLDAWAAGEAAEAGALSDSPKTAESLLSSVMTNLKPTATKLSAG
                     DGEKNDKGEVTVPYTARFTVPAVGVFGYESQATLVRKAEQWIVEFSSPMVHPRLEHGK
                     TLALKAVAKRAPVLDANGDDLQAASLRGSVDEQGKGAFGLEARYDKQLRGGGGTATSE
                     VVIADRQSGEAEASLTKSSAEPGKPVKTTIDPKVQGAAAAAMEGLKVNAALIALEPST
                     GNILAVSSRPAGGLNRALAGRYPPGSTFKVVTAAAMLKAGMKPSDVVKCPKFAHVDGQ
                     RFENQNQFTLPAGSTFKDSFAKSCNTMFVENRAKAGGSALHDAAEAFGIGGVWDVGDT
                     TYDGSVPVSTSDNDLAASTIGQARVQASPLVMASIAATVKEGTFKQPVLVPDAVKKKH
                     EATARLDPSVTGALRDMMRATVTYGAGSALTGLPGEPHAKTGTAEFGQEKPPRTHAWM
                     IGYQGADDLAWCVMLEDGGSGGADAGPVAARFLKNLT"
     gene            650393..650854
                     /locus_tag="SFLA_RS02715"
                     /old_locus_tag="Sfla_0560"
                     /db_xref="GeneID:11371644"
     CDS             650393..650854
                     /locus_tag="SFLA_RS02715"
                     /old_locus_tag="Sfla_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152700.1"
                     /db_xref="GI:503918706"
                     /db_xref="GeneID:11371644"
                     /translation="MPDEGRGDDVYQPDGSDTDNPPTDDLDPENVIGEPDLDEMLDTG
                     YSPPEKPLGVTKYGTTGEEQREGESLDRRLAQEVPEDDPLLTDEPHEGPEDNGPEEDD
                     AGTERAGRLTTTDEEPGIDRNNRTLGRDVGIDGGAASAEEAALHIQEDDEI"
     gene            650946..651512
                     /locus_tag="SFLA_RS02720"
                     /old_locus_tag="Sfla_0561"
                     /db_xref="GeneID:11371645"
     CDS             650946..651512
                     /locus_tag="SFLA_RS02720"
                     /old_locus_tag="Sfla_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_014152701.1"
                     /db_xref="GI:503918707"
                     /db_xref="GeneID:11371645"
                     /translation="MSGDEIEQRKVLAVVTNYGVEQDELLVPLEHLRGAGARVDVAAV
                     SMDDILTLVGDKDPGKTVRPDLTLDDADPADYDLLLIPGGTLNADTLRLQNATNGIIR
                     SFTDSGRPVAAICHGPWALVEAGVVPDKRLTSYPSLRTDIRNAGGEWTDEPVVTDGSG
                     GWTLITSRNPGDLEPFVREIRTALGARP"
     gene            complement(651636..652541)
                     /locus_tag="SFLA_RS02725"
                     /old_locus_tag="Sfla_0562"
                     /db_xref="GeneID:11371646"
     CDS             complement(651636..652541)
                     /locus_tag="SFLA_RS02725"
                     /old_locus_tag="Sfla_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="WP_014152702.1"
                     /db_xref="GI:503918708"
                     /db_xref="GeneID:11371646"
                     /translation="MRAARYHEYGGTDTLVVEQAPDPLPGPGEIRVRVAAAGVNPVDW
                     KVRDGSVRDFLPVDLPAIPGRDAVGLVDMTGEGVTSVDIGDRVFGLGGVTGATAELAV
                     LSAWAPAPAAWSDEEAAGAGLASVTALGGLRALGRLEGRTLLVEGAAGGVGGAAVEIA
                     RALGATVIGTASERNHAYLASLGAVPVTYGAGLAERLTGLAPNGVDLVLDAAASGSLP
                     DLVEIAGGPDRVVTVADHVNAERLGVRVANAVNDSALLAEAAALGEQGRYVPRIDRTY
                     PLEEIAQAHAHSERGHVRGKIVILL"
     gene            652656..653057
                     /locus_tag="SFLA_RS02730"
                     /old_locus_tag="Sfla_0563"
                     /db_xref="GeneID:11371647"
     CDS             652656..653057
                     /locus_tag="SFLA_RS02730"
                     /old_locus_tag="Sfla_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_014152703.1"
                     /db_xref="GI:503918709"
                     /db_xref="GeneID:11371647"
                     /translation="MRIGEVARRAGVSVRALRYYEEQDLLRAERSTGGQRRYPDSAVD
                     RVQLIQQLYAAGLPSRSVREVLRSVYAGTVEPGLLDRLESERARITTRITELLAARDR
                     LDGVIATTRNPPPACARGRARGGPAPSAAHG"
     gene            653157..653420
                     /locus_tag="SFLA_RS02735"
                     /old_locus_tag="Sfla_0564"
                     /db_xref="GeneID:11371648"
     CDS             653157..653420
                     /locus_tag="SFLA_RS02735"
                     /old_locus_tag="Sfla_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152704.1"
                     /db_xref="GI:503918710"
                     /db_xref="GeneID:11371648"
                     /translation="MNTWRILTAAAAGSVLLTAAPAAAQADSFAPALTGTALTAATTG
                     ERTGTAVHEVAQETGLGQTASTATGLVETGAETLLARDQSVTD"
     gene            complement(<654621..657761)
                     /locus_tag="SFLA_RS02740"
                     /old_locus_tag="Sfla_0565"
                     /db_xref="GeneID:11371649"
     CDS             complement(<654621..657761)
                     /locus_tag="SFLA_RS02740"
                     /old_locus_tag="Sfla_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019482528.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249387.1"
                     /db_xref="GI:702730785"
                     /db_xref="GeneID:11371649"
                     /translation="MYERLGEKPFQQLCNALLAHVFPDVSCFPVGHADGGRDAVLQEG
                     KSSIIFQVKWTSHAVKDPVTWLDRTIKDETSSIRRLVEQGAEKYYILTSVAGTGTPGR
                     GGIDRLHTALEKHSKEFGISFVCWWRADIDARVDAAPDELKWAYSEMLAGSELIRYLI
                     EAQSAETDMRRLRALLLKVIATQWRDDAKVKFKQVELDSHDLADLFVDVEATLVSLPR
                     RTVGLFADRVVGAQLGGAAAYLTRTAQPFTLVRGEPGQGKSTLGQYLCQQHRTPFLRA
                     EDGGQIGSTGFQRFPLRIDLSDYALWLLGTDPFSTVGGGRAVRVRPRASGPLEEFLKD
                     LLHAKSGKLPVEVDGVHDLLHRLPVLIVLDGLDEVARRDVRARVVKEVNEFCARLSTA
                     VTPPQVVVTTRPNASDFSEPDPDLFETVALSRLSPRLRISYLRKWAATRHVSPRDRLV
                     LERSFQQRSAEPHIDQLAANPMQLTILLYLLQKRANSVPSSRTALYSSYMETFLDREA
                     TKWPAVQDHRQDLEEVTAYLGWDLQSRAEADGSSGHVPTRDLKQSILVYLYQVDKETS
                     LVDDLFTAVTDRVWALSSKVQGTFEFDVQPVREYFAAHYLYHFAGVDQSDFDSAKVLR
                     SLIQRPYWLNTCRFYCGFAKPNDLAGMLEALEEERDLGLRPRQVRLASWALLADGVFN
                     GRVRSLRRATDLFTDDLSVRLLHHALGASDETPALSADRGGKFLAESLLARVAGDLRS
                     PMTADRVGLAVQILGEREAFDAWWQPQVQAAAGGSNQALWMGIGRANAAGSRLPQETV
                     AALTLENPLEAAAAVAAGVCPPPDSNTERWMLHAALDGHCCDQDSPASSHVHDILRVV
                     SPQTLIHRAHPPQHGDAIDVGHLQAPTDTQRQTALQRLKRRSPQWSLIQAALRTGRGQ
                     KGTTSSWGNTARELSSLYGPCWLAAEIAVIGAASPRTVFLTGGNLTRNSEPLGESPDY
                     GRLLQDVRANRSAPEWWSQQYVAAPDSLSRRTWALALLTCADADVVSDHLAHLDQALA
                     VMTFPQQLALCRSSSRL"
     gene            complement(658079..658795)
                     /locus_tag="SFLA_RS02745"
                     /db_xref="GeneID:23391317"
     CDS             complement(658079..658795)
                     /locus_tag="SFLA_RS02745"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249334.1"
                     /db_xref="GI:702730543"
                     /db_xref="GeneID:23391317"
                     /translation="MLVTSGAEVAGAVVSLPFLVAPGLVVVFLLVLVLVLVLVVGFGG
                     GGRVLAGGEGDGGVTLGLEVLLVLDSRSSQMASESTSLTAAPSGRMRLSVGRGHRQLG
                     QSRATASPKGTSVWFTEAADRSLRHSGLPWSLPLPVAETWQVMRMSRVDPRGTSGVKS
                     EPSMTWRSSSRVEDMSAGYARALTVCRSICSLHPAVTRDARAILIARTGILGTSLLGR
                     RQRVMRIGLGRKRGARSTLR"
     gene            <659135..>659449
                     /locus_tag="SFLA_RS02750"
                     /db_xref="GeneID:23391318"
     CDS             <659135..>659449
                     /locus_tag="SFLA_RS02750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003961837.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249388.1"
                     /db_xref="GI:702730788"
                     /db_xref="GeneID:23391318"
                     /translation="DAFGRRRKGKPEAHTAFRRLTADWIRQAREEAGRPVSAPWQLVA
                     VKAPAIVRTHRSEPEHDPLTLWEAAVIATYQVAFNRKAGTTALLVPHLVAEQLLACAS
                     DDM"
     gene            659877..662930
                     /locus_tag="SFLA_RS02755"
                     /old_locus_tag="Sfla_0568"
                     /db_xref="GeneID:11371652"
     CDS             659877..662930
                     /locus_tag="SFLA_RS02755"
                     /old_locus_tag="Sfla_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012802109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152707.1"
                     /db_xref="GI:503918713"
                     /db_xref="GeneID:11371652"
                     /translation="MATFPETERYIQFLLEQLAGRNEHHVFEQIVFQIALRRLSSNIV
                     PATGPVSAGGDQGRDAESYYTNLPHELPGAGGFVGRATTEPWVLAASVQKPPLDGKIR
                     DDLKSICSRGEPVRRVAFFAVHEIPVAARHRLQQHARDTYDVALDVFDGQAVANMLAQ
                     GDLVWIAQRFLDLPSAMIPDEPAAAHPDWYRSTLTAFRERPGQRLTPGALSEVRDGLR
                     HATFDDEARVDLAEWLGYVGEFIDAGDGDVALRARYERVLAVLRGRNSLDGAEADIRA
                     VIDAALSSERVALLDDAGQLLMYWGGAWLRHLGTANAEELRELVLRLRQRVAVLIEAT
                     DAAVYPVRKASLLDVAARLCLHPRWPQVTRPAAGALPTPQETTRLGRAGEIVPTVSSA
                     NPLVDVTEAMDCLEQLVDLLPQAPAFPVGGASETFQIFAPALTEDPRYEKIRDALDAA
                     QADLAGDSSVAARCRDRAMAFLRAGRPLDALHELHEVKINWWHGDTLRGALLTMRMIG
                     KIYGDLDLQQAARQYALTAAAVAASPVGQGNQDLLPATLTQAMAHTHAAGHWGDALAL
                     GGLAFMAHHLFAENPEDYPSHGYIQQLDFHSSMVMLSAERFRPALMPALRELTDADYL
                     ADLDEHLPLIRPSFTQTAQQFIQNADDQLTGRPFSDVGAHRDMNFAALGTTWRIRCDN
                     TRATVLAAERFTAAVQISLAELAPHDPLFFPQNILVRVITGTPLGGGDRVTFRPNNHA
                     IDCTVILSTYSASTDHTAFERELSTTVVHLLAHLSARPTEAFMSLVKTTFARGLLHKL
                     ISGRPYDEAAGLLAEAHYDTLRRSAMPPWSDTAFQPPTALQLARPITPGPGYDRTRAL
                     DMIRDNYTDLPQVLSETLPRVLADPDTRAGLQELREEGWLDWQILVALANMAANLRLQ
                     QASPGSVPRDYPTRFFQTPESHYPSALPLNAFTADNLRAQMDVTLLAVAQRRWKLGSA
                     MTTPNLQALKELLTARYGYATDDVPHRDLLNGAPDEGGALIAPGT"
     gene            complement(663225..663416)
                     /locus_tag="SFLA_RS02760"
                     /old_locus_tag="Sfla_0569"
                     /db_xref="GeneID:11371653"
     CDS             complement(663225..663416)
                     /locus_tag="SFLA_RS02760"
                     /old_locus_tag="Sfla_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006376242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152708.1"
                     /db_xref="GI:503918714"
                     /db_xref="GeneID:11371653"
                     /translation="MPIDYLPTAVIIPGVLGFVILVLLYAGVVLPTIWSRCPERRKAA
                     HRTLDMLLKARRGLRRIGQ"
     gene            complement(663765..664055)
                     /locus_tag="SFLA_RS02765"
                     /db_xref="GeneID:23391319"
     CDS             complement(663765..664055)
                     /locus_tag="SFLA_RS02765"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249336.1"
                     /db_xref="GI:702730550"
                     /db_xref="GeneID:23391319"
                     /translation="MVDFEVERVQLRDRTSHSRGGPVAVQYSFCLRLLYADPHGLGTL
                     LSHRSVLIAPPQRIEQMRFGRGRLEALSQSRGMELLDDLDKGVDLLRESVPA"
     gene            complement(664479..665123)
                     /locus_tag="SFLA_RS02770"
                     /db_xref="GeneID:23391320"
     CDS             complement(664479..665123)
                     /locus_tag="SFLA_RS02770"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249337.1"
                     /db_xref="GI:702730559"
                     /db_xref="GeneID:23391320"
                     /translation="MHIRGLPQISGHGSVDSAVTTVLFQVIGQSILRSFEHFLPWAGL
                     DSGQRAASSMARLGCVRQRFFEPVIAVLVPFLIREVARRSGCKEEMGDGKAITEPTGV
                     HGCFQHGTCIGRGIVIALQQYWGSCQVLSDLAVCSTLGRIEQPGVAHLTTTDSGQIRS
                     RERGGHRDVGTRQQLSGLLVQVRGASPWQCGEHGPVLRPDGAQYQDRATGLILE"
     gene            665118..665870
                     /locus_tag="SFLA_RS02775"
                     /db_xref="GeneID:23391321"
     CDS             665118..665870
                     /locus_tag="SFLA_RS02775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009086001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249338.1"
                     /db_xref="GI:702730562"
                     /db_xref="GeneID:23391321"
                     /translation="MHAHNEDQFAFGRSARAERHKSVDHLRFVLKAAEAGDHAAAWEA
                     AEELNKLGRHTHALALYQRAASGAAFAVARRKAAGLLQKLGRTDEAVDEYKEAAALGH
                     LSSVHVVVELMLGQDQAAAAAAWIKQLAEQTDMDVLDTAITLLKRAEHETDILRWLCD
                     LADKGRPGAMGRAAELMQQADRSQEAAVWLTGLANSGFLGAELLVAEVLEEDGLIDEA
                     IEWYRRAAKSGYPSARSALARLTVQDPPDVVE"
     gene            666527..667633
                     /locus_tag="SFLA_RS02780"
                     /db_xref="GeneID:23391322"
     CDS             666527..667633
                     /locus_tag="SFLA_RS02780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007267620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249389.1"
                     /db_xref="GI:702730791"
                     /db_xref="GeneID:23391322"
                     /translation="MAAKALVLKPSTMARYRDYVRNDLIPAFGTLKLDQLANRHIAAF
                     VTSQLAVGCGRTTLYRCLATLSSALGDAVRQQRLPRTPASPPVLHRPPSPERRIWTAE
                     EAARFLTHCHQTDPEMADLFEVLIGTGMRKGEALGLHWNDVHLDQGVLYIRCTLSAVD
                     NNRLVLTTPKTRSSRGWVAISPRVAIAFRHRARSAPRAHGDADDPFAGLVFCRPDGRP
                     LGPHLVLDRLHRLSEEAGVPQVTVHDLRHLAATITISAGVPLTVVSKTLRHSTLSTTA
                     NLYSHLTQQAAHQAVDTIDHVLSGAQQPAVRTDRPARLRPPRDHIHRHHKALHKLRSP
                     APPATSTQANQPRPRHATTLRPPRPGTHEKAVLS"
     gene            667998..>669764
                     /locus_tag="SFLA_RS02785"
                     /db_xref="GeneID:23391323"
     CDS             667998..>669764
                     /locus_tag="SFLA_RS02785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152712.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_033249390.1"
                     /db_xref="GI:702730795"
                     /db_xref="GeneID:23391323"
                     /translation="MSIARVDGRVQPARSGDPKRVGPYRIIGRLGSGGMGTVHAGLDP
                     AGLRVAVKVIHPAQAEDPEFRARFRREVQLSSRVHGPCLIPHLAADPDAETPWLATAY
                     APGLTLDQHLASHGALTGATLYAFATGTAQALAAIHASGVVHRDVKPQNVILTPAGPR
                     VLDFGIAHAADGTSVTRTGVMTGTPGWISPEHYRTGTAGPEGDVFAWGTLVAYAATGR
                     LPFGTGAPDVVAYRVMSEEPDLDGLPEELREPLAKALAKNPAERISAEEAAQLCALLL
                     TRQGTQVLGTAAEPEPPQIIDCLTTAWNLPSLEDPAWSLPAPSNRRRALVAATVTAIA
                     ITAASGGIVVYNSDDRADVSLTSGHAAPSTPSTEISAPISAPGAAAAGTPAVTASAPV
                     VDPRTTRIPKDPLAGVANPAYTRSGDETQPFADEWSASTIAGSPEERDAEKVIRDRMT
                     SMLATKDMDFMKPTITFNQRAQTVMVTGGPVTQLSENYQEVFRRVGEMAACSALAHRL
                     KNNPATWPYGRFAIYWKTSDDDLDAAALGYGEATDGCISETAGQWHGDESGMATAEIP
                     SSDKAEIRVADATVKAIVSTWNT"
     gene            complement(670659..670934)
                     /locus_tag="SFLA_RS02790"
                     /db_xref="GeneID:23391324"
     CDS             complement(670659..670934)
                     /locus_tag="SFLA_RS02790"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249339.1"
                     /db_xref="GI:702730570"
                     /db_xref="GeneID:23391324"
                     /translation="MLDTGADASVFGVVLFLAAQEWASGSSAVRDDQYGSRVGAVCDD
                     RCPGRDGGQVRLPLGVGVGLVPGKGRAEAITRRLSASMMTCTFAENR"
     gene            complement(671108..671947)
                     /locus_tag="SFLA_RS02795"
                     /old_locus_tag="Sfla_0575"
                     /db_xref="GeneID:11371659"
     CDS             complement(671108..671947)
                     /locus_tag="SFLA_RS02795"
                     /old_locus_tag="Sfla_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152713.1"
                     /db_xref="GI:503918719"
                     /db_xref="GeneID:11371659"
                     /translation="MTQALENGIRTLDTNTIKELARIICGDDNLYYRGTRDLTRFFEN
                     AGWLNVLDFDGESRSEWTLDRLTERRTDGAAVEQVLLRLADAREYYEEPHQLTKVLQA
                     VNAFLVHEGLRLENPGGRPRLVTCDPSLGHPGEQAPAELQATMAGIIADERMAQLLQH
                     RLDEARTCFANGAHIAAVIMLGSLLEGVLLTVIQERDPSLLRGRDLKRVSLGELIDIC
                     SRARWIDADATSYSHTLRDYRNFVHPHREFREEHKPDRDTLNVSWWVVNGALNDLAAS
                     HPH"
     gene            complement(<672127..676638)
                     /locus_tag="SFLA_RS02800"
                     /old_locus_tag="Sfla_0576"
                     /db_xref="GeneID:11371660"
     CDS             complement(<672127..676638)
                     /locus_tag="SFLA_RS02800"
                     /old_locus_tag="Sfla_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152714.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA helicase"
                     /protein_id="WP_041825562.1"
                     /db_xref="GI:754215119"
                     /db_xref="GeneID:11371660"
                     /translation="MRHHAADPDVLARTTGLVNFLQEMVRSSHQRQRDDRGRGRERLW
                     LSDLPPQIRKPGARDDGVLLQLKHIPQEPPPDLPELLEGWVDPLACLDPDAGDPPLAD
                     EGPVHSRLPVPAGTLQGDEPAVIAQGDAEEVLRAYEPWLNRWRIWAQKERRQQPLRAL
                     YDTVYAWHQRLTLEDDRIELILAVGLLTWDKPGQDAVHRHLLVQRAETSVHRGSAEIT
                     VRLSAEAAMRLEDQDFLDSGDGWIREQSAALGDEIAASAVHPLDPDTLELLSKWQDRA
                     YQHRIAFSARWQPPESPEAVSRVTYAPALLVRPRNQNALLRLYGKIAETIAAEEYAPL
                     GLAQMVLDGLSAEERAAWDGHGLAQAPLFQGDPLFPGKTNEQQRRVLRRLQKDTGVVV
                     QGPPGTGKTHTIANLVSALLAEGQRVLVTSARDQPLAVLRDKLPKPVRDLCVLLLSST
                     RSNNGTSELERTVTALTKQVASTDAETLQGEINRLTKRRLDIQGRIGTLTDQLLSVRE
                     QEYRHQGVAPGYIGTLAEIVHRVRDHQPSLSWIGALADSTPEHAPLSAQQAQELLVLL
                     REGMGEPRVGGVLPSSETLPASDLVDATFAASRLTSQGLDEQTLQLCDVLAGLDLSPT
                     DEIAGHLDNAATALHYLGLPADPSRWVETWWVCQALVERLAHPQTLLWKRVEDTSEYI
                     TQARNALDSVGVRSVHLPESLDVHGAGRMAASGQDLLKHLQTKGQPRVRERFMSLASR
                     EQRNAHDLLTLCTIDGQSPRTVDDLEHVLAYLRAHIALDVVAARWKQVKAPLPEGDLE
                     VLLAELDQRHKQLEHIAAFVEARESIDRILVGQGVRFALTTPTAWQVLTRAAGALAHR
                     RAADEALAQLTSWDQYLSATKDGQQPAPEARALSAALREQDSAAYSKAVDDLHAAHER
                     DARRSRCRHLLDRIRSVHPMLSARLLEEAPDPQWDERLAQIERAWAWGAAARFVADRR
                     ELGLEQRLDTELGQQEALLEEITGELAATWGRLHCLRNMTSEQRSALQMYQTHMSSLG
                     RGTGRSADRLRAAAKERMRVAQGAVPAWVMPIADVAEMVQTGRNSFDVVIVDEASQAS
                     MDALFLLWLAPRVIVVGDDKQCSPPSTGFGRHQAIRDKLAAYLHDMPSGVRELYMPHT
                     NLYGLLSSFFPEVIRLDEHFRCVPEIINWSSANFYDESLLPLRQYGGERLDPLRVTYV
                     EDAATIGREIRIHNPKEAEAIVDALERMTEDAAYRDKTIGVIVLQGHGQTKYIEALIK
                     QRIDPAVRQRHRIQVGNAASFQGDERHVILLSMVVTDPPKIAGGARYEQQAYNVAASR
                     AQDQMWLFHSVPIDRLKPNDMRLNLITYMHNPPTALSALHDIGFVSPKVMQAPFQSMF
                     EQEVYLRLKGRGYHVLPQYPAGTKKIDLVVVGARGRLAVECDGAHFHDTTREQIERDH
                     QRDRELRRVGWEFYRIPESEYRFDADEALTGLWSELNRLDIHPADFTHSPATREASTE
                     WSPLVLTDPD"
     gene            <676979..677550
                     /locus_tag="SFLA_RS02805"
                     /note="integrase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23391325"
     gene            complement(677661..677734)
                     /locus_tag="SFLA_RS02810"
                     /old_locus_tag="Sfla_R0002"
                     /db_xref="GeneID:11371662"
     tRNA            complement(677661..677734)
                     /locus_tag="SFLA_RS02810"
                     /old_locus_tag="Sfla_R0002"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(677698..677700),aa:Pro,seq:ggg)
                     /db_xref="GeneID:11371662"
     gene            complement(677785..680442)
                     /locus_tag="SFLA_RS02815"
                     /old_locus_tag="Sfla_0578"
                     /db_xref="GeneID:11371663"
     CDS             complement(677785..680442)
                     /locus_tag="SFLA_RS02815"
                     /old_locus_tag="Sfla_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152715.1"
                     /db_xref="GI:503918721"
                     /db_xref="GeneID:11371663"
                     /translation="MKPSRPLYERDHELDAAAKALDALCGGQASGGLLVFSGEAGIGK
                     TALLGEIRAMAADRCTVWSARGGETVTSVPFHVVRQLLQPALDRFPADETRALFGDWF
                     EIAAPALGLADPVGPQLDPQGVRDGLDYLVSRLASRLSHRPLLLIVDDAHWADGESLA
                     WLAGFTARLSELPVLVVQAHRPQEFADRDADWAIDRGAGSAGVAGHPALIRVALRALT
                     PEATAELVRAGLGDHADDPFCREVWAVTGGNPYEAVELVAKAQDRELAPVEESAGLLR
                     ELGASARGSGLVARLERLGTNANRFAWAAAVLGTEISQELAATLAGMSSAEAADCTAR
                     LRDARIVSGFDPLEFVHPLIASAVYRSIPPATRTAMHGRAAWAITQAGLGAAAASRHL
                     LEVHPDDDQELVAQLRDAARQHLAVGAPEAARRCLERALDEPPRPRDRAALLYELGCA
                     TLLSSPATTVQHLRAALDTPGLDGALRIDATFRLASALSHNNQLKDAALSLAAEASRT
                     APGPGLMRLQAAHFLWEGMQATEDDGPSRSARLARNADHLKGRDNAERALLTLRAFDA
                     MLRGENAQQVVDFCERALDDGRPARGLGWTDSEWGFELPAMVGITYAFTDQLDRAEAL
                     FGEAVRAFEISGWSGAHLAFAHTLLGLVHRRRGRLAEAEGFLREGLRLADRAGSGLPV
                     HWDATCLLVDTLLARGRTAEARQVADRYDFGPPYPSAMVLPDAPCVRGRLLLAEGRTE
                     EAVAELESAGAALEPRGRFNGVWAPWAGDLARALADTDPVRGAQLATRARVHAERFGT
                     DTAIGEALRCLALFAPEEEAVHLLSESVRHLEISSSAYEHALARFEYGVAKRSPREIA
                     RARKLATACGAEGLATRAQQACASIRSAE"
     gene            680550..681080
                     /locus_tag="SFLA_RS02820"
                     /old_locus_tag="Sfla_0579"
                     /db_xref="GeneID:11371664"
     CDS             680550..681080
                     /locus_tag="SFLA_RS02820"
                     /old_locus_tag="Sfla_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152716.1"
                     /db_xref="GI:503918722"
                     /db_xref="GeneID:11371664"
                     /translation="MEESRRDRDEEGRARNARPRDGLGRPLPYGSRGVERQPEGVVRS
                     PAETVREAQRLLDAGMPFHAHEVFEDAWKSGPDAERELWRGLAQMAVGLTHAARGNAA
                     GGARLLRRGAAAVKAFRASDPHGIGVEGLIAWAGDLAGRVDPSGPGSGTGEGVSPGVD
                     PVAEAPRLRREDRTRE"
     gene            681186..681608
                     /locus_tag="SFLA_RS02825"
                     /old_locus_tag="Sfla_0580"
                     /db_xref="GeneID:11371665"
     CDS             681186..681608
                     /locus_tag="SFLA_RS02825"
                     /old_locus_tag="Sfla_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017947396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152717.1"
                     /db_xref="GI:503918723"
                     /db_xref="GeneID:11371665"
                     /translation="MTDIINGLGRATAYGALGVVLLVLGIFLIDALTPGKLGRQIWEE
                     RNRNAALLLSSALLGIGGIVFTSIWTTYDDFGKGLASTAAFGLLGLVMMAVAFLVVDL
                     VTPGRLGATLVEREPHPAVWVTASCNLAVSAIVSASIA"
     gene            681670..682029
                     /locus_tag="SFLA_RS02830"
                     /old_locus_tag="Sfla_0581"
                     /db_xref="GeneID:11371666"
     CDS             681670..682029
                     /locus_tag="SFLA_RS02830"
                     /old_locus_tag="Sfla_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152718.1"
                     /db_xref="GI:503918724"
                     /db_xref="GeneID:11371666"
                     /translation="MSTSDQDQDQRQEQEQDQEPDGSPAGIPGAAAEERRLTPRQARR
                     LRVVLSSVGMAAMAVVLALRIASRSSVLVVGVYGLALILCGVVIELSRNGRTRLGSWL
                     LGVGLVAAVGADWLLIP"
     gene            complement(682040..683311)
                     /locus_tag="SFLA_RS02835"
                     /old_locus_tag="Sfla_0582"
                     /db_xref="GeneID:11371667"
     CDS             complement(682040..683311)
                     /locus_tag="SFLA_RS02835"
                     /old_locus_tag="Sfla_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014152719.1"
                     /db_xref="GI:503918725"
                     /db_xref="GeneID:11371667"
                     /translation="MTGQPREVDVLIVGAGPAGLAAGAELAAADAGRVEILEREQEAG
                     GIPRHCHHGGFGGRLDRSAYAWASAAGSAYARKGTTGPDFARRGVAAAVAAGAALRTG
                     VTVTGWAGPRTVETTGPAGPEQITARAVILATGARERPRSARLIPGTRPPGVYTTGEL
                     QQAVHLYGLRIGTRAVVVGDEPVGHAAVATLRAAGVHVVAVVTDRTAPALRLRSPRVP
                     LLTGTTVTELTGRRRLSGVALRHHDGRTTTLRCDTVVLTGDFVPDHELARRGGIVLDP
                     GTRGPAYDAAYRTSHPGVFAVGNLLHAVERAGYAAQEGRAVAVPVLHRLAGTEEAAGA
                     GRRLVVDAPLRWIAPNVAGPDGARPVGDRFVLRTGRRLPRPLLVVSQDGRELHRQRLL
                     STAVPGRPFTLGAEWVDRVDPDGTDVRITAR"
     gene            complement(683308..684729)
                     /locus_tag="SFLA_RS02840"
                     /old_locus_tag="Sfla_0583"
                     /db_xref="GeneID:11371668"
     CDS             complement(683308..684729)
                     /locus_tag="SFLA_RS02840"
                     /old_locus_tag="Sfla_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_014152720.1"
                     /db_xref="GI:503918726"
                     /db_xref="GeneID:11371668"
                     /translation="MTVTLTTAGPLPPLDDAEATYDVVVVGAGVVGAAVARELARYRL
                     RTALVDASDDIGNATSKANTAILHTGFDAVPGSLEARLVREGRDLLAAYAAEAGIPVE
                     RVGALLVAWDEDQLAALPGLRDKAERNGYHASRIIGADELRAREPHLGPGALGALDVP
                     DESIICPWTTPLAFATQAVRAGVHLHLNCRVRDITPDADGHTLTTSRGPLRTRHLVNA
                     AGLHADEIDRLLGHDVFTVIPRRGQLLVLDKLARPLVGHILLPVPGPAGKGVLVAPTV
                     FGNVLLGPTAEDLDDKTATGSTADGIRLLREKGRRIVPGLLDEEVTAVYAGLRAATGQ
                     EDYRIQEYPGLRYVAVGGIRSTGLTASMAIGRHVMGLLTAVGLDPGEPHELPPLTMPN
                     LGEAFPRPYRDAALIAADPAYGTLVCHCEQVTLGEIRDALTSTIPPHSPDGLRRRTRA
                     RGGRCQGFYCGAAVRALFEEERP"
     gene            complement(684726..686159)
                     /locus_tag="SFLA_RS02845"
                     /old_locus_tag="Sfla_0584"
                     /db_xref="GeneID:11371669"
     CDS             complement(684726..686159)
                     /locus_tag="SFLA_RS02845"
                     /old_locus_tag="Sfla_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_033249341.1"
                     /db_xref="GI:702730581"
                     /db_xref="GeneID:11371669"
                     /translation="MTEPVLAIDQGTSGTKALVICPERGVIGSGSAPVRPRYGPGGLV
                     EADPAQLIGSVLDAGRRAVADAGEPVAAVGLANQGETVLAWDPATGRPLTEAVVWQDR
                     RAEGVCGDLAAHGDELKRLTGLPLDPYFAAPKMAWIRRELTREGVVTTSDSWLVHQLT
                     GAFVTDAATAGRTQLLGLHDVGWSPAALEIFGLSDERLPVVVDCAGPVGTTTAFGAEV
                     PLTGLLVDQQAALLAQNALEPGQAKCTYGTGAFLLAQTGARPSTGATGLVSCVAWRLG
                     GRTAYCLDGQVYTAASAVRWLTDLGVISGAADLDPVGASVPDTGGVTFVPALAGLAAP
                     WWRSDLRGSVTGLGLDTTAGHLVRALCEGIAAQVVALADAVASDLGTPLTTLRVDGGL
                     TRSSLLMQTQADLLQRPVEVSALPDATALGAGVVARLGLDPGLPPSRATPPWQPSAVY
                     EPRIGPEEASERLAGFRSAVDGLLERA"
     gene            686534..687541
                     /locus_tag="SFLA_RS02850"
                     /old_locus_tag="Sfla_0585"
                     /db_xref="GeneID:11371670"
     CDS             686534..687541
                     /locus_tag="SFLA_RS02850"
                     /old_locus_tag="Sfla_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152722.1"
                     /db_xref="GI:503918728"
                     /db_xref="GeneID:11371670"
                     /translation="MATGDFRPVYHPAGHDHALRVALQDLRTGRWLAMRDLLENTPDW
                     ASWTQRTQVLAAVAAGSDTVQAWLAEEPRSVAATVMHARVRVERAVRAHREKHPSAQQ
                     LWQEAWEGCRSAAHASPADPVPWVCLLALSQLDEGQRLEEHRLLPPGPMLFPGPWGLL
                     AEADKRDPFNREAYHRMLQFVYARRASGTLSEAVNFVQWAASSAPEGSALHVLPLYVR
                     VERYRREHGHERALDLHWVTEDGERDARRALDIWFVAADPPARSLLDLNHLAHALWGS
                     LRFTDAAQVFRAMGPYYTSVPWAHRTRTPQDPAGAEEVFLRARSRCLAAEHEPGREPR
                     G"
     gene            687606..689135
                     /locus_tag="SFLA_RS02855"
                     /old_locus_tag="Sfla_0586"
                     /db_xref="GeneID:11371671"
     CDS             687606..689135
                     /locus_tag="SFLA_RS02855"
                     /old_locus_tag="Sfla_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_014152723.1"
                     /db_xref="GI:503918729"
                     /db_xref="GeneID:11371671"
                     /translation="MSISASTPSSTEPAPQKDEEQRLRELGYQPVLARRMGGFGNFAI
                     SFSVISILSGCMTLYGFGMSTGGPSVMLWGWAGVGLFVLCVGMALAEVTSAYPTSGAL
                     YYMADRLGGRKWGWYTGWLNLLGLLGAIAGIDYGAALFTGALLNLQWGFDPTPGHTMV
                     IFLCILLLHAVLNLFGVRLVSVLNSISVWWHLAGVAVIVTVLAVVPSNHQSPSFVFTE
                     FVNDTGWENPLYVAAIGLLLAQYTFCGYDASAHLSEETSNASVTAAKGIVRAIWVSWV
                     AGFVLLAGLTFAIQDYAGTQNSATGVPPAQILIDALGTAGATAMLLIVIAAQLFCGNA
                     EVAAASRMVFAFSRDNALPGSALWRRVSARTQTPVPAVWLSVGVAALLAVPSLYSATA
                     YGAVTAINVIGITPAYAIPIYLKLRAGDRFERGPWHLGRWSKPIGWIAVVWVALVTVL
                     FLLPQSSPVTIDSMNYASIALVAVLILATVWWFVARRSYSTPAAYGNAREQAEIAEGI
                     V"
     gene            complement(689158..689925)
                     /locus_tag="SFLA_RS02860"
                     /old_locus_tag="Sfla_0587"
                     /db_xref="GeneID:11371672"
     CDS             complement(689158..689925)
                     /locus_tag="SFLA_RS02860"
                     /old_locus_tag="Sfla_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014152724.1"
                     /db_xref="GI:503918730"
                     /db_xref="GeneID:11371672"
                     /translation="MDTFSLWQLAALAAASTLVGFSKTAVSGANTISLAVFAAVLPAR
                     ESTGVLLPILIAGDVLAVLVYRRHAHWPTLLRLFPAVAVGVAAGTVFMMWADDDAVRT
                     SIGAILLLMAGVTLWRRREGPQPSPDEEGSGPPSRGERLKARSYGVLGGFTTMVANAG
                     GPVMSLYLLSAGFRKLGFLGTSAWFFLIVNTSKVPFSVGLGLIDARSLLLDAALVLFV
                     VPGALLGRACIGRINQKIFDRIVIGATVLGGLQLLLG"
     gene            690073..691194
                     /locus_tag="SFLA_RS02865"
                     /old_locus_tag="Sfla_0588"
                     /db_xref="GeneID:11371673"
     CDS             690073..691194
                     /locus_tag="SFLA_RS02865"
                     /old_locus_tag="Sfla_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014152725.1"
                     /db_xref="GI:503918731"
                     /db_xref="GeneID:11371673"
                     /translation="MREPVELRRKRILAVVHARGAVKVSSLATELDVSAVTLRRDVEE
                     LARAGMLRRGHGVVGPVGEAGPTASVPPARSGEAAGEEAAIALVVPERHSYLYETLHG
                     ARTTLEAAGARIALHIAPQAAGAERPQVERALAAGVRGLLIAPRWRSAAGEEADYGWL
                     AEVGVPTVLMERRPRPGSALHAVDAVCSDHWYGIHLAVDHLVSLGHRRLVLAARNDSP
                     TARSLRAAFADIAAARPEVEDWSVVLSSPNAGPGEPGSREEVPDLAALLRERGATGAV
                     LHGDEDALMLVQRLAESGIRVPRDCSVVAYDDVVAALGSTALTAVAPPRAEIGRAAAE
                     LLLHRLAHPAGASGPVRRTELLPRLKVRGSTAELLTPIN"
     gene            691297..692664
                     /locus_tag="SFLA_RS02870"
                     /old_locus_tag="Sfla_0589"
                     /db_xref="GeneID:11371674"
     CDS             691297..692664
                     /locus_tag="SFLA_RS02870"
                     /old_locus_tag="Sfla_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014152726.1"
                     /db_xref="GI:503918732"
                     /db_xref="GeneID:11371674"
                     /translation="MPGRQSRRHVLATIAALPLTGALSACGGGGGDTRSGGTSSTGRT
                     VSSGNGRKTRITFWSALRGSQEVVDAFNRGHDTIQVDFQQIPSGGQGGYAKLSNAARA
                     GNAPDIATIEYPQVPGFAIDGVCRDLTGLMSDGLRAKLLPQALGLTTFEKRVFSVPLD
                     IEPMVMHYRTDLFERYGLTVPRTWEEFEDTARTVRRKGDERRMALFPTDGDTHFAAWS
                     WQAGARWFDTSGGAWNLSLADAPTRRVAAYWQRLTDQHLVFMNASESRQSDAQIAGGA
                     VLSRLSGAWDAGAQMKARPGQKNRWAIAPLPQWDPADPGVGTHGGSTFAVTRDSTAPE
                     AAMEFIEWQVSHPDALRARLSSGASSQYPAAPGLVDVGREAFDRSYYGGQDIYSLFER
                     EALKIRAGWTWGPRMTATGKLMKDGFARASGGQGDILGAVRAAEAGTVPDLEALGLST
                     TRHST"
     gene            692706..693707
                     /locus_tag="SFLA_RS02875"
                     /old_locus_tag="Sfla_0590"
                     /db_xref="GeneID:11371675"
     CDS             692706..693707
                     /locus_tag="SFLA_RS02875"
                     /old_locus_tag="Sfla_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014152727.1"
                     /db_xref="GI:503918733"
                     /db_xref="GeneID:11371675"
                     /translation="MTSATPVSAPAETTAPPAPERHVGAAPAPAGRGSARRRELGACG
                     VLMTPFFVLMVTVFLIPVATAVRLSFFSDDQPGLGFGPERTVFAGLRNYTAVVTDPTF
                     LGGLGIVALYCLIYIPLMVAGALALALLLDSGVVRLRGTAQLALFLPHAVPGIIAALI
                     WLYLYTPGISPVIEVLGKADITVDFLGVHTVLPSIVNIALWSNLGYNMVVFYAALQAV
                     PREVIEASVVDGAGPVRTALQVKAPLVRSSIVMVAMFTLIFALQLFTEPMLLSQSTPM
                     INSRFSPSMYIYDAAFTRNNYGLAAAASVVLLLCTVALSYGVTRWTNRAAAAEEGAR"
     gene            693704..694579
                     /locus_tag="SFLA_RS02880"
                     /old_locus_tag="Sfla_0591"
                     /db_xref="GeneID:11371676"
     CDS             693704..694579
                     /locus_tag="SFLA_RS02880"
                     /old_locus_tag="Sfla_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014152728.1"
                     /db_xref="GI:503918734"
                     /db_xref="GeneID:11371676"
                     /translation="MSTSTASRTASPLRPRLLGRSVVNLVVGISVLYTLLPVLWLVLA
                     STKNRDALFSSNVLSLTDFSFVRNLTDLFAMDGGLYGRWYGNSLLYAVLGAALGALVS
                     IACGYAFDKYRFAHKEKLFGLVLAAVMVPQTVLALPLYLMASAAGLVNTFWAVFIPVL
                     FNPFGVYLGRIFSQGYVPDEVLEAARMDGAGELAAYFRVALRMLGPGLVTVFLFQLTA
                     IWNNFFLPMVMLSDQDLYPVSLGLYSWNSSASVSPEYYPVVIMGSLLAVVPLILAFAL
                     LQRFWRSGLTAGAVK"
     gene            694617..695645
                     /locus_tag="SFLA_RS02885"
                     /old_locus_tag="Sfla_0592"
                     /db_xref="GeneID:11371677"
     CDS             694617..695645
                     /locus_tag="SFLA_RS02885"
                     /old_locus_tag="Sfla_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_014152729.1"
                     /db_xref="GI:503918735"
                     /db_xref="GeneID:11371677"
                     /translation="MSRTPPAHRRPRAALAMGADAAAAVLSPGSLAALAEVCTLAPLP
                     AIDDFTTEAARAVLADTEVLVTGWGCPPIHAGVLAAAPELRAVVHTAGTVRGHVTDAC
                     WDRGIEVSSAAAANALPVAEYTLAMILLSGKRVLERARDFRATRVRDAWLATPPQVGN
                     YRRTVGILSASLIGRRVIELLRPYDLRVLLHDPYVTDEEAAALGVRPVGLAELFAESD
                     VVSVHTPLLPATTGLVSRALLTTMRPDAVLINTSRGAVVDQDALTDVLRADRVRAVID
                     VTDPDPLPADHPLWDCDNAVITPHLAGSQGNELRRLADLAVGEVARWAAGDGFAHPVR
                     RERLAFLA"
     gene            695642..697537
                     /locus_tag="SFLA_RS02890"
                     /old_locus_tag="Sfla_0593"
                     /db_xref="GeneID:11371678"
     CDS             695642..697537
                     /locus_tag="SFLA_RS02890"
                     /old_locus_tag="Sfla_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152730.1"
                     /db_xref="GI:503918736"
                     /db_xref="GeneID:11371678"
                     /translation="MSPLPFPLPSEDRATSPHTGWTRAHWEATADGLLDAAWKWSTLG
                     RALLDLPGRPSRSGVRSDGLEGYARTFLTAAFRVAGAKGEDPHNWLERYADGLTAGTR
                     TAGRDDAESWPLILDHTVFGQPMVESASVAIGLRLTRPWLWDRLDGATQDRAEAWLRG
                     ALRHTPAPNNWYLFPFSVAGFLESVGRGDAETARARQRALDLLEVWYRGEGWYADGDG
                     RAFDHYNGWALHLYPVLDAYLSGDAELSALHGARLSEHLESFSLMFGADGAPMHFGRS
                     LTYRFAAGAAVGMGAVSGHTPLAPGVSRRLVSGSLRYFLERGSVGEDGLLGLGWHGPH
                     DATLQVYSGPSSPYWASKAFVALLAPAEHPLWTAREEPAPSEGPDRVLSLPSPGLLVQ
                     STRADGVVRLHNHGSDHVRPHEGETADVADPLYARLAYSTATGPTASANTADNHLSVR
                     VGGSRSSRVRIHPLGAGHGDGWGWAASWHTPVFAGGPPTWPGLRVESVTVVRGRYELR
                     VHRILGAPAGSRAEETGWATGPRDAVSSALHGLHGWEEREDVRAPQGTAFTRWAVLPR
                     LGADVEGTDLLVALASLTAEEDPAPLPTAVSGVNVDVDTVEVAWADDGSMTRVGFAPL
                     EVTHRLR"
     gene            complement(697644..698282)
                     /locus_tag="SFLA_RS02895"
                     /old_locus_tag="Sfla_0594"
                     /db_xref="GeneID:11371679"
     CDS             complement(697644..698282)
                     /locus_tag="SFLA_RS02895"
                     /old_locus_tag="Sfla_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152731.1"
                     /db_xref="GI:503918737"
                     /db_xref="GeneID:11371679"
                     /translation="MTTPTARETVLGRIRDALALAPAPDTVIPRNYRTGRTLPDGERL
                     ALLTDRLVDYRATVHPCTADRTAEVVAGILNERGARRIGVPDGLDERWLGAYDGEVRR
                     DSADVPAPSLDALDGVVTASAVSCAETGTIFLDGSPDQGRRALSLVPDLHVCVVDLSS
                     VVAGVPEAVARLVPERPTTLISGPSATSDIELERVEGVHGPRTLAVVIRTDA"
     gene            complement(698279..699823)
                     /locus_tag="SFLA_RS02900"
                     /old_locus_tag="Sfla_0595"
                     /db_xref="GeneID:11371680"
     CDS             complement(698279..699823)
                     /locus_tag="SFLA_RS02900"
                     /old_locus_tag="Sfla_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="WP_014152732.1"
                     /db_xref="GI:503918738"
                     /db_xref="GeneID:11371680"
                     /translation="MSTFLGMPTAPPRSPYGTGHLRGDRTFPEAAHDELRNEQLRRNL
                     GRATRTIRTKRLDVTGELPDWEQLRDAGSAIKTDTMNRLPELLEQLERKVTERGGTVH
                     WARDGVEANEIVTRLIRATGSSDVIKVKSMATQEIGLNEHLEAAGITPYETDLAELIV
                     QLADDRPSHILVPAIHRNRDEIRQIFLDEIPGVDPDLDNVPAHLAAAARAYLREKFMT
                     TRVAVSGANFGIAETGTLAVVESEGNGRMCLTLPDTLITVMGIEKVLPRHQDLEVFLQ
                     LLPRSSTGERMNPYTSMWTGVTPGDGPQDFHLVLLDNGRTAALADAIGREALNCIRCS
                     ACLNVCPVYERAGGHAYGSTYPGPIGAVLTPQLAGMHAAKNDPNSSLPYASSLCGACF
                     DACPVKIDIPSMLVELRHQHTEQSGTTAEKLAMKAAAAVMSRPTLFTAAQKAASLGRA
                     VGGRDGTVPRLPAPFGGWSDSRDLAAPPKQSFRAWLSSAEGAETMRAAAEEGAGRTAD
                     TPEEDR"
     gene            complement(699820..700587)
                     /locus_tag="SFLA_RS02905"
                     /old_locus_tag="Sfla_0596"
                     /db_xref="GeneID:11371681"
     CDS             complement(699820..700587)
                     /locus_tag="SFLA_RS02905"
                     /old_locus_tag="Sfla_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_014152733.1"
                     /db_xref="GI:503918739"
                     /db_xref="GeneID:11371681"
                     /translation="MRIGLFATCLGDTLFPEAVKSTAVLLARLGHDVVFPPGQTCCGQ
                     MHVNTGYQREPVPLVRNFAEQFGDTSIDAVVMPSASCAGSVRHQHEIVAERYGDAALR
                     AGVATVKAKTYELSELLVDVLGVTRVGAYFPHRVTYHPTCHSLRMLRVGDKPLRLLRA
                     VEEIDLVELPEADACCGFGGTFALKNSETSTAMLQDKMHHISGTKADVCTAGDSSCLM
                     QIGGGLTRIRSGTRTLHLAQILGSTRTAPYALTEAAL"
     gene            complement(700740..701471)
                     /locus_tag="SFLA_RS02910"
                     /old_locus_tag="Sfla_0597"
                     /db_xref="GeneID:11371682"
     CDS             complement(700740..701471)
                     /locus_tag="SFLA_RS02910"
                     /old_locus_tag="Sfla_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014152734.1"
                     /db_xref="GI:503918740"
                     /db_xref="GeneID:11371682"
                     /translation="MPVEWQPVRQSRTHELVLQSIEERVFAGELKAGDRLPAERELAP
                     VLGVSRSALREALRVLETIGVLVAQPGRGPDSGARIVRNPDDALGRLLRLHFALGSYS
                     LHDVLEARVVLERSSWEAAARHARAEDLDAAGELVARMGEPDVGVAEFNDLDTRFHVL
                     IAGSSGNALTSTLTSAVRESVRPLILRALEDAGDWPATAGALNAQHERLLRLVREGRG
                     AEAADLVEKHIRGLHGTLVDEKGAP"
     gene            complement(701618..701896)
                     /locus_tag="SFLA_RS02915"
                     /old_locus_tag="Sfla_0598"
                     /db_xref="GeneID:11371683"
     CDS             complement(701618..701896)
                     /locus_tag="SFLA_RS02915"
                     /old_locus_tag="Sfla_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152735.1"
                     /db_xref="GI:503918741"
                     /db_xref="GeneID:11371683"
                     /translation="MAHYDERLHGFEDRLRRDEPEHAGAPERHASRSFRPGPTTWLWL
                     AVGVVGLLTGIFIGHGLLIAAGLVVAGMAGQLLDPQRSRRRGGVPRPR"
     gene            702125..703078
                     /locus_tag="SFLA_RS02920"
                     /old_locus_tag="Sfla_0599"
                     /db_xref="GeneID:11371684"
     CDS             702125..703078
                     /locus_tag="SFLA_RS02920"
                     /old_locus_tag="Sfla_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014152736.1"
                     /db_xref="GI:503918742"
                     /db_xref="GeneID:11371684"
                     /translation="MSLFWRIFLLNAAVLVAAGALLLLGPITVSAPVVLTEALILAGG
                     MTLMLGANALLLRLGLAPLQRVTRAMATIDLLSPRPRPEVAGEGEVAALIETFNSMLD
                     RLEAERATSNARALGAQEDERRRVAQELHDEVGQTLTAVLLELKRVTGHAPEPLREEL
                     TQVQEITRGSLDEIRRIARRLRPGVLEELGLVSALTALTTETPTPRGLTIRRRMEKDL
                     PPLGKEAELVVYRIAQEAFTNTVRHAGATLLELSLRRRPGGVELRIRDDGRGLGDAHE
                     GAGLRGMRERALLIGATLTLSTGATGGTDVRLDVPVRNGNA"
     gene            703083..703754
                     /locus_tag="SFLA_RS02925"
                     /old_locus_tag="Sfla_0600"
                     /db_xref="GeneID:11371685"
     CDS             703083..703754
                     /locus_tag="SFLA_RS02925"
                     /old_locus_tag="Sfla_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_014152737.1"
                     /db_xref="GI:503918743"
                     /db_xref="GeneID:11371685"
                     /translation="MPHSPDGSPKTRILLADDHALVRRGVRLILDGEPDLQVVAEAGD
                     GAEAIEMARSERPDLAVLDIAMPRLTGLQAARELSRVMPELRILMLTMYDNEQYFFEA
                     LKAGASGFVLKSVADRDLVEACRAAMRDEPFLYPGAVTALIRNYLDRVRDGGDVPDRA
                     ITEREEEILKLVAEGHSSKEIAGMLVISVKTVERHRANLLQKLGLRDRLELTRYAIRA
                     GLIEP"
     gene            704000..704803
                     /locus_tag="SFLA_RS02930"
                     /old_locus_tag="Sfla_0601"
                     /db_xref="GeneID:11371686"
     CDS             704000..704803
                     /locus_tag="SFLA_RS02930"
                     /old_locus_tag="Sfla_0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249391.1"
                     /db_xref="GI:702730800"
                     /db_xref="GeneID:11371686"
                     /translation="MPPATVRRRRMRIGAGIAAGIVVLAAVGGGAYVLGDRSGDSAGG
                     SASAPSQSPRLPDGRNGEGGQGGNGGQDGGGGGGGNPDQQMPQTEDGYATDAASGISI
                     PVPDGWKGQSGPIGAGVTTGDYACPGDESEKCVRGGVFSAPAQALKVEATTAKAAAEA
                     DIKANAEESYGEKIYGGITSHEELASRAVTVAGQKGYQVRWKVVTKNGDDGYVESLAF
                     PSPRTASMLVVVRSGFDINSEAPKLSVLDEITRGIKKADGAGTGTGETA"
     gene            complement(704879..706132)
                     /locus_tag="SFLA_RS02935"
                     /old_locus_tag="Sfla_0602"
                     /db_xref="GeneID:11371687"
     CDS             complement(704879..706132)
                     /locus_tag="SFLA_RS02935"
                     /old_locus_tag="Sfla_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152739.1"
                     /db_xref="GI:503918745"
                     /db_xref="GeneID:11371687"
                     /translation="MSARADGHRTRTPAPTTGSGEGHRPRPVARRRTAFLAATASAAV
                     TVVLAGCAPDARTSPSSTAPSARSGSAQKDDRPARLPGGTILVTDFGADTVTFVGPPG
                     RATAGRQSVEVGTAPYGIVLGADGTAWVATAEGVAAVDTVTRRRTALVPYATDTGPVT
                     TGEYRGGGMGIALSPDGGTVYVGVHVPGARGTLEAIDTERRAVVDTVPVGRRPFDVDV
                     SGDGRRIYATGHDSFDVTVVDAAAWTSRRVEVAPYGAEGGLGSWLKPHYAAVRPSDGA
                     LLLPFEGERLAVVDPDTGRVRVERMTADTHQHGVAVTEDGTLFAVGTGPIDPSTDAGP
                     SLTVRAPDGEERVIPLDGPHEDVVVTADGRTAYVSGGFTRDGYWDGISVVDVATGEVT
                     RVPAGTRPLGMVLLGGVAPTDTDAG"
     gene            complement(706417..707382)
                     /locus_tag="SFLA_RS02940"
                     /old_locus_tag="Sfla_0603"
                     /db_xref="GeneID:11371688"
     CDS             complement(706417..707382)
                     /locus_tag="SFLA_RS02940"
                     /old_locus_tag="Sfla_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase"
                     /protein_id="WP_014152740.1"
                     /db_xref="GI:503918746"
                     /db_xref="GeneID:11371688"
                     /translation="MSRKLRTLTAALCALPLAFAAAPPAHAADPTTMTSGFYADPDSS
                     ASRWAAANPGDGRAAAINASIANTPMARWFGSWSGAIGTAAGAYAGAADGRDKLPVLV
                     AYNIYNRDYCGGHSAGGAASPSAYADWIARFAGGIAARPAVVILEPDSLGDYGCMNPA
                     QIDEREAMLTNALVQFNRQAPNTWVYMDAGNPRWADAATMARRLHEAGLRQAHGFSLN
                     VSNYITTAENTAYGNAVNNELAARYGYTKPFVVDTSRNGNGSNGEWCNPSGRRIGTPT
                     RTGGGAEMLLWIKTPGESDGNCGVGSGSAAGQFLPEVAYKMIYGY"
     gene            707634..708605
                     /locus_tag="SFLA_RS02945"
                     /old_locus_tag="Sfla_0604"
                     /db_xref="GeneID:11371689"
     CDS             707634..708605
                     /locus_tag="SFLA_RS02945"
                     /old_locus_tag="Sfla_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041825285.1"
                     /db_xref="GI:754214667"
                     /db_xref="GeneID:11371689"
                     /translation="MAGHAGVSRSVASRALNNAPHVSRAKREAVERAVRQLGYTRNST
                     ARALATRQTGAAALVISGEDPSIFADPFFARVIVGASAALDSADLHLMLCLAASDRGR
                     KRVEELLRSRGADGVMLMALREDDPLTRMADEAQMPVVFGGRPVGSVPRWYVDVDNVG
                     GAREATEHLVSLGRRRVAVICGRMDTEAGRARYRGYRDAMLGAGLDPFPPMEGDFTER
                     SGAAAMTALLTEHPDVDGVFAANDNMAAGALRTVREAGRRVPAEVAVVGFDDLAISQV
                     ADPPLTTVHQPVEALGREMARMLVALVNGQDPTPLVLPTRLTVRASA"
     gene            708701..708934
                     /locus_tag="SFLA_RS02950"
                     /old_locus_tag="Sfla_0605"
                     /db_xref="GeneID:11371690"
     CDS             708701..708934
                     /locus_tag="SFLA_RS02950"
                     /old_locus_tag="Sfla_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase"
                     /protein_id="WP_014152742.1"
                     /db_xref="GI:503918748"
                     /db_xref="GeneID:11371690"
                     /translation="MVIVAACTAARIGEISGCRVGDIDTARSIWTARRQSTPAPGGLT
                     DEGTKGKRARRVPVVEGDPSLVAQRFLCAGKPR"
     gene            complement(709021..709094)
                     /locus_tag="SFLA_RS02955"
                     /old_locus_tag="Sfla_R0003"
                     /db_xref="GeneID:11371691"
     tRNA            complement(709021..709094)
                     /locus_tag="SFLA_RS02955"
                     /old_locus_tag="Sfla_R0003"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(709058..709060),aa:Pro,seq:ggg)
                     /db_xref="GeneID:11371691"
     gene            709225..709926
                     /locus_tag="SFLA_RS02960"
                     /old_locus_tag="Sfla_0606"
                     /db_xref="GeneID:11371692"
     CDS             709225..709926
                     /locus_tag="SFLA_RS02960"
                     /old_locus_tag="Sfla_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_030636741.1"
                     /db_xref="GI:664098920"
                     /db_xref="GeneID:11371692"
                     /translation="MTNTTTPPLHGYGELDRLMGLMTGDEKHGPAATSTLDVLWVLYD
                     RVLRVSPATAGSPGRDRFLLSKGHGPMAYYAVLAARGFFDEELLSGFGAYDSPLGHHP
                     DRLLVPGAEIGSGSLGHGLPLAVGSVLGLRAQGLTEPRVWVLTGDAELDEGSNHEAIA
                     YAGPAGLEQLNTVVIDNASATYARPGGIAARFEAAGWSASTVDGRDHDALYAAFTAPH
                     PGRPHAVIARVAPGR"
     gene            709985..710887
                     /locus_tag="SFLA_RS02965"
                     /old_locus_tag="Sfla_0607"
                     /db_xref="GeneID:11371693"
     CDS             709985..710887
                     /locus_tag="SFLA_RS02965"
                     /old_locus_tag="Sfla_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014152744.1"
                     /db_xref="GI:503918750"
                     /db_xref="GeneID:11371693"
                     /translation="MDTMRDRFIATTTRLLDEDPRIAVVLAEISRDGFGPAERAHPHR
                     VVNVGIREQLLIGAGAGMALTGMRPVMHTFASFLVERPFEQVKLDLGHQGVGGVLVSA
                     GASYDWPAGGFTHMAPGDVALLDTLDGWTVHVPGHPDEAETLLRRSVRGDGRVYVRLS
                     LQSNRAARAVGGPGFETVRRGDGGGVVIAVGPMLDNVLEATEGLDVTVLYATTVRPFD
                     AASLRRAAGAHGTADVVLVEPFLAGTSTAAANDALTDLPHRILGLGVGRSELRRYGQM
                     PDHLVAHGLDPRSLRQRITGFLHP"
     gene            711084..714110
                     /locus_tag="SFLA_RS02970"
                     /old_locus_tag="Sfla_0608"
                     /db_xref="GeneID:11371694"
     CDS             711084..714110
                     /locus_tag="SFLA_RS02970"
                     /old_locus_tag="Sfla_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding protein"
                     /protein_id="WP_014152745.1"
                     /db_xref="GI:503918751"
                     /db_xref="GeneID:11371694"
                     /translation="MSSRPLPSSTPPRALPPASIAVLALFSLLASIVGAAAVSSFPRA
                     PAVSFRVLVYSGGAHGPRGTIRAGVEAVRELGVRHGFGVEATDDPAVFDDARLARFHA
                     VVFNNTAAAPEGDGGLHERGRAALQQYVRAGGGWVGLHDASDGAGDWDWYRGLVGAAL
                     DRSAPVQAGRVEVLDRAHPSTVALPDLWERTEDWLSWRTGPSATVHTLARIRVRDGIT
                     GLDEGVDHPWSWCQDYDGGRSWFTAGGHAPSAFHEEYFLAHLLGGIEWAAGARPGDCT
                     ATRAGSFQRTRLATGGPGDPVDVAVAPDRRVFVARRTGELEVVDQRTTRVSTALDLAY
                     GPGTAARSDGLIALTLDPRFAENHWLYLLRSDTSGERLLLSRFTAGPDTVDPASEKRL
                     LTLPGRRSTDAADSPAPTGSLAFDRKGSLFAATGDITLPLNAGGPNDLRGAILRLTPR
                     DDGTYTVPEGNLFAPGTPGTRPEIYATGMRNPFRFTVDPVSGIVLATDTRPDGTVGHF
                     RITGAGQIGSPFCSGGLPRGATDCAPRFGGAPDAAGPGGGITMSGPVYDYDAGSLYRT
                     RFPEYFAGKWLTYDPAGRRFTTLSFLREDRTFTAPRLGPVSAGELQSVDAVFEDMEWN
                     RPTAAVFGPDGALYVVDSGQDDGTDHDGDDGGSGIFRIDHVGLGALPGAAVTADRDNG
                     SAPLTVAFTGAGSGLPGGVPVTYAWDFDGDGGTDSTEANPSYTYRAEGRFTARLTVTG
                     PEGTTAVAGQDITVGNNRPRITVRRPADGGLFRPGDTVGFTVEVRDEEDGRNTPVDCS
                     RILVRTRTGRPGALSPLPHSRGCRGSIVTEAGDVPRSGRYRVTMRYTDEGGPDAPELT
                     GSASLTLRTSFQEAEDFTSTGGAHGGAVAGNRTGASGGRVLTEIEDGDWIAFDPLDLG
                     GIRSVTVGATPCGLGGTVEFRAGSPDGPLLGSVRVPGAGHGGGDVTPTAALRSQGRSD
                     RLYVVFTDAAWNSEKPDLFAVDWFRFHGPGDGTGAS"
     gene            complement(714142..714753)
                     /locus_tag="SFLA_RS02975"
                     /old_locus_tag="Sfla_0609"
                     /db_xref="GeneID:11371695"
     CDS             complement(714142..714753)
                     /locus_tag="SFLA_RS02975"
                     /old_locus_tag="Sfla_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_014152746.1"
                     /db_xref="GI:503918752"
                     /db_xref="GeneID:11371695"
                     /translation="MVYDDSSDSSEFFPVALKVLVAGGFGVGKTTFVGAVSEIAPLST
                     EELLTQVSAATDSLEGIESKSATTVAMDFGRITLSEQHVLYLFGTPGQERFWFMWDEL
                     SKGALGAVVLADTRRLAECFAAVDFFERRGIGFIVAVNEFDGAYRYEPEEVRAALDLG
                     PEVPVVLCDARIASSGTGALVTLVQHLINATAPTPLSGFGATP"
     gene            complement(714731..715102)
                     /locus_tag="SFLA_RS02980"
                     /old_locus_tag="Sfla_0610"
                     /db_xref="GeneID:11371696"
     CDS             complement(714731..715102)
                     /locus_tag="SFLA_RS02980"
                     /old_locus_tag="Sfla_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152747.1"
                     /db_xref="GI:503918753"
                     /db_xref="GeneID:11371696"
                     /translation="MPAPQDGPLLDDAAGRLIRPYTVSNGRTRPTTVLDLLSLVMATG
                     SDPQVHLGPEHTVALELCDGPTSVAEIAAHLRLPAVITKVLLSDLVDCGAVTAHAPAF
                     HDMPTDRSLLEAVLDGLRRQL"
     gene            complement(715105..715539)
                     /locus_tag="SFLA_RS02985"
                     /old_locus_tag="Sfla_0611"
                     /db_xref="GeneID:11371697"
     CDS             complement(715105..715539)
                     /locus_tag="SFLA_RS02985"
                     /old_locus_tag="Sfla_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynein regulation protein LC7"
                     /protein_id="WP_014152748.1"
                     /db_xref="GI:503918754"
                     /db_xref="GeneID:11371697"
                     /translation="MTSEMPSGQVSDLDWLLSGLVQRVPYTRSAVLLSADGLVKSVHG
                     MDADSADHMAALAAGLYSLGRSAGARFGDNGDVRQVVVELDSTLLFVSTAGSGTCLAV
                     LAGREADAAVLGYEMAMLVKSVRPYLMTPLRQPAGAPFTPGL"
     gene            complement(715547..717523)
                     /locus_tag="SFLA_RS02990"
                     /old_locus_tag="Sfla_0612"
                     /db_xref="GeneID:11371698"
     CDS             complement(715547..717523)
                     /locus_tag="SFLA_RS02990"
                     /old_locus_tag="Sfla_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014152749.1"
                     /db_xref="GI:503918755"
                     /db_xref="GeneID:11371698"
                     /translation="MSQLRAPDARPERREGGRHGRPGGRSHSATSRPRAAQPAPDGRL
                     RPQLMRTALLPTVAALLSGAAAVIFTIRASGVRPSGSLLAALGGSGALAVAAVAAAFL
                     GAGRVSAAVLDRALTLRRTGAQHHDELQRLVERIRDGEPLPARRATPPAAADADAFDL
                     LAQEMNRAQDSAVAAVVEASQLFRSNGNEQKVEVFVNLARRLQSLVHREIQILDELEN
                     QVEDPDLLKGLFHVDHLATRIRRHAENLAVLGGAVSRRQWSSPVTMTEVLRSAIAEVE
                     QYPRVKLVPPIDGTLRGHAVADVIHLLAELVENATVFSAPHTQVLLRAQRVTAGLALE
                     VEDRGLGMPGPEQKRMNTLLADPDQVNVAHLLQDGRIGLFVVASLARRHGIAVRLQSN
                     IYGGTQAVLVLPEVLLGIDIESTTAPDAAPAPSPGTVHLPPARGAATPAPAQVTAEPS
                     PERAPGGDGQGGGPPLPLRAERVDRPNPAASPPVARTVQPDPAPVPVPFGGPVPSAGP
                     VPPAGAVESAPPRTDAPAPAPAAETRPARPQLPRRSNQEHLAPQLREAPVRRTEDENV
                     LHDPGLMAAFRRGVDLAEAQTAEEPETAHPYGAPGAVPATGPVPSVGAQRSHGLAPLP
                     LRAPTTTATAGPGPVHRTPQTPEPDPRTGNTFKE"
     gene            complement(718148..719923)
                     /locus_tag="SFLA_RS02995"
                     /old_locus_tag="Sfla_0613"
                     /db_xref="GeneID:11371699"
     CDS             complement(718148..719923)
                     /locus_tag="SFLA_RS02995"
                     /old_locus_tag="Sfla_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_033249394.1"
                     /db_xref="GI:702730809"
                     /db_xref="GeneID:11371699"
                     /translation="MSAEPLAPFDHLDHRYRGENPVRTLGHLFRPDRGRLALAVAIFV
                     VKHSPIWLLPLITATVLDVVVQHGPESGIWKASGVLLFILVINYPLHQWYVRCLAGSI
                     RRMGTTLRSALCRRMQQLSIGYHSRVSSSVLQAKVVRDVEAVEQMVQQSSDMGLGAVV
                     TLIGGLVVIGVRVPEFLPVFLVVVPASGFLVMKLRGRLRSHNESFRREVEQLSSRVGE
                     MTTLIPITRAHGLERTALGRVDGSLRQVFAAGMRLDMINGRFGSLAWVILNTLGVLCL
                     TGSALVAYHGWMAITPGDVVMLSSFFTVLTGSVTTLLGLAPILTKGLESVRSAGEVLQ
                     APDLENNAGKARVESVVGRIDFEDVGFAYEDGKSAVDGFTLSARPGETIALVGASGAG
                     KSTVLNLLIGFIRPTSGRILLDGTDMAGLDLRTYRRFLSVVPQESILFEGSIRDNVTY
                     GLGDTDEGTLMRALRDANALEFVDRLPRGLDTVIGEHGAQLSGGQKQRLAIARALIRD
                     PRVLVLDEATSALDNRSEALVQEALTRLVHGRTVFVVAHRLSTIQGADRIVAMEGGRI
                     AEVGTHEELLGTGGVYAGLQPAHPR"
     gene            complement(720555..720998)
                     /locus_tag="SFLA_RS03000"
                     /old_locus_tag="Sfla_0614"
                     /db_xref="GeneID:11371700"
     CDS             complement(720555..720998)
                     /locus_tag="SFLA_RS03000"
                     /old_locus_tag="Sfla_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_014152751.1"
                     /db_xref="GI:503918757"
                     /db_xref="GeneID:11371700"
                     /translation="MSSSLVETVDIKAPVAVTWALWSDVTQWPKFLSHVRRVDPMDER
                     RFSWQLSLPGADKAFVAELTEVVPQDRIAWKTIEGVHHAGVVTFHRLDDTSSRVALQI
                     EYDPHGFVERLGALTNLDSALANYDLGEFQKLAEATVAGDGPRAT"
     gene            complement(721164..721664)
                     /locus_tag="SFLA_RS03005"
                     /old_locus_tag="Sfla_0615"
                     /db_xref="GeneID:11371701"
     CDS             complement(721164..721664)
                     /locus_tag="SFLA_RS03005"
                     /old_locus_tag="Sfla_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_014152752.1"
                     /db_xref="GI:503918758"
                     /db_xref="GeneID:11371701"
                     /translation="MTENTTTSFHPLLTRHADAETCVDPSSTMRLLGEAGDADGGFTS
                     YRSTFAEGAVGAPAHFHTRATELFFVLDGALRVLVGEEVTVLRKGDFLAVPPHTPHAF
                     AAAPGHAADVLFVFDHAMDRFAYLRLLGRVMRGEADPKEIAESAERFDNHYVESAAWR
                     AALDAS"
     gene            721868..722584
                     /locus_tag="SFLA_RS03010"
                     /old_locus_tag="Sfla_0616"
                     /db_xref="GeneID:11371702"
     CDS             721868..722584
                     /locus_tag="SFLA_RS03010"
                     /old_locus_tag="Sfla_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152753.1"
                     /db_xref="GI:503918759"
                     /db_xref="GeneID:11371702"
                     /translation="MTEGTRTDRLGLLLGQFDQAGEMARVRLKGLGDDEYLWEPVPGS
                     WSIRRRGEAPTPRAYGPGEWVLDRGAPDIPAAEYAEVARQAAGGMTVSRIAEDWSVSV
                     ERVEQVLAHRGEPVPDETPVTTIAWRLGHLHSCLAGQWEWTFGERRREPRLLVDFSPS
                     ASVALHRFWDLIDRWRESLATVTEEQLDTVGFSRYPYGSDSDDPFVAVLAGANLEFIH
                     HMAEVSLLRDLWRGRFTASE"
     gene            722738..723475
                     /locus_tag="SFLA_RS03015"
                     /old_locus_tag="Sfla_0617"
                     /db_xref="GeneID:11371703"
     CDS             722738..723475
                     /locus_tag="SFLA_RS03015"
                     /old_locus_tag="Sfla_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014152754.1"
                     /db_xref="GI:503918760"
                     /db_xref="GeneID:11371703"
                     /translation="MKFAVIGGTGLIGSKVVEKLRADGHEAVPCAKSTGVDVISGEGV
                     EKAVAGADVIVDLTNSPTFDEASPEFFRRSMGNLLDAGRKAGVGHFVALSIVGVDQVP
                     ELDYYRAKTLQEELLAAGPIPYSIVRATQFMEFVDAIMSWSSDGDTVRLPETPLQPIA
                     AQEVADAVAEAAMGTPLRGVHNIAGPEVFPLDELGRITLAARSDGRTVVTDDTAGMFS
                     VVRGDVLTGRNDASLAPTRYADWLASH"
     gene            complement(723615..724322)
                     /locus_tag="SFLA_RS03020"
                     /old_locus_tag="Sfla_0618"
                     /db_xref="GeneID:11371704"
     CDS             complement(723615..724322)
                     /locus_tag="SFLA_RS03020"
                     /old_locus_tag="Sfla_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="B3/4 domain-containing protein"
                     /protein_id="WP_014152755.1"
                     /db_xref="GI:503918761"
                     /db_xref="GeneID:11371704"
                     /translation="MTVFRIHPDVADAFPGTRIALVTATGLRGREPWPEATAALAHLE
                     RDAADGVWQPADESDPRIEAWHTAYRSFGTNPRRIRPSVDALGRRVAKKGALPRINPA
                     VDSYNAVSLRHGLPAGAFDRAHVSGDVDIRYADGSERFTPLGEPDTVENPKPGEIIYA
                     DAHGVLTRHWNHRDAHRTRVTEDSTQVTFVLETLHAHRDGHLIEAAAKELQALLLPHA
                     DHCTVRYLDPAGPDAAV"
     gene            724530..725114
                     /locus_tag="SFLA_RS03025"
                     /old_locus_tag="Sfla_0619"
                     /db_xref="GeneID:11371705"
     CDS             724530..725114
                     /locus_tag="SFLA_RS03025"
                     /old_locus_tag="Sfla_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014152756.1"
                     /db_xref="GI:503918762"
                     /db_xref="GeneID:11371705"
                     /translation="MPEADEALRTLARNVRAARTRAGLSLDELGRRAKVSKGALVGLE
                     KAQGNPNFATLVRLADTLGISVSALLEGPAEGRVRVVSADAVMPLWAGERGSEARLML
                     TTSGPAPVEVWRWKLEPGEEYPSHPHQAGVVETVSVTSGRMTLVVDGTEHSVEAGQTA
                     TFDGDATHAYRGSGSGTCHLIMTVHIPPGPGSTN"
     gene            complement(725209..725691)
                     /locus_tag="SFLA_RS03030"
                     /old_locus_tag="Sfla_0620"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:11371706"
     gene            726041..726862
                     /locus_tag="SFLA_RS03035"
                     /old_locus_tag="Sfla_0621"
                     /db_xref="GeneID:11371707"
     CDS             726041..726862
                     /locus_tag="SFLA_RS03035"
                     /old_locus_tag="Sfla_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate-binding protein"
                     /protein_id="WP_014152758.1"
                     /db_xref="GI:503918764"
                     /db_xref="GeneID:11371707"
                     /translation="MTRTARPTGRALQVAGAGAAVLLALSGCSSSDDSSSAASGSSAS
                     SSDELSGTVTVFAAASLKESFTALGEEFEKAHPGTKVTFNFGGSDSLAAGITGGAPAD
                     VFASASPKTMKIVTDAGDASGTPATFVRNQLEIATLPGNPDTISSLKDLTDPGLKVVL
                     CDKEVPCGAAAQKALDASGLKLTPVSYEQDVKSALTKVELKEADAAVVYKTDVHAAGD
                     KVEGVEFPESADAVNDYPIVQLKNTGNAAAAKAFIALVQSAQGQKVLTGAGFLKP"
     gene            726859..727710
                     /locus_tag="SFLA_RS03040"
                     /old_locus_tag="Sfla_0622"
                     /db_xref="GeneID:11371708"
     CDS             726859..727710
                     /locus_tag="SFLA_RS03040"
                     /old_locus_tag="Sfla_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="WP_014152759.1"
                     /db_xref="GI:503918765"
                     /db_xref="GeneID:11371708"
                     /translation="MTELDVGAATGPPKGGPRRVRTRGGPGVPLPLLLPALIGLAFLI
                     VPLVALLVRAPWRSMPELLTSAEVWQALRLSLICATAATAVSLVIGVPLAWLLARVEF
                     PGRGLVRALVTLPLVLPPVVGGVALLMALGRNGIIGKSLDDWFGITLPFTTTGVVIAE
                     AFVAMPFLVISVEGTLRAADPRFEEAAATLGASRFTAFRRVTLPLIAPGIAAGAVLAW
                     ARALGEFGATITFAGNFPGRTQTMPLAVYLALQSDPEAAIALSLVLLAVSIAVLAGLR
                     DRWMTAG"
     gene            727707..728828
                     /locus_tag="SFLA_RS03045"
                     /old_locus_tag="Sfla_0623"
                     /db_xref="GeneID:11371709"
     CDS             727707..728828
                     /locus_tag="SFLA_RS03045"
                     /old_locus_tag="Sfla_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014152760.1"
                     /db_xref="GI:503918766"
                     /db_xref="GeneID:11371709"
                     /translation="MTETPDTAHGTRDARTPDARGHGPDGSETGLDARLVVERGGFRL
                     DVALTAAPGEVVALLGPNGAGKTTALRALAGLMPLSGGHLRLDGTALERTPPESRPVG
                     VVFQDYLLFPHLTALDNVAFGPRCHGATKASAREQAADWLGRLGLADHAGAKPRRLSG
                     GQAQRVALARALATRPRLLLLDEPLAALDARTRLEVRSQLRRHLADFEAVAVLVTHDP
                     LDAMVLADRLVVVEDGRIVQEGAPSDVARRPRTDYIAQLVGLNLYRGEADGHTVRLDD
                     GPSLTTSEALSGPVFVAFPPSAVTLHRDRPAGTSARNLWHCEIAGLETHGDQIRADLS
                     GELRLAADLTTVAAAELDLRPGAEVWATVKATQTHAYPV"
     gene            complement(728898..730094)
                     /locus_tag="SFLA_RS03050"
                     /old_locus_tag="Sfla_0624"
                     /db_xref="GeneID:11371710"
     CDS             complement(728898..730094)
                     /locus_tag="SFLA_RS03050"
                     /old_locus_tag="Sfla_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_014152761.1"
                     /db_xref="GI:503918767"
                     /db_xref="GeneID:11371710"
                     /translation="MTGADHQPSLRTRLRSLRPVAFGADPAGERMERIRRSPNFADGV
                     FQNPEGARTRPSGSMLEFAKVYFSKEERARRSPLGTVPVHATTLADLSAPPASGLRVT
                     WLGHSSVLVEIDGRRVLFDPVWGDRCSPFAFAGPKRLHPVPLPLTSLGPVDAVVISHD
                     HYDHLDLPTIKALAGTDTVFAVPLGVGAHLERWGVPTDRVRELDWNETTRIAGIGLTA
                     TPARHFCGRGLRNQQHTLWASWVVTGSEHRVYHSGDTGYFSGFKDIGAAHGPFDVTMI
                     QVGAYSEYWPDIHMTPAEGLRAHLDLQGGAPHGALLPIHWGTFNLAPHPWSEPGEWMK
                     DVADEAGQAVALPRPGEPFEPAGKLPSDTWWRAVAAPAAQPWRRSGVAEAPPVHQEEV
                     DLAGER"
     gene            complement(730239..730679)
                     /locus_tag="SFLA_RS03055"
                     /old_locus_tag="Sfla_0625"
                     /db_xref="GeneID:11371711"
     CDS             complement(730239..730679)
                     /locus_tag="SFLA_RS03055"
                     /old_locus_tag="Sfla_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate oxidase"
                     /protein_id="WP_014152762.1"
                     /db_xref="GI:503918768"
                     /db_xref="GeneID:11371711"
                     /translation="MTDIEPGRDALLRLIGQHDGGVLVTLRRDGRPQLSNVNHAYYPD
                     EGVIRVSVTEDRAKTRNLRRDPRASYHVTSDDRWAWTAADVTAELTPSAAGTHDAVVE
                     QLITLYRDVQGEHPDWDDYRRAMVRDRRVVLTLRIDHVYGRPRA"
     gene            730832..732073
                     /locus_tag="SFLA_RS03060"
                     /old_locus_tag="Sfla_0626"
                     /db_xref="GeneID:11371712"
     CDS             730832..732073
                     /locus_tag="SFLA_RS03060"
                     /old_locus_tag="Sfla_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014152763.1"
                     /db_xref="GI:503918769"
                     /db_xref="GeneID:11371712"
                     /translation="MPSPSPAPLISLTWTDHVTGTEGYLVVDRLVRGVSSGGLRMRKG
                     CTLAEVTGLARGMTMKEALHFDADSPARYIPLGGAKGGIDCDPRDPAAYGVLVRFLRA
                     VRPYVENVWTTGEDLGLGQDIVDRAAEEAGLVSTVQAVYPLLEDEQEARRRLADAFAV
                     TVRGIGLDELVGGCGVAESALAALDRAGVAHSGTRVSLQGLGTMGGATARFLSDAGLS
                     IVAVADVKGTIANPAGLDVEALLAARDAHGAVDRGALRAEDQELPGDAWLGTDAEILV
                     PAAVSYAVDAVNQAAIRARWVVEAANMPVLPEAEALLVGRGITVLPDVVVNSATNAWW
                     WWTLFGDIGPDAEEAFRHTRRSMRALVDRVLERAAADGCTPRAAAHALAADRLPVMAE
                     RFGWYGEPLGRTARDPGRGVG"
     gene            732104..732694
                     /locus_tag="SFLA_RS03065"
                     /old_locus_tag="Sfla_0627"
                     /db_xref="GeneID:11371713"
     CDS             732104..732694
                     /locus_tag="SFLA_RS03065"
                     /old_locus_tag="Sfla_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_030125375.1"
                     /db_xref="GI:662754310"
                     /db_xref="GeneID:11371713"
                     /translation="MAERREELLRAAVEQIEVRGVSAVRIADVAAVLGVSNALVLYHF
                     SSKEKLVAAAFAYAAEADLAHLRKLMSRRTSAVRRLRAAVRWYAPTGQAKGWRLWIEG
                     WASSLRDPVLREVAADLDQQWKAELAEVIDEGAAAGEFRCDDPMSVAWRLTALLDGLA
                     VQMTSYAGPLSRATMLRWTEQALARELGIDHEVLTA"
     gene            complement(732740..733741)
                     /locus_tag="SFLA_RS03070"
                     /old_locus_tag="Sfla_0628"
                     /db_xref="GeneID:11371714"
     CDS             complement(732740..733741)
                     /locus_tag="SFLA_RS03070"
                     /old_locus_tag="Sfla_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152765.1"
                     /db_xref="GI:503918771"
                     /db_xref="GeneID:11371714"
                     /translation="MQFVNTWRAVAAATGRADRGAAEAGVRLAYRAAGLAEPERVIWA
                     DSPKAAVEVVEKLTGAGRSVREEVRTRPWAEERRRLYDELGPAGWSALWSATGAQLWE
                     TTAALAERIRTGVVAELAARPEDESSIRLVLLDAVLGQHDAAWLAAFDGRGDRLTGLA
                     EVARNAGWWWPYEHAVVIVERPEALHRDEAGRLDRADGPALAYPDGFALYAWRGMPVP
                     AEFLDGLASLTPDRIRAEENAERRRVMLEYYGYDRYLAESGAEPVHRDETGILWRIAM
                     AGDEDVVMVEVVNSTPEPDGTHRTYWLRVPPRTRTAKEGVAWTFGLDGEAYAPVRQT"
     gene            complement(733850..734176)
                     /locus_tag="SFLA_RS03075"
                     /old_locus_tag="Sfla_0629"
                     /db_xref="GeneID:11371715"
     CDS             complement(733850..734176)
                     /locus_tag="SFLA_RS03075"
                     /old_locus_tag="Sfla_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003964833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152766.1"
                     /db_xref="GI:503918772"
                     /db_xref="GeneID:11371715"
                     /translation="MYRQGDVLMMALEESEVPRHFLDAPGEPRDGRGRMVLALGEVTG
                     HAHAVQGPGRLLREAGPFGPMLLHLPEGGRVVHEEHAAIALPQGWFRVVRQREYAPGA
                     VRIVAD"
     gene            734496..735446
                     /locus_tag="SFLA_RS03080"
                     /old_locus_tag="Sfla_0630"
                     /db_xref="GeneID:11371716"
     CDS             734496..735446
                     /locus_tag="SFLA_RS03080"
                     /old_locus_tag="Sfla_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152767.1"
                     /db_xref="GI:503918773"
                     /db_xref="GeneID:11371716"
                     /translation="MSDADRLHELLGLPAVEFQREAEEATRPPAGAVAWRVSVDPYDG
                     DVAWEAEFEAFLEAVDPSGVEALIIGQWGESYEETSAYPIGLVVAAADRLTSLRAVFV
                     GDLVAEEAEISWIEQSDVTALLTAFPQLTHLGVRGGTGLTFPPVKHDSLRGLVIESGG
                     LPAEALRGVLDSELPALESLDLWLGVSSYGGDVVVPDLAPLLAGTRFPRLSHLGLRNS
                     ELQNEIASAIASAPVVAQLRTLDLSNGTLGDEGAAALLEGQPLTHLTSLDLHHHFLTE
                     PMERRVAEALEPHGVSVDLSGRSEPWDGLGPEGRYTAVAE"
     gene            735454..736422
                     /locus_tag="SFLA_RS03085"
                     /old_locus_tag="Sfla_0631"
                     /db_xref="GeneID:11371717"
     CDS             735454..736422
                     /locus_tag="SFLA_RS03085"
                     /old_locus_tag="Sfla_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152768.1"
                     /db_xref="GI:503918774"
                     /db_xref="GeneID:11371717"
                     /translation="MTDITHHDSFHGLPVHTLQPPSPTDPTAPPAAGSVAWRLDCYPY
                     ELPFEDVWGRFLDEVDTTGVRALLIGPWWDGDYTSLSPVVDAIVADAHRFPALRALFL
                     GDVESEECELSWLQLCDITPVLEALPLLEEFGVRGCGDGAPGEGSLQLRPVRHQALRT
                     LRFESGGLPGHVVRAVGASGLPALEHLELWFGSEWYGGDTTVADLAPVLSGAALPRLR
                     HLGLQNSEIQDEIAAAVASAPVVARLESLSLSMGTLGDSGAQALLDGQPLTHLSVLDL
                     HHHFLSDPFVARIEELGARSGVQVRLDQGDRWDDEDDKARYVAVSE"
     gene            736403..737584
                     /locus_tag="SFLA_RS03090"
                     /old_locus_tag="Sfla_0632"
                     /db_xref="GeneID:11371718"
     CDS             736403..737584
                     /locus_tag="SFLA_RS03090"
                     /old_locus_tag="Sfla_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152769.1"
                     /db_xref="GI:503918775"
                     /db_xref="GeneID:11371718"
                     /translation="MSPSANSGRPRLAVVGIPANRRVGLFQDAVRAAGLPAARTVSWP
                     EVLRGEAFFLPGETVRVDSPGEDPEVDMLLRGGDDPTRVEGSARWYARFTSAVRDVAR
                     TAAAAGAVLLDGPQDIAVMFDKRLCHGVLDTAGVPVPDSPTSGPDGDPVRGWADVRRL
                     MSEHRMPRVFVKPAHGSSASGVMALETAGPGRIRAATSVERDEEGRLFNSLRVRRCTT
                     EREVAALVDALAPDGLHIERWLPKASQRGRAADLRVVVVAGRATHAVVRTSRSPMTNL
                     HLGGTRGDLDGVRAAVEAAGGSWSAALAVCERAAACFPDTLCVGVDLLPATGWRRFAV
                     GEVNAFGDLLPRLTGLPGSGAEGLDTYGTQVAAVLAASAHPVLPGGAGGAAGRTGGEG
                     R"
     gene            737711..738580
                     /locus_tag="SFLA_RS03095"
                     /old_locus_tag="Sfla_0633"
                     /db_xref="GeneID:11371719"
     CDS             737711..738580
                     /locus_tag="SFLA_RS03095"
                     /old_locus_tag="Sfla_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152770.1"
                     /db_xref="GI:503918776"
                     /db_xref="GeneID:11371719"
                     /translation="MPSTDPDSAIRGTQHPNPDMNAIVGSHDLLLVTLDTLRFDVAEE
                     LAAAGRIPHLARHLPGGAWEKRHAPGSFTYASHQAIFAGFLPTPAAPGPHPRLFAARF
                     AGSESTADGTFVHESPDLLSGLAEVGYRTVCIGGVGFFNRRPPLGSVLPAMFQESHWE
                     PEFGVASPTSFEAQVSRAEQVVAELPAAQRLFLFVNVSALHQPNWFHTPGATAGAGDS
                     RATHAAALEYVDRHIGRLFAAASSRRRCFAIVCSDHGTAYGDDGYTGHRIGHEAVWTV
                     PYAHFFLEQGASR"
     gene            738577..740004
                     /locus_tag="SFLA_RS03100"
                     /old_locus_tag="Sfla_0634"
                     /db_xref="GeneID:11371720"
     CDS             738577..740004
                     /locus_tag="SFLA_RS03100"
                     /old_locus_tag="Sfla_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152771.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_014152771.1"
                     /db_xref="GI:503918777"
                     /db_xref="GeneID:11371720"
                     /translation="MTGTTLGTSPYRSYVYAYPHKTAYRPLAGRPGGRPLLSDLWATE
                     RKDALSLYLHIPFCEVRCGFCNLFTRIGAPDELTTRYLDALDRQATAVRDALGDDAPV
                     RFTSAAFGGGTPTFLTAGELERLCDIAEKRMGADLSAVPLSVETSPSTATADRLAVLA
                     DRGTTRVSIGVQSFVDAEARAAVRPQHRSEVEAALGRIREAGIPVLNIDLIYGIEGQT
                     EDTWRTSLDAALAWSPEELYLYPLYVRPLTGLGRLGAAAQEAGGPDAAWDDQRLRLYR
                     AGRDHLLAHGYEQVSMRMFRRADAPPAGPDDYACQTDGMIGLGCGARSYTSSLHYSFD
                     YAVEMREIRGIIDGFTTTTDFSRAEVGRYVDGEEARRRHLLQSLLQAEGMRSAEYRER
                     FGSDPYEDFPAELERFAARGWLADPADGGSPSARSASGRSPAGGPAASGLLRLAPEGL
                     AHSDALGPELFSPAVRAAMAAYEAK"
     gene            740013..740996
                     /locus_tag="SFLA_RS03105"
                     /old_locus_tag="Sfla_0635"
                     /db_xref="GeneID:11371721"
     CDS             740013..740996
                     /locus_tag="SFLA_RS03105"
                     /old_locus_tag="Sfla_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014152772.1"
                     /db_xref="GI:503918778"
                     /db_xref="GeneID:11371721"
                     /translation="MNTELTILYRGPLASCDYDCPYCPFAKRRDTGEQLRGDRAALER
                     FTAWAAAQTGDRLSVLFTPWGEGLVRSWYRRALVEMSLLPHVGRVAIQTNLSGRTGWL
                     AEADRDKVALWCTYHPGQTPYERFLARCRELTALGVRHSVGIVGLDEHLEEARRLRSA
                     LPPEVYLWVNAAEGHTYTDEQADRWTALDPLFPYSRHPHRSAGLPCRTGESVVSVDGD
                     GAVRRCHFVRAELGNLYDGSYRDALGPRGCPLDVCDCHIGYVHLETLPLYDVFAGGVL
                     ERIPADPVRMPSGPAPAPACTPPPAGPARASAPDGPVSPGPSRRPLPFVSR"
     gene            complement(741054..741881)
                     /locus_tag="SFLA_RS03110"
                     /old_locus_tag="Sfla_0636"
                     /db_xref="GeneID:11371722"
     CDS             complement(741054..741881)
                     /locus_tag="SFLA_RS03110"
                     /old_locus_tag="Sfla_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SGNH hydrolase"
                     /protein_id="WP_014152773.1"
                     /db_xref="GI:503918779"
                     /db_xref="GeneID:11371722"
                     /translation="MADDSRNNIRGIIGSYAAIGDSFTEGVGDPGPGGTLVGWADRFA
                     VILADQLPVPDAMVGPVDDPHGYFRYANLAVRGRLLDQIVEEQVPRAKELAPDLVSFC
                     AGGNDILRPGSDPDDVAERFERAVADLTRSVGTVMVTTGFDTRGIPVLKHLRGKIAMY
                     TAHVRSIADRYDCPVLDLWSLRSVQDRRAWDNDRLHLSAEGHTRVALRAAQVLGLDVP
                     ADPDQVWPPQAQRGALEVRRDDIQWAREYLVPWIGRRLRGESSGDHVAAKRPDLLPL"
     gene            complement(742045..742947)
                     /locus_tag="SFLA_RS03115"
                     /old_locus_tag="Sfla_0637"
                     /db_xref="GeneID:11371723"
     CDS             complement(742045..742947)
                     /locus_tag="SFLA_RS03115"
                     /old_locus_tag="Sfla_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_014152774.1"
                     /db_xref="GI:503918780"
                     /db_xref="GeneID:11371723"
                     /translation="MPAKGKHRRTKTGPISRGVLAAGTGGAVLALPLIGATGAHAAEQ
                     AAPAKPVAAQSAPAAAAKGSPKTYSVVSGDYLAKIAADHKVKGGWQKLYKDNRDVVGG
                     NPSLILPGMKLTLGAKASGPAEAAPSKAAPSTAKKSAPAEKAAAPAQEAAAKTTGSGA
                     SESTSSGWTAPVENANVTTQYRASGASWSSGYHTGSDFQAASGTSVRSIGEGTVVSAG
                     WSGSYGNEVVIQHSDGMYSQYAHLSSLEVTTGQTVTGGQQIGLSGSTGNSTGPHLHFE
                     VRTGPSYGSDVDPIAYLRSHGVSI"
     gene            743524..744348
                     /locus_tag="SFLA_RS03120"
                     /old_locus_tag="Sfla_0638"
                     /db_xref="GeneID:11371724"
     CDS             743524..744348
                     /locus_tag="SFLA_RS03120"
                     /old_locus_tag="Sfla_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein tyrosine/serine phosphatase"
                     /protein_id="WP_014152775.1"
                     /db_xref="GI:503918781"
                     /db_xref="GeneID:11371724"
                     /translation="MTQLPEVPPAGHGPKDVDLTGVRNFRDVGGLPTVDGRTVRYGRL
                     YRSGHLAHATATDAAFLAGLGLHTIFDFRNAADHKLDGLDVELPGVRNVSIPLSDPAD
                     GAEFWRLVRDGNIQQLRSILADGKGTERMVASYRSIIKDRTAEHSRVLHALAEDSVPA
                     LMHCAAGKDRAGLSIAVSLLAVGVEKEAIEADYLKSNDAHRRYRIRRSDTSSAGMSDE
                     VLELLDPLFGAEAEYLAAAFSTIEEIWGSTDRYLTEGLKIAPETRARLRERLVEDA"
     gene            complement(744635..745249)
                     /locus_tag="SFLA_RS03125"
                     /old_locus_tag="Sfla_0640"
                     /db_xref="GeneID:11371726"
     CDS             complement(744635..745249)
                     /locus_tag="SFLA_RS03125"
                     /old_locus_tag="Sfla_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014152777.1"
                     /db_xref="GI:503918783"
                     /db_xref="GeneID:11371726"
                     /translation="MNPPDGGSTDELPGIAPRLRDLRRNRGLTLEAAAGRAGLSPAHL
                     SRLETGRRQPSLPMLLGLARVYGTTVSELLGEMPPERDAIVRGGPLEGAGGEGGGWLY
                     RQAGGSGRAMQALRVRVPYGTEGDLVRVHPGEEWLYVLDGRLRVVLGETVHDLDPGDS
                     AHFDSLTPHRIAALDIGGARLLFVHTLLQSPTAELCLGGGAHRL"
     gene            complement(745310..746704)
                     /locus_tag="SFLA_RS03130"
                     /old_locus_tag="Sfla_0641"
                     /db_xref="GeneID:11371727"
     CDS             complement(745310..746704)
                     /locus_tag="SFLA_RS03130"
                     /old_locus_tag="Sfla_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_014152778.1"
                     /db_xref="GI:503918784"
                     /db_xref="GeneID:11371727"
                     /translation="MKDRSQGFDLARLIEERGAERYELHTRHLNHQLPRMLHTLGFDK
                     VYERAEGAYFWDADGNDYLDMLAGFGVMGLGRHHPVVRRALHDVLDASLADLTRFDCQ
                     PLPGLLAEKLLAHSPHLDRVFFGNSGTEAVETALKFARYATGKPRILYCDHAFHGLTA
                     GSLSVNGERGFRDGFAPLLPDTAIALGDLDALRRELKRGDVAGLVVEPIQGKGVHASP
                     PGFLREAQDLLHRHKAVLVVDEVQTGLGRTGDFYAYQHEEGVEPDLLCVAKALSGGYV
                     PVGATIGKDWIFKRVYSSMDRVLVHSASFGSNAQAMAAGLAVLAVMEDEETVANARRT
                     GDLLRERLAALVGRYELLHEVRGRGLMIGIEFGRPSSLKLRSRWAMLQAARKGLFAQM
                     VVVPLLQKHRILTQVSGDHLEVIKLIPPLVIGEPEVDRFVTAFTAVMDDAHSGGGLVW
                     DFGRTLVKQAVANR"
     gene            complement(746909..747928)
                     /locus_tag="SFLA_RS03135"
                     /old_locus_tag="Sfla_0642"
                     /db_xref="GeneID:11371728"
     CDS             complement(746909..747928)
                     /locus_tag="SFLA_RS03135"
                     /old_locus_tag="Sfla_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014152779.1"
                     /db_xref="GI:503918785"
                     /db_xref="GeneID:11371728"
                     /translation="MAMPLRQSIKVATYLFEQKLRKREKFPLIVELEPLFACNLACEG
                     CGKIQHPAGVLKQRMPVAQAVGAVLESGAPMVSIAGGEPLMHPQIDEIVRQLVARKKY
                     VFLCTNAMLMRKKLEKFTPSPYFAFAVHIDGLRERHDESVAKEGVFDEAVEAMKEAKR
                     RGFRVTTNSTFFNTDTPQTVIEVLNYLNDELKVDEMMISPAYAYEKAPDQEHFLGVEQ
                     TRELFKKSFAGGNRGRWRLNHSPLFLDFLEGKADFPCTAWAIPNYSLFGWQRPCYLMS
                     DGYVPTYRELIEDTDWDKYGRGKDPRCANCMAHCGYEPTAVLATMGSLKESLRAARET
                     VGGGR"
     gene            complement(747935..748594)
                     /locus_tag="SFLA_RS03140"
                     /old_locus_tag="Sfla_0643"
                     /db_xref="GeneID:11371729"
     CDS             complement(747935..748594)
                     /locus_tag="SFLA_RS03140"
                     /old_locus_tag="Sfla_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152780.1"
                     /db_xref="GI:503918786"
                     /db_xref="GeneID:11371729"
                     /translation="MGGAEVPPGPTTPLLIACALGIERFALRTGRRGGEPGPGPVSII
                     RSGMGPRAAESAVRQALGRPGAGGTAVIASGFCAGLEPGMHPGDLVVAEETRDAGGTT
                     ACTGTGLLVDALVRAVPGRTVHTGPLTGSGHVVRGAERAGLRAAGAVAVDMESAATLR
                     TAVRTGPRPVAAVRVVVDAPEHELVRIGTVRGGISAFRVLRAVLPAFHEWHRSLLLPR
                     R"
     gene            complement(748599..750611)
                     /locus_tag="SFLA_RS03145"
                     /old_locus_tag="Sfla_0644"
                     /db_xref="GeneID:11371730"
     CDS             complement(748599..750611)
                     /locus_tag="SFLA_RS03145"
                     /old_locus_tag="Sfla_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="squalene-hopene cyclase"
                     /protein_id="WP_014152781.1"
                     /db_xref="GI:503918787"
                     /db_xref="GeneID:11371730"
                     /translation="MTATTDGSTGAANLRAAAASDPTESTSAAPDMMAVARHAAERSV
                     EHLLGRQDEQGWWKGDLATNVTMDAEDLLLRQFLGIQDPETVKAAARFIRGEQLGDGT
                     WNTFYEGPPDLSATVEAYVALRLAGDRPDDPHMIRAAGWVREQGGIAESRVFTRIWLA
                     LFGWWKWDDLPELPPELMFFPKWVPLNIYDFGCWARQTIVPLTIVSAKRPVRPAPFAL
                     DELHTDPACPNPSRPTAPAASWDGVFQRLDKALHLYHKVAPRRLRRIAMNEAARWIIE
                     RQENDGCWGGIQPPAVYSVIALHLLGYDLDHPVMRAGLESLDRFAVWREDGARMIEAC
                     QSPVWDTCLATIALADAGVSPDHPALVRAADWMLGEEIVRPGDWAVRKPGLAPGGWAF
                     EFHNVNYPDIDDTAEVALALRRVRHPDPARVDAAIERGVRWNLGMQSRNGAWGAFDAD
                     NTSPFPNRLPFCDFGEVIDPPSADVTGHVVEMLAVEGRAHDPRTRRGVEWLLAEQEAS
                     GAWFGRWGVNYIYGTGSVVPALIAAGLPAAHPSVRRAVDWLRSVQNDDGGWGEDLRSY
                     REEKWIGHGSSTASQTGWALLALLAAGERETRSVERGVAWLAATQQADGSWDEPHFTG
                     TGFPWDFSINYHLYRQVFPLTALGRYVYGDPFATATAIGAGTGKGA"
     gene            complement(750716..751786)
                     /locus_tag="SFLA_RS03150"
                     /old_locus_tag="Sfla_0645"
                     /db_xref="GeneID:11371731"
     CDS             complement(750716..751786)
                     /locus_tag="SFLA_RS03150"
                     /old_locus_tag="Sfla_0645"
                     /EC_number="2.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019993176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylallyltransferase/Geranyltranstransferase
                     "
                     /protein_id="WP_015579670.1"
                     /db_xref="GI:505392568"
                     /db_xref="GeneID:11371731"
                     /translation="MTPANPAYDTVADPTDVTALLERGRALSAPVLRAAVDRLAPPMD
                     TVAAYHFGWIDAQGRPAEGDGGKAVRPALALLSAEAAGAPAEAGIPGAVAVELVHNFS
                     LLHDDLMDGDEQRRHRDTVWKVHGPAQAILVGDALFALANEVLLELGTVEAGRAARRL
                     TTASRKLIDGQAQDISYEHRERVTVEECLEMEGNKTGALLACAVSIGAVLGGADDRTA
                     DTLEAYGYHLGLAFQAVDDLLGIWGDPESTGKQTWSDLRQRKKSLPVVAALAAGGPAS
                     ERLGELLADDAKSSDFDSFSEEEFAARAALIEEAGGREWTAQEARRQHAVAIEALHGV
                     DMPERVRAQLTELADFVVVRKR"
     gene            complement(751816..753204)
                     /locus_tag="SFLA_RS03155"
                     /old_locus_tag="Sfla_0646"
                     /db_xref="GeneID:11371732"
     CDS             complement(751816..753204)
                     /locus_tag="SFLA_RS03155"
                     /old_locus_tag="Sfla_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase"
                     /protein_id="WP_014152783.1"
                     /db_xref="GI:503918789"
                     /db_xref="GeneID:11371732"
                     /translation="MSGRSSANSRAVVVGGGLAGVTAALRLADAGLDVKLLEGRPRLG
                     GLAFSFRRGDLSVDNGQHVYLRCCTAYRWFLDRIEGAHLAPLQDRLDVPVLDVGRAAG
                     PRLGRLRRTALPVPLHLAGGLAAYPHISLAEKAGVARAALALGRLDPADPALDGIDFA
                     TWLRRQGQSQRTIEALWDLVGVATLNATAPNASAALAAKVFRTGLLSEPGAADIGWAA
                     VPLGDLHDTLARKALESAGVEIHLRSRVDSLTRTEDGRWSVGTDGERFAADTVVLAVP
                     QGDTHRLLPDGALDDPGRLLELTDAPILNVHVVYDRKVLRRPFFAALGSPVQWVFDRT
                     ASSGLQGHGQYLAVSQSAAQDEIDLPVAELRRRYVPELERLLPAARGAGIRDFFVTRE
                     RTATFAPTPGVGRLRPGTHTRAPGLHLAGAWTATGWPATMEGAVRSGFTAVDAALEGL
                     GRPHEHPLQEAA"
     gene            complement(753317..754261)
                     /locus_tag="SFLA_RS03160"
                     /old_locus_tag="Sfla_0647"
                     /db_xref="GeneID:11371733"
     CDS             complement(753317..754261)
                     /locus_tag="SFLA_RS03160"
                     /old_locus_tag="Sfla_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene synthase"
                     /protein_id="WP_014152784.1"
                     /db_xref="GI:503918790"
                     /db_xref="GeneID:11371733"
                     /translation="MEGQTTYMSAPVQAAYSYCEAVTGQQARNFAYGIRLLPYEKRQA
                     MSALYAFSRRVDDIGDGELDPETKHVRLEETRGLLGRIRDGAVDEDDTDPVAVALADA
                     TRRFPLPLGGLDELIDGVLMDVRGATYETWDDLKTYCRCVAGAIGRLSLGVFGTQPGA
                     PGAERAAEYADTLGLALQLTNILRDVREDAGNGRTYLPADDLAKFGCSAGFHRATPPP
                     GSDFAGLVHFEVRRARALFAEGYRLLPMLDRRSGACVAAMAGIYRRLLDRIERDPEAV
                     LRGRVSLPGHEKAYVAVRGLSGLDARYISRRTARGRVS"
     gene            complement(754270..755184)
                     /locus_tag="SFLA_RS03165"
                     /old_locus_tag="Sfla_0648"
                     /db_xref="GeneID:11371734"
     CDS             complement(754270..755184)
                     /locus_tag="SFLA_RS03165"
                     /old_locus_tag="Sfla_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="squalene synthase"
                     /protein_id="WP_014152785.1"
                     /db_xref="GI:503918791"
                     /db_xref="GeneID:11371734"
                     /translation="MTRPQQACADAAATLDKAADENFPVAPFFLPRAWRDDLMAVYGF
                     ARLVDDIGDGDLAPGGADARHLGLEPGQDEDRLAALDALEADLHRVFSPTGDGPRHPL
                     MRALRPTVRRCALTPEPFLGLLEANRQDQKVRRYETYGDLLAYCELSANPVGRLVLQI
                     TGTASPERIRRSDAVCTALQIAEHLQDVAEDLGRDRIYLPAEDMARFRVGERELAAPS
                     AGSAVRSLVAFEAERARALLDEGVPLVGSVHGRLKLLLAGFVGGGRAALGAISAAGFD
                     VLPGPPKPTAPRLLREVGDVLRRAHREG"
     gene            complement(755602..756387)
                     /locus_tag="SFLA_RS03170"
                     /old_locus_tag="Sfla_0649"
                     /db_xref="GeneID:11371735"
     CDS             complement(755602..756387)
                     /locus_tag="SFLA_RS03170"
                     /old_locus_tag="Sfla_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003964853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="teichoic acid ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_014152786.1"
                     /db_xref="GI:503918792"
                     /db_xref="GeneID:11371735"
                     /translation="MAEETSQGHIPTVIADDVHIVYRVNGTGGGKGSATAALSRIMRR
                     GKGEPRGVRKVHAVRGVSFTAYRGQAIGLIGTNGSGKSTLLRAIAGLLPTEQGKVYTD
                     GQPSLLGVNAALMSDLTGERNVVLGGLAMGMSREEIRVRYQDIVDFSGINEKGDFITL
                     PMRTYSSGMAARLRFSIAAAKNHDVLMIDEALATGDRKFRVRSEERIRELRKEAGTVF
                     LVSHNNKTIRDTCDRVLWLEKGELLMDGPTEEVLKAYERETGK"
     gene            complement(756380..757309)
                     /locus_tag="SFLA_RS03175"
                     /old_locus_tag="Sfla_0650"
                     /db_xref="GeneID:11371736"
     CDS             complement(756380..757309)
                     /locus_tag="SFLA_RS03175"
                     /old_locus_tag="Sfla_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010058024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014152787.1"
                     /db_xref="GI:503918793"
                     /db_xref="GeneID:11371736"
                     /translation="MSDTTHDGGVALSSPPSADEGLSASRLAEKYGLTVSGARPGLFA
                     YVRQLWGRRHFILAFSRAKLTAQYSQAKLGQLWQVATPLLNAMVYFLIFGLILGTNRG
                     MSQEVFIPFLVTGVFVFTFTQSSVMAGVRSISGNIGLVRALHFPRASLPVSFSLQQLQ
                     QLLYSMIVLFAVAVGFGSYPSLSWLLILPALALQFLFNTGLALVMARLGSKTPDLAQL
                     MPFIMRTWMYGSGVMFSIPVMLEGKPAWIADVLQYNPAAIYMDLVRFALIDGYGSENL
                     PQHVWAVGLAWALVVGVVGFVYFWKAEERYGRG"
     gene            complement(757417..758301)
                     /locus_tag="SFLA_RS03180"
                     /old_locus_tag="Sfla_0651"
                     /db_xref="GeneID:11371737"
     CDS             complement(757417..758301)
                     /locus_tag="SFLA_RS03180"
                     /old_locus_tag="Sfla_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014049652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_033249359.1"
                     /db_xref="GI:702730656"
                     /db_xref="GeneID:11371737"
                     /translation="MSSPMKLGAVIITMGNRPDELRALLDSVAGQDGDRIEVVVVGNG
                     APVPDVPAGVRTVELPENLGIPGGRNVGIEAFGPSGADVDALLFLDDDGHLPNTDTAE
                     LCRQAFEADPRLGIVTFRIADPDTGVTQRRHVPRLRASDPMRSSRVTTFLGGANAVRS
                     QVIAEAGPLPGEFFYAHEETDLAWRALDAGWQIEYRADMVLNHPTTAPSRHAVYHRMV
                     ARNRVWLARRNLPAPLVPVYVGVWLLLTLVRRPSLPALKAWFGGFREGWTTPCGPRRP
                     MRWRTVWRLTRLGRPPVI"
     gene            complement(758298..759026)
                     /locus_tag="SFLA_RS03185"
                     /old_locus_tag="Sfla_0652"
                     /db_xref="GeneID:11371738"
     CDS             complement(758298..759026)
                     /locus_tag="SFLA_RS03185"
                     /old_locus_tag="Sfla_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014049651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transferase"
                     /protein_id="WP_030125363.1"
                     /db_xref="GI:662754295"
                     /db_xref="GeneID:11371738"
                     /translation="MKDRRSGEHWAGRLYMREVSLRITRRLVTTKVTPNQLTYVMTVA
                     GVLAAPALLVPGIPGALLGVVAVQLYLLFDCVDGEVARWKKQYSLGGVYLDRVAAYLC
                     DAAVLVGFGLRAADLWGPGRIDWLWAFLGTLAALGAILIKAETDLVGVARHQGGLPPV
                     KEAASEPRSSGMALARRAAGALKFHRLILGIEASFVILLVAVLDTVRDDFFFSRLAVA
                     VMAGIALLQTVLHLVSILASSRLK"
     gene            complement(759055..760116)
                     /locus_tag="SFLA_RS03190"
                     /old_locus_tag="Sfla_0653"
                     /db_xref="GeneID:11371739"
     CDS             complement(759055..760116)
                     /locus_tag="SFLA_RS03190"
                     /old_locus_tag="Sfla_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014049650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014152790.1"
                     /db_xref="GI:503918796"
                     /db_xref="GeneID:11371739"
                     /translation="MPVLTRLIPSPVVVDIRRGAMDDLAGLLADQRISASGKLAIAIS
                     GGSGRALRERLAPVLPGADWYPVTDGTIDSAVRLADEIKGNRYDAVVGLGGGKIIDVA
                     KYAAARVGMPMVAVATNLSHDGLCSPVATLDNDNGRGSYGVPTPIAVVIDLDVIREAP
                     ARYVRSGVGDAVSNISCVADWELAHEIRREDIDGLAAAMARQAGEAVLRHPGGVGDDA
                     FLKVLAEGLVLTGISMSIAGDSRPASGACHEINHAFDLLYPKRAASHGEQVGLGACFA
                     MHLRGAHEESAQMAAVLRRHGLPVLPDEIGFTADEFVRAVDYAPQTRPGRFTILEHLN
                     LSTDQIRDAYADYAKAIHS"
     gene            complement(760104..760841)
                     /locus_tag="SFLA_RS03195"
                     /old_locus_tag="Sfla_0654"
                     /db_xref="GeneID:11371740"
     CDS             complement(760104..760841)
                     /locus_tag="SFLA_RS03195"
                     /old_locus_tag="Sfla_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018552444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_014152791.1"
                     /db_xref="GI:503918797"
                     /db_xref="GeneID:11371740"
                     /translation="MIGLVLAAGAGRRLRPYTDTLPKALVPVDGEKTVLDLTLANFAA
                     VGLTEVAVVVGYRKEAVYARRAEFEATYGVTLTLIDNDKAEEWNNAYSLWCAREVLKK
                     GVILANGDTVHPVSVEKTLLDARGEGRKIILALDTVKNLADEEMKVITEDGKGVRRIT
                     KLMDPATATGEYIGVTLIEPEAAEELADALRTTFERDPDLYYEDGYQELVNRGFTVDV
                     APIGEVTWVEIDNHDDLARGREIACRY"
     gene            complement(760838..762598)
                     /locus_tag="SFLA_RS03200"
                     /old_locus_tag="Sfla_0655"
                     /db_xref="GeneID:11371741"
     CDS             complement(760838..762598)
                     /locus_tag="SFLA_RS03200"
                     /old_locus_tag="Sfla_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transferase"
                     /protein_id="WP_014152792.1"
                     /db_xref="GI:503918798"
                     /db_xref="GeneID:11371741"
                     /translation="MTAAADAGEAAELLAAVPAGRRVALVDPRFIGHVHALRLGLTDP
                     RFAAASIPGALTAQPEARPALLRALRRAVTAGGAGAPVASSGTDAVAVAEDRTVPGRL
                     ADALDAEGTAVQRPELGSLTASVPDRPEERNTARAAVAAVDDEAVRLRSAVKAHDGFF
                     TTYFISPYSRYIARWCARRGLTPNQVTTASLVTALIAAGSAATGTRAGYVAAGVLLLL
                     SFVLDCTDGQLARYSLQYSTMGAWLDATFDRAKEYAYYAGLAIGAARTGDDVWVLALG
                     AMVLQACRHVVDFSFNEANHDAVSNTSPTAALSDKLDSVGWTVWLRRMIVLPIGERWA
                     MIAVLTAVTTPRIVFYALLVGCALAACYTTAGRLLRSLTRKAQRTDRAARALADLADS
                     GPLAQAVAAAVRRPGGGFTAPLLAFVGALVMVGAAVFTPYGGWSAVGAAAVYAVLSGL
                     AVSRPLKGALDWLVPPVFRAAEYCTILVLAARSDVPHAVPAAFGLVSAVAYHHYDTVY
                     RIRGGTGAPPGWLVRVIGGHEGRTLVVAVLAALLTHGSGFTTALTALAAAVALVVLVE
                     SIRFWVSSSAPAVHDEGELA"
     gene            762904..763890
                     /locus_tag="SFLA_RS03205"
                     /old_locus_tag="Sfla_0656"
                     /db_xref="GeneID:11371742"
     CDS             762904..763890
                     /locus_tag="SFLA_RS03205"
                     /old_locus_tag="Sfla_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_014152793.1"
                     /db_xref="GI:503918799"
                     /db_xref="GeneID:11371742"
                     /translation="MTWLITGGAGYIGAHVAKAMTGAGERVVVLDDMTTGIAGRLPAE
                     VTLVRGSASDRAVLDRVLAEHAVTGVVHLAAKKQVGESVEKPLLYYRENVTGLAVLLE
                     AVVAAGVKRFLFSSSAAVYGVPDVDLITEETPCAPINPYGETKLAGEWLVRAAGRAHG
                     ISTACLRYFNVAGAAEPELADTGVFNVVPMFFDRLTRGEAPRIFGDGYPTPDGTCVRD
                     YIHVADLAEAHLAVARHLDGTPEGGDLTVNIGRGEGVSVRRLAELVGEVTGLRTEPVV
                     DPPRPGDAARAVASADRMAEQLGWTARRDMREMVESAWEGWCLRHPEARAAK"
     gene            764074..765015
                     /locus_tag="SFLA_RS03210"
                     /old_locus_tag="Sfla_0657"
                     /db_xref="GeneID:11371743"
     CDS             764074..765015
                     /locus_tag="SFLA_RS03210"
                     /old_locus_tag="Sfla_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006128923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_014152794.1"
                     /db_xref="GI:503918800"
                     /db_xref="GeneID:11371743"
                     /translation="MGAGHDHGHTHGGPPPTGTAAAAYRGRLRVALGITLGVMVMEIV
                     GGVLADSLALIADAAHMATDALGLGMALLAIHFANKAAGPNRTFGYARAEILAALANC
                     LLLLGVGGYLVFEAVDRFITPAETRGGLAVAFAAVGLVANVVSLSLLVRGQQDSLNVR
                     GAYLEVVADTLGSVTVLVSAGIIMATGWQAADPIASLLIGLMIVPRTLKLLRETLDVL
                     LESAPKGVDMDEVRAHITALPGVLDVHDLHAWTITSGMPVLSAHVVVHQEMLDSIGHE
                     KLLHDLQGCLGHHFDVEHCTFQLEPSGHAEHEARLCH"
     gene            765245..765838
                     /locus_tag="SFLA_RS03215"
                     /old_locus_tag="Sfla_0658"
                     /db_xref="GeneID:11371744"
     CDS             765245..765838
                     /locus_tag="SFLA_RS03215"
                     /old_locus_tag="Sfla_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018552448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="WP_014152795.1"
                     /db_xref="GI:503918801"
                     /db_xref="GeneID:11371744"
                     /translation="MPTTPATAAHSSSNGTADAIMLELVDENGTTIGTAEKLAAHQAP
                     GQLHRAFSVFLFDEQGRLLLQRRALGKYHSPGVWSNTCCGHPYPGEAPFAAAARRTYE
                     ELGVSPSLLAAAGTVRYNHPDPASGLVEQEFNHLFVGMVQERLRPDEDEVGETAFVTS
                     GELAERHAAAPFSAWFMTVLDAARPAIRELTGPSAGW"
     gene            complement(765863..766285)
                     /locus_tag="SFLA_RS03220"
                     /old_locus_tag="Sfla_0659"
                     /db_xref="GeneID:11371745"
     CDS             complement(765863..766285)
                     /locus_tag="SFLA_RS03220"
                     /old_locus_tag="Sfla_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019993172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033249361.1"
                     /db_xref="GI:702730665"
                     /db_xref="GeneID:11371745"
                     /translation="MPYEGVWRFDAPAVDVSVPQARHAVRDLIERQGVPVEDDILQGL
                     LLIVSELVTNAVRHAALLSPELAVEVAVGAEWIRVAVEDNHPYRPTALVTDHAQTGGR
                     GLLLVREITAEAGGTCDVEHTAGGGKIIWAALPLKTQL"
     gene            complement(766466..767053)
                     /locus_tag="SFLA_RS03225"
                     /old_locus_tag="Sfla_0660"
                     /db_xref="GeneID:11371746"
     CDS             complement(766466..767053)
                     /locus_tag="SFLA_RS03225"
                     /old_locus_tag="Sfla_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152797.1"
                     /db_xref="GI:503918803"
                     /db_xref="GeneID:11371746"
                     /translation="MAGPTTEGKRLHRSFGGLALLGVLLVVAGLVGLVYTGVATLTSM
                     ILFGWLLLVGGLVGLVHAVQARGTAYFWLGVVVAALNIAAGIVVIKNPVGTAEALTMF
                     AALLFLTGGVFRLVGSVVVRGPQFGWTLLQGAFGLLLGVLVLVDWPHSSLYVLGCFFS
                     LALLFDGLGLVAIGVGGRRVVSMVTDQMKPEEGAK"
     gene            767134..767934
                     /locus_tag="SFLA_RS03230"
                     /old_locus_tag="Sfla_0661"
                     /db_xref="GeneID:11371747"
     CDS             767134..767934
                     /locus_tag="SFLA_RS03230"
                     /old_locus_tag="Sfla_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_014152798.1"
                     /db_xref="GI:503918804"
                     /db_xref="GeneID:11371747"
                     /translation="MDLGERTAGTGPRLEHTVVDGVATVVISNPAKRNAMTADMWQAL
                     PVLLEGLAADPAVRVLVLTGAGDTFCAGADISSLRDPAGRPQTLAVRAEEALAAFPGP
                     TLAAVRGFCVGGGSQLATACDLRFAEEGASFGVTPAKLGIVYPSSSTRRLVALVGPAT
                     AKFLLFSGELIGTERALRTGLVDEVLPRGGLEERVHRFTEVLASRSQLTQAAAKEFAD
                     GREDRDAHWSLQARGSGDTAEGVAAFLERRAPRFTWTAGSAGDTSTSG"
     gene            complement(767921..768556)
                     /locus_tag="SFLA_RS03235"
                     /old_locus_tag="Sfla_0662"
                     /db_xref="GeneID:11371748"
     CDS             complement(767921..768556)
                     /locus_tag="SFLA_RS03235"
                     /old_locus_tag="Sfla_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_014152799.1"
                     /db_xref="GI:503918805"
                     /db_xref="GeneID:11371748"
                     /translation="MQIAIVLFDRFTALDAVGPYEMLSRVPGAETVFVAERPGAVRND
                     SGSLALVADRALADVPAPDVVVVPGGPGQSAQMENGELLGRLRAADAASTWTTSVCTG
                     SLLLAAAGLLTGRRATSHWLALDTLRTLGAEPTGERVVTDGKYVTAAGVSAGIDMGLT
                     LLGRIAGDEHARAVQLLTEYDPRPPYDCGSPEKAPAAMVETWRARSRFILT"
     gene            complement(768575..769531)
                     /locus_tag="SFLA_RS03240"
                     /old_locus_tag="Sfla_0663"
                     /db_xref="GeneID:11371749"
     CDS             complement(768575..769531)
                     /locus_tag="SFLA_RS03240"
                     /old_locus_tag="Sfla_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014152800.1"
                     /db_xref="GI:503918806"
                     /db_xref="GeneID:11371749"
                     /translation="MKQRSVLVVLFEGVQSLDVSGPAEVFAGASRFPGVSYELRTASL
                     DGAPVRCSSGLTLVPDGTLADTPAPDLLLVPGGAGTRTPDPELVDWLRAHGPRARQLV
                     SVCTGALLLAAAGQLDGHRVTTHWSVCETLARTYPAVRVDPDPIFVRDGRLATSAGVT
                     AGIDLALALVEEEHGRDVALTVARHLVVFLRRPGNQAQFSAQLSAQTAVRAPLRGVQH
                     WITEHPDADLSVEALAARAGLSPRHFARAFTAETGLTPGRYVERVRLEQARRLLEDTA
                     DGVVGISRASGYGTPEAMRRAFVKALGTAPAEYRRRFRSHPV"
     gene            769654..770517
                     /locus_tag="SFLA_RS03245"
                     /old_locus_tag="Sfla_0664"
                     /db_xref="GeneID:11371750"
     CDS             769654..770517
                     /locus_tag="SFLA_RS03245"
                     /old_locus_tag="Sfla_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152801.1"
                     /db_xref="GI:503918807"
                     /db_xref="GeneID:11371750"
                     /translation="MSTLPPRAGRRCHNALNPLHSCVYFSPDLGKEFAELGVDDASRV
                     YFAARGAALGAAGAGTVTATFYNFNHDLVARHLPSVWSEITPGAALDARLRTADSTLR
                     RVLGEETVASPEMAEAAGLALRAAEACTRHARPLYAAHADLPVPDEPHLAYWHAATLL
                     REHRGDGHLAALLSAGLDPLEALVSHTATGKGMAPRWILATRGWRRTDWDAAVERLRE
                     RGVLDAEGELTGTGTALRAELEEATDRMDAAPYEHLGADGVARLTELGRGFLFAAASA
                     GAFPEDLVGKG"
     gene            770876..773302
                     /locus_tag="SFLA_RS03250"
                     /old_locus_tag="Sfla_0665"
                     /db_xref="GeneID:11371751"
     CDS             770876..773302
                     /locus_tag="SFLA_RS03250"
                     /old_locus_tag="Sfla_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_014152802.1"
                     /db_xref="GI:503918808"
                     /db_xref="GeneID:11371751"
                     /translation="MTTSIEGRIAEELGVHERQVKAAVDLLDGGSTVPFIARYRKEAT
                     EMLDDAQLRTLEERLRYLRELEDRRAAVLDSVREQGKLDEALEAQIRAAETKARLEDI
                     YLPFKPKRRTKAQIAREAGLTPLADGLLADPSVDPLTAAAAFVDSEKGVADPAAALEG
                     ARAILTERFSEDADLTGELRERMWSRGRVVARVRDGKEEAGAKFADYFDFAEPFTALP
                     SHRILAMLRGEKEDVLDLVLEPEEPSKEPGPSSYENMVARRFGVADRGRPGDKWLGDT
                     VRWAWRTRILVHLGIDLRLRLRTAAEDEAVRVFASNLRDLLLAAPAGTRATLGLDPGF
                     RTGVKVAVVDATGKVVATDVIHPHVPANQWDRSLATLERLAKEHHVDLIAIGNGTASR
                     ETDKLAGELCEKHPELKLTKVMVSEAGASVYSASAFASQELPDMDVSLRGAVSIARRL
                     QDPLAELVKIDPKSIGVGQYQHDLSEVKLSRSLDAVVEDCVNGVGVDVNTASAPLLSR
                     VSGIGSGLAENIVAHRDTNGPFRSRRALKDVARLGPKAYEQCAGFLRIRGGDDPLDAS
                     SVHPEAYPVVRTMVKRTGGDVASLIGNTQTLRSLRPDDFVDEKFGLPTVTDILRELEK
                     PGRDPRPAFKTATFKEGVEKLGDLVPGMVLEGVVTNVAAFGAFVDVGVHQDGLVHVSA
                     MSRTFVKDPRDVVKPGDIVKVKVMDVDIPRKRVSLTLRLDDEATAGQGGGQGPKRERN
                     TQGGGERPPRQRQGQDNRQGGAGQRRDRREGGGTGAPRPAAAPANSAMADALRRAGLT
                     GGSDQGGRKR"
     gene            complement(773392..775032)
                     /locus_tag="SFLA_RS03255"
                     /old_locus_tag="Sfla_0666"
                     /db_xref="GeneID:11371752"
     CDS             complement(773392..775032)
                     /locus_tag="SFLA_RS03255"
                     /old_locus_tag="Sfla_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="WP_014152803.1"
                     /db_xref="GI:503918809"
                     /db_xref="GeneID:11371752"
                     /translation="MTATLVAKELAAGHGDRTLFAGLDLVIAPGDVIGLVGANGAGKS
                     SLLRLLAGLDRPEEGELRLSPPTATVGHLPQEPERREGESVREFLARRTGVADAQAAM
                     DTATQALVDGAPGADDAYSETLERWLALGGADLDERAEEVAADLGLTIGLDQPMTGLS
                     GGQAARAGLASLLLSRYDVFLLDEPTNDLDLDGLERLERFVSGLRAGTVVVSHDREFL
                     MRTVTKVLELDLAQQQINLYGGGYASYLEERERARSHAREEYEEYADKRSALEGRAQM
                     QRGWMDKGVKNARRKATDNDKIGRKFRSEASEKQAAKAKQTQRMIERLDVVEEPRKEW
                     ELRMEIASAPRSGSVVATLRDAAVVRGGFSFGPATLQIDWADRVAITGANGAGKSTLL
                     AALLGRLPLDAGHASLGSGVVVGEVDQARKLFHGTESLLDAFCAAVPDTEPAEVRTLL
                     AKFGLRAAHVLRPATTLSPGERTRAGLALLQGRGVNLLVLDEPTNHLDLPAIEQLESA
                     LEAYTGTLLLVTHDRRMLEAVRTTRRVEVADGKVTESG"
     gene            775139..776071
                     /locus_tag="SFLA_RS03260"
                     /old_locus_tag="Sfla_0667"
                     /db_xref="GeneID:11371753"
     CDS             775139..776071
                     /locus_tag="SFLA_RS03260"
                     /old_locus_tag="Sfla_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid oxidase"
                     /protein_id="WP_014152804.1"
                     /db_xref="GI:503918810"
                     /db_xref="GeneID:11371753"
                     /translation="MGAVADVIVVGGGVSGLTTALLLAERGLRVRVWSRDPAGATTSA
                     VAGALWWPYRIEPAELVGAWSLETLRVYEELAAAPAETGVRMVAGVHEGERLAALGPW
                     ARGLDRASEVPEGLRVTLPLIDMPAHLRWLEGRVAAAGGVVERRTVRAFTEAAAEARV
                     VVNCTGLGARELVPDLGVRPVRGQLVVVENPGIDEWFTHADPSSSATTYFFPQPGRLV
                     LGGTAEVDDPRTEPDLRTAREIVERCARVRPEIAGARVLGHRVGLRPSRDAGVRIEAE
                     DLPDGGLLVHNYGHGGAGVTVARGCARAAAQLVD"
     gene            complement(776085..777824)
                     /locus_tag="SFLA_RS03265"
                     /old_locus_tag="Sfla_0668"
                     /db_xref="GeneID:11371754"
     CDS             complement(776085..777824)
                     /locus_tag="SFLA_RS03265"
                     /old_locus_tag="Sfla_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BCCT transporter"
                     /protein_id="WP_014152805.1"
                     /db_xref="GI:503918811"
                     /db_xref="GeneID:11371754"
                     /translation="MSHDEQGSGGRGDYLPVTAELPAEPLHGRRPTTDRVVFGVTAVL
                     TVAFVIWGSTATDSLEDVSSSLLTGLIHNGGWAFMLAASGFVVFALWLAISRYGTISL
                     GQEGEEPEFRTVSWVAMMFSAGMGIGLMFYGVSEPLAHFVDPPPGTRPEDAAEAMQTA
                     MATTLFHWTLHPWAIYAVVGLAIAYSAYRRHRRQTISSVFVPLIGEKRAHGPLGRVID
                     ILAIFATLFGSAASLGLGALQIGSGFQELDWMEKTGTGLLVAIIAALTVAFVASAVSG
                     VEKGIQWLSNINMVLALILVVFVFIAGPTIIVLDLLPTSIAAYFGDLAQLAGRTEATG
                     KGEVADWLASWTVFYWAWWISWTPFVGMFIARISRGRTIRQFVGGVILVPSTVSLIWF
                     AVFGGSAIRLEESGQLKGIGDTPEAQLFGVLQQFPVATMMSILVMVLVGIFFVSGADA
                     ASIVMGTLSQKGVLEPSRWVVIFWGVVTGAVAAVMLLIGDGQGDALAGLQNLTILVAA
                     PFTIVMIGMCVALMRDLRHDPMIVRREFGVEAVESAVIEGHAKYDGDFEIRIGPGTAE
                     VTTDERHKHEPPA"
     gene            778065..779114
                     /locus_tag="SFLA_RS03270"
                     /old_locus_tag="Sfla_0669"
                     /db_xref="GeneID:11371755"
     CDS             778065..779114
                     /locus_tag="SFLA_RS03270"
                     /old_locus_tag="Sfla_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014152806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014152806.1"
                     /db_xref="GI:503918812"
                     /db_xref="GeneID:11371755"
                     /translation="MPDPTPDPHRDVRPTLEAVAARAGVSRATASRVVNGGAGVRQPL
                     VDQVRKAVEELGYIPNHAARTLVTRRNGAVAVIIDEPEFRVFSDPFFSRQIRGISREL
                     NAHDAQLVLLLVEGSGDFDRVTRYLAGGHVDGVLAFSLHTDDELPAIIRRFRVPTVYG
                     GRPQHAARGQDDPELPYVDCDNRGGAREAVRHLVSLGRRCVAHIAGPRDQVSALDRID
                     GYRDVLPDAAEELVVDGDFTTEGGARAMTELLDARPDVDAVFVSNDLMASGALRVLRE
                     RGVRVPEDVAVVGFDDMASVAEATEPPLTTVRQDVEGMGRLMVRLLMERLNSGTGAWP
                     DSVITPTELVRRASA"
     gene            complement(779152..780009)
                     /locus_tag="SFLA_RS03275"
                     /old_locus_tag="Sfla_0670"
                     /db_xref="GeneID:11371756"
     CDS             complement(779152..780009)
                     /locus_tag="SFLA_RS03275"
                     /old_locus_tag="Sfla_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015579657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014152807.1"
                     /db_xref="GI:503918813"
                     /db_xref="GeneID:11371756"
                     /translation="MASTGEPSPPPAGGVLWSLAGDVRGLLMLPAALTLQVAHPAVGA
                     GVDDHSVFRTDPWGRGERSLSSLLLWVYGGEEAAEEGRRLRRLHRTIQGTDTRGRRYH
                     ALTPENYAWVHATGFPVYRHASRYLVRPLTGAQERALYREWLQVGRILGIHDRDMPQT
                     IEEFWPYYRRMLAEEVEATVVVRELVAADDPVPPPDRGPLLLRLLLRALWPVLLPPLA
                     RFRRFLTVGLMPPDARQAIGLDWTPAQERRLRRFGAVVRRIVPVLPERLRYLPRARSA
                     RAAWRAGRG"
     gene            780278..781156
                     /locus_tag="SFLA_RS03280"
                     /old_locus_tag="Sfla_0671"
                     /db_xref="GeneID:11371757"
     CDS             780278..781156
                     /locus_tag="SFLA_RS03280"
                     /old_locus_tag="Sfla_0671"
                     /infere