GenomeNet

Database: RefSeq
Entry: NC_016114
LinkDB: NC_016114
Original site: NC_016114 
LOCUS       NC_016114            7337497 bp    DNA     linear   CON 14-MAY-2014
DEFINITION  Streptomyces pratensis ATCC 33331 chromosome, complete genome.
ACCESSION   NC_016114
VERSION     NC_016114.1  GI:357409266
DBLINK      BioProject: PRJNA40839
            BioSample: SRS152855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Streptomycineae; Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 7337497)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of chromosome of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7337497)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7337497)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002475.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7337497
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /collected_by="Waksman and Lechevalier"
     gene            17..760
                     /locus_tag="Sfla_0001"
                     /db_xref="GeneID:11367246"
     CDS             17..760
                     /locus_tag="Sfla_0001"
                     /inference="protein motif:PFAM:PF00665"
                     /note="KEGG: scb:SCAB_1311  integrase core domain;
                     manually curated;
                     PFAM: Integrase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_004921003.1"
                     /db_xref="GI:357409267"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11367246"
                     /translation="MRDSELTEQITEVHARSRGTYGAPRVHAVLTREGAGCGRRRVAR
                     LMQAAGLQGRHRRRRQVTTVPDPRAAFRPDLIVRDFQPGRTGLDARWCGDITYIPTDE
                     GWLYLATVIDIASRRVVGWATADHLRTDLVAEALTAACRQRRPTRPVIFHSDHGCQYT
                     SQQFASLAAGFGVRLSVGRTGQCWDNALAESFFSTIKRELLGTSAWPSRATARTAIFD
                     FIEGWYNLHRLHSSLGYLSPAEYETALAT"
     misc_feature    17..754
                     /locus_tag="Sfla_0001"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    20..193
                     /locus_tag="Sfla_0001"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    284..616
                     /locus_tag="Sfla_0001"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    530..730
                     /locus_tag="Sfla_0001"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            1051..1626
                     /locus_tag="Sfla_0002"
                     /db_xref="GeneID:11368209"
     CDS             1051..1626
                     /locus_tag="Sfla_0002"
                     /inference="similar to AA sequence:KEGG:Sros_4130"
                     /note="KEGG: sro:Sros_4130 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921004.1"
                     /db_xref="GI:357409268"
                     /db_xref="GeneID:11368209"
                     /translation="MDRLSEVLSSEYFCVTAVRGLPQQDLLDRLEIVVQGALQEYRLD
                     NAIEHLGFDSWGVRIYAPADTEWIYLFDVNGQTGVAHMEPVLRRLSRGTEAISVWSLL
                     DSTTHVKQARDGEVIATCSTWLFEPAAGSDPDRLNTALRHVGFFLEDEPEGFDDARAA
                     LEAVETEFGLRVEAGAVKGPLPTIFVSSQLS"
     gene            complement(1655..2953)
                     /locus_tag="Sfla_0003"
                     /db_xref="GeneID:11368210"
     CDS             complement(1655..2953)
                     /locus_tag="Sfla_0003"
                     /inference="similar to AA sequence:KEGG:SAV_34"
                     /note="KEGG: sma:SAV_34 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921005.1"
                     /db_xref="GI:357409269"
                     /db_xref="GeneID:11368210"
                     /translation="MLRSVFVGALTVGLLALGVPAYSQSEPVNDRVSAPSNAEPERFP
                     GGRAGAEKSNCAEAAARHKAAGSTGLYGCITEVSETEARQRSAATGAAAVPLPVNDCT
                     GNENGSWWALRLSQCQIDPDVRYTLRDKDGTIVATALFAIAQQMDLSATSLEWTETDQ
                     LVMLEASPKLPALTATWTTKCAATCSPATTAVFSKQPVKVGQLLKKTYKVADVPTKKY
                     DFLDVDYTLNFDAAGATEITPPSTWDAEVRCDDQLSVGNTSGCVVPWFTPTLNISRAQ
                     YGSSADMINWAQINLSGHWGLRSSGKPLHRLQSASEQKKNRQAICGTGKFTPDPAVEQ
                     DSCDEFPFAGTYESGALNGVDHGNACAQVTSVRKNSTGDLPFDWQTVTPIGTVTGNEK
                     CVRGHIPGPLNSYAGGAYGNFVQTARLADNDGFWLKVTSS"
     gene            complement(3333..3503)
                     /locus_tag="Sfla_0004"
                     /db_xref="GeneID:11368211"
     CDS             complement(3333..3503)
                     /locus_tag="Sfla_0004"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921006.1"
                     /db_xref="GI:357409270"
                     /db_xref="GeneID:11368211"
                     /translation="MTKVHQRGQEPVDEHHAVLRTSAHRTLPLPGRKPGLVPLMPQRA
                     HLSNKFSNHSGR"
     gene            4051..4229
                     /locus_tag="Sfla_0005"
                     /pseudo
                     /db_xref="GeneID:11368212"
     gene            complement(4373..4981)
                     /locus_tag="Sfla_0006"
                     /db_xref="GeneID:11368213"
     CDS             complement(4373..4981)
                     /locus_tag="Sfla_0006"
                     /inference="similar to AA sequence:KEGG:Sthe_2297"
                     /note="KEGG: sti:Sthe_2297 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921007.1"
                     /db_xref="GI:357409271"
                     /db_xref="GeneID:11368213"
                     /translation="MNWWHRAHATPLATAVLIVTMLLVPLLGGSALPIPSLLAGMSAG
                     IPVALVLPAIPAAFTLYALNRVPRLYDTTAVRPVARYQVGMLTAAVLLATILGLGAAY
                     AADSSMSLAAARNLLGYLGTGLIVQYLAGHVYGPLTVAFVPVTCALIGLGPGGRPFPW
                     TWPLHEASSPIAAIASLLLLTAGIAATTLLPPRGAASRPATA"
     gene            complement(4978..6225)
                     /locus_tag="Sfla_0007"
                     /db_xref="GeneID:11368214"
     CDS             complement(4978..6225)
                     /locus_tag="Sfla_0007"
                     /inference="similar to AA sequence:KEGG:Sthe_2296"
                     /note="KEGG: sti:Sthe_2296 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921008.1"
                     /db_xref="GI:357409272"
                     /db_xref="GeneID:11368214"
                     /translation="MRISTLLRSGPAAWAALVLVPVLVWFSAQNTESTIAYWPSISSQ
                     TTIVVGFISAACGAGAAWEAARLRQGGITVLAPARGSLSVAVLHLGPVAVLGLIAMIA
                     PFAVIVTSVASTPGLPNPAILAVSYSVVLAHIALGWFVGARMPKLLGAATMLIFGYLW
                     GFWPAALGGLPWLRHLNGQGVTECCGLDQDPSIRSLAATVTFSLAIVAAVVLSSALRH
                     RLWRPLLSLTGFTVATTVALTLAVPLDFQGTQARDTALRTCTGQNPQICLWPEQNTRR
                     ADISHWAEETTAQLSAVGVTPARQVEFGDPQPDKTNVASNIATSPLPNEAPPCALRQG
                     AAYPGDEAMIAIYAWLSLTGGVPKSDLAQRWPLEAISLAEQIRALPTQAQHAWYERNM
                     RSVHDCAVLPDLDPASYTKAATS"
     gene            complement(6229..6972)
                     /locus_tag="Sfla_0008"
                     /db_xref="GeneID:11368215"
     CDS             complement(6229..6972)
                     /locus_tag="Sfla_0008"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: sti:Sthe_2295 ABC transporter related
                     protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004921009.1"
                     /db_xref="GI:357409273"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11368215"
                     /translation="MPLHYTDCSFAYRAGTPVLDGLTMDLPQGCTVLLGPNGAGKSTL
                     LSLGASSLTPVSGRVTLGRLDSVRRRDRRAFRQKVGWLPQEVKAIPALTVREQAAYVG
                     WLKGLSKREAWDRSATALDRVRLTELGQRKSHELSGGQLRRLGIAQTLVHQAEIVLLD
                     EPTAGLDPVQRGVFRDLLAELSGSVHFIVSTHQTEDLADIYETVIVFDRGRPVFRGPV
                     SDFFSTAPAGTPHERRAESAYRGLVRGEV"
     misc_feature    complement(6325..6966)
                     /locus_tag="Sfla_0008"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(6304..6954)
                     /locus_tag="Sfla_0008"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    complement(6847..6870)
                     /locus_tag="Sfla_0008"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(6397..6399,6490..6495,6721..6723,
                     6844..6852,6856..6861))
                     /locus_tag="Sfla_0008"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(6721..6732)
                     /locus_tag="Sfla_0008"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(6538..6567)
                     /locus_tag="Sfla_0008"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(6490..6507)
                     /locus_tag="Sfla_0008"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(6472..6483)
                     /locus_tag="Sfla_0008"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(6391..6411)
                     /locus_tag="Sfla_0008"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(7063..7470)
                     /locus_tag="Sfla_0009"
                     /db_xref="GeneID:11368216"
     CDS             complement(7063..7470)
                     /locus_tag="Sfla_0009"
                     /inference="similar to AA sequence:KEGG:CMM_2902"
                     /note="KEGG: cmi:CMM_2902 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921010.1"
                     /db_xref="GI:357409274"
                     /db_xref="GeneID:11368216"
                     /translation="MRTSRIAAVAVSTAVVGVLGIAPAFAQGGYTSSISGWLPGKESN
                     HWTDGNTDSVSTSVKFSGCSVDNGRFTYAGLQLKKERSGLPDTVVNRDNNYCDTSSFG
                     DKAAGKYYFNYSSLNGQDSVSAYLSVSTVTVRY"
     gene            complement(8542..9117)
                     /locus_tag="Sfla_0010"
                     /db_xref="GeneID:11368217"
     CDS             complement(8542..9117)
                     /locus_tag="Sfla_0010"
                     /inference="similar to AA sequence:KEGG:SCAB_1221"
                     /note="KEGG: scb:SCAB_1221 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921011.1"
                     /db_xref="GI:357409275"
                     /db_xref="GeneID:11368217"
                     /translation="MAGRWMDLGALNARGLPGADALGVAIERMVTGIASSVESERGLA
                     ARLNYLTKTDAGYEAMDRAGIHVSPRTLMAWLAEERIPNKANRSRLDAAYWDLRRRNV
                     AADLKKRLNNHGRGTRVEINPVDQTRVEGRHQRDLSSRSLNVRGVWDRAVDAWMNEDV
                     DELDAVWDDIIEDLGSEYDAYSNVSSIGWAA"
     gene            complement(9117..10679)
                     /locus_tag="Sfla_0011"
                     /db_xref="GeneID:11368218"
     CDS             complement(9117..10679)
                     /locus_tag="Sfla_0011"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: scb:SCAB_0311  telomere-binding protein;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921012.1"
                     /db_xref="GI:357409276"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11368218"
                     /translation="MTEKLSVEALLEEARLNASIPPPAERLRLREAAKLSRAQVAETC
                     DVGRSTVANWETGHSEPAPPARLPYLRLLKGLAEIYPPDSTPAPAPGPAADPAPHPAP
                     APVPAAFTAALETLRGADGRAIESDPGPCIRCGIETTYQSTDGRPLHSGAMCQPADPA
                     VSAAPAPAVTALAPVSPTPAPVPSRPERRARSAARAQADTTALIARAVQDEAERAGGD
                     EEAALKALIKRAIPDVMHLFNETRATARYDYTAYPALPDILKKPSKKDPDQIWEARPK
                     FHHPGYSLKVPGDVKVTALDVNAAYLSALKCWLPIGKLEHHAGTDGVDPKRSGVHLIT
                     PGEWAHPHLPDPIGDRDEPGALWVTNSTLRLLQRLSGPKYGLTDAPVIHESWTSGATE
                     NFLDALRKLLSAARDEAIENRDTLTLEYVKAMYSKFISTMGESIHNREMVRPDWMHII
                     HSQAYANLWGKAYKAHQAGLDVVAMMGTDELHLTGDWRKVFTEGRGVSQMKVKHGEGK
                     ATGEYTVGTVGR"
     misc_feature    complement(<10497..10610)
                     /locus_tag="Sfla_0011"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(10512..10514,10587..10589,10596..10598))
                     /locus_tag="Sfla_0011"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(10515..10517,10590..10592))
                     /locus_tag="Sfla_0011"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(10509..10514,10524..10526,10533..10535,
                     10566..10571))
                     /locus_tag="Sfla_0011"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            10864..13509
                     /locus_tag="Sfla_0012"
                     /db_xref="GeneID:11368219"
     CDS             10864..13509
                     /locus_tag="Sfla_0012"
                     /inference="protein motif:PFAM:PF04851"
                     /note="KEGG: sma:SAP1p95  helicase;
                     PFAM: type III restriction protein res subunit;
                     helicase-associated;
                     SMART: DEAD-like helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction protein res subunit"
                     /protein_id="YP_004921013.1"
                     /db_xref="GI:357409277"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005114"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:11368219"
                     /translation="MQGISLRPHQVEAVDSIIEGLALPLDGTVPASGRRGQVHMSTGS
                     GKTITAAVAALRMVPRGVVGVLVPTLDLLTQTVEAWRAVGHSAPAVAVCSLGADPLLE
                     ALNVRCTTNPTQLALWAGAQDGPLLVFATYASLSPQGLDDDQGDEETGAAPGALERAL
                     RGSYGQTMRPFDLLVVDEAHRTSGDLGKAWAAVHDQGRVPAVRRLYMTATPRLWEASP
                     GSAGADETGGHLVASMDDETLYGPVLFEFGLMESVERGVLARFEIDVLEIRDPQSPGP
                     DASVEERRGRRLAALQEALLKHADTTGVRSFMTFHSRTLDAMSFARALPETAAELHAT
                     DPVTYPGRVGAEWLSGEHPAAHRRMVLGRFADGIDADGWVTDLGVLSSCRVLGEGVDI
                     RGKRGVGAVVFADTRSSPVDIVQVIGRGLRQNPGEGKVSRIVVPVFLEPGEDPSDMMA
                     SPSYRPLVAVLQGLRAHDERVIERMTLGTTTARGKATSVVALDPVREEGDDGNGQEHD
                     ADEDQEQQTDTAPAGTEDSTEDDAAGIGAGHESGTEDDAAEEEHPGSGVPLLRFSLPR
                     DPGTIALFLRTRILHPDSEIWLTGYNALRHWVAEHRSAEVPLDEVVELGEERITYALG
                     AWVSEQRRAFRLGTLKAWRADLLNELGMVWSVADAGFWKNLTAARAYHAVHGSLAAPK
                     DAVVEGVAVGQWLANLRKAGGLGKDEVRAAERRAALEAIDPEWHPGWSMEWQRHYATA
                     RALLAEEGGLTEVLPGVLVHGCDVGTWVLRQRDSATWEALLPEQRERLEALGLTPLPA
                     VPAKKTTAGGAGAFERGVLALEQYRARTGTVTVPRAHIETVTIDGQEHGVKLGVFLTN
                     SKTRRAKLAADKLAVLAALGLDWAA"
     misc_feature    10873..12225
                     /locus_tag="Sfla_0012"
                     /note="DNA phosphorothioation system restriction enzyme;
                     Region: dnd_restrict_1; TIGR04095"
                     /db_xref="CDD:234468"
     misc_feature    10975..11496
                     /locus_tag="Sfla_0012"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    10990..11004
                     /locus_tag="Sfla_0012"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    11392..11403
                     /locus_tag="Sfla_0012"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    11905..12129
                     /locus_tag="Sfla_0012"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    12622..12822
                     /locus_tag="Sfla_0012"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     misc_feature    12844..>12981
                     /locus_tag="Sfla_0012"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     misc_feature    13060..13239
                     /locus_tag="Sfla_0012"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     misc_feature    13297..13491
                     /locus_tag="Sfla_0012"
                     /note="Helicase associated domain; Region: HA; pfam03457"
                     /db_xref="CDD:251968"
     gene            complement(13771..14121)
                     /locus_tag="Sfla_0013"
                     /db_xref="GeneID:11368220"
     CDS             complement(13771..14121)
                     /locus_tag="Sfla_0013"
                     /inference="protein motif:PFAM:PF00376"
                     /note="KEGG: stp:Strop_1156 regulatory protein, MerR;
                     PFAM: regulatory protein MerR; Transcription regulator
                     MerR DNA binding;
                     SMART: regulatory protein MerR"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004921014.1"
                     /db_xref="GI:357409278"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR015358"
                     /db_xref="GeneID:11368220"
                     /translation="MRIGEVASAAGVSTRALRYYEQQQLIVSNRSAGGQRLYTPDTVE
                     RVRWIQLLYAAGLSSRTIVEFLPCVHTGIAGPEMIARLRAERDRLDDHMRDLAATRAR
                     LDSVLTAAERSRGR"
     misc_feature    complement(13786..14121)
                     /locus_tag="Sfla_0013"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    complement(13798..14121)
                     /locus_tag="Sfla_0013"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg3; cd01282"
                     /db_xref="CDD:133388"
     misc_feature    complement(order(14014..14022,14068..14070,14110..14118))
                     /locus_tag="Sfla_0013"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133388"
     misc_feature    complement(order(13822..13827,13834..13836,13846..13848,
                     13864..13866,13876..13878,13927..13929,13954..13959,
                     13969..13971,13978..13980))
                     /locus_tag="Sfla_0013"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133388"
     gene            14281..14631
                     /locus_tag="Sfla_0014"
                     /db_xref="GeneID:11368221"
     CDS             14281..14631
                     /locus_tag="Sfla_0014"
                     /inference="protein motif:PFAM:PF03992"
                     /note="PFAM: Antibiotic biosynthesis monooxygenase;
                     KEGG: ske:Sked_12430 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="YP_004921015.1"
                     /db_xref="GI:357409279"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="GeneID:11368221"
                     /translation="MSTDDTAPDGLIPAAILASDTPIAVYGYARAKAGEEDRLLGEIQ
                     AIIGLTRKEDGCEQYTVHTTPDQPGAFAFYERWSSGAHLLAHVSQPFMQTYFTAIAGL
                     VEGELEAHWLHPFS"
     misc_feature    14338..14628
                     /locus_tag="Sfla_0014"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            complement(14940..15647)
                     /locus_tag="Sfla_0015"
                     /db_xref="GeneID:11368222"
     CDS             complement(14940..15647)
                     /locus_tag="Sfla_0015"
                     /inference="protein motif:PFAM:PF04471"
                     /note="PFAM: restriction endonuclease;
                     KEGG: sco:SCO7763 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="YP_004921016.1"
                     /db_xref="GI:357409280"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004519"
                     /db_xref="InterPro:IPR007560"
                     /db_xref="GeneID:11368222"
                     /translation="MTARGPAPRRRPRRSPARSRKRKQAHAGGEILVGVVVIGWLFSQ
                     LMHWLAAHPWVPLLLALLAGAGAFVWFRSRVQAQALLHTQVRALRYPMAALDGLQHRQ
                     FEHAIRDLMLRDGCADAVQVGGAGDNGADVKATDPYGRRWVIQCKHRRAGLAGAAVGT
                     CDLHVLNGTGRPVHKGDVIVLVTNGRFTKPATEFARSQRLHLVDRHTLATWAAGSQPL
                     WELLRALPPPRRPTTLS"
     misc_feature    complement(15015..15365)
                     /locus_tag="Sfla_0015"
                     /note="Restriction endonuclease; Region: Mrr_cat;
                     pfam04471"
                     /db_xref="CDD:252617"
     gene            complement(15644..15997)
                     /locus_tag="Sfla_0016"
                     /db_xref="GeneID:11368223"
     CDS             complement(15644..15997)
                     /locus_tag="Sfla_0016"
                     /inference="similar to AA sequence:KEGG:RC1_3177"
                     /note="KEGG: rce:RC1_3177 acid phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921017.1"
                     /db_xref="GI:357409281"
                     /db_xref="GeneID:11368223"
                     /translation="MPWVRLYVRRDGTKVQGHSRWAAGGRREMSTVVMVGLAVVVLGN
                     PANSDSGSGATPRPAPTAVYPVTFPKTERTSSTPRPQPTVSYPIRFPQASKAAARPRP
                     RSTVTYPIPWDRSAR"
     misc_feature    complement(<15665..>15832)
                     /locus_tag="Sfla_0016"
                     /note="Protein of unknown function (DUF4106); Region:
                     DUF4106; pfam13388"
                     /db_xref="CDD:257714"
     gene            complement(16259..17536)
                     /locus_tag="Sfla_0017"
                     /db_xref="GeneID:11368224"
     CDS             complement(16259..17536)
                     /locus_tag="Sfla_0017"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: sgr:SGR_4604 major facilitator superfamily permease"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004921018.1"
                     /db_xref="GI:357409282"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11368224"
                     /translation="MTFAATRPGAAPVPPGGAPNGTPGGRPSRALTAVYAAGAVTALG
                     TQMTMLALPWLVLETTGSATRAGLVFAAQVLPMALLGFVGGEVIQRLGARRTMVVSDL
                     ARAPVVALVPLLQTLGALSLAALVVIVAALGALAVPYHAAQRVLAMELLSPHARSLAR
                     ANSALEGVQHGSAFAGPALAGALIPLMGTTSVIWLDAATFAFSGLLLLRFVPAGAGGA
                     KGSAAGPRGLWAGVRHLCGDWFLSRAMLSTVVFGLMLRTLMITMPVLAFVRFEGDARV
                     GGLLIAVLGAGGLVGSMAAYALAARVAPVRLACTALVCVALPLWTLLVPVPAGVLVVA
                     VGLSSAAAPLANAPLMGLLTARLPDGFGPKVLQAVVTISTLAGPLGFLAAGAVLDRAG
                     VEATLWGVAALATFGSGNLILALRRLQATGNPG"
     misc_feature    complement(16313..17446)
                     /locus_tag="Sfla_0017"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(16361..17434)
                     /locus_tag="Sfla_0017"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(16406..16408,16415..16420,16427..16432,
                     16439..16444,16475..16477,16484..16489,16499..16501,
                     16508..16513,16520..16522,16661..16663,16673..16675,
                     16682..16684,16694..16696,16706..16708,16748..16750,
                     16757..16762,16769..16774,16781..16783,17018..17020,
                     17036..17041,17048..17053,17093..17095,17102..17107,
                     17114..17119,17126..17131,17282..17287,17291..17296,
                     17306..17308,17315..17320,17327..17329,17378..17383,
                     17387..17395,17402..17404))
                     /locus_tag="Sfla_0017"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            17783..19762
                     /locus_tag="Sfla_0018"
                     /db_xref="GeneID:11368225"
     CDS             17783..19762
                     /locus_tag="Sfla_0018"
                     /inference="protein motif:PRIAM:3.4.19.1"
                     /note="KEGG: stp:Strop_2293 peptidase S9 prolyl
                     oligopeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="acylaminoacyl peptidase"
                     /protein_id="YP_004921019.1"
                     /db_xref="GI:357409283"
                     /db_xref="GeneID:11368225"
                     /translation="MSSGIGTAVHVPSFAARDGRRAVETRYVDGLPQIVAWDLTTGQR
                     RQATTAPLGVETAAIEPDGHGLWWFDASAGGQGSWLRGPFGGGHPRPALDGVPAGRMY
                     GLAFDPRSGLAAVGVGVGVGVADHSEYYLGRPGEHARLVAEEPGYGAVVGLAPGGRLL
                     ATAGYPAGPAAVRLWSPASGALVDTVPGAAGDDDGGAVWALGFRPDLTTARPELLLVL
                     ERAGRYTLASWLQGEGIRTHGPGSALDFDTEITACWYGPGRTALVQQDRAGRSRLLRA
                     DLDRGTTRVLPTPEGTIIDFSCAPDRTVHCLWSRDGEPPRPLICPPESLEGSESTEHP
                     EPPEHPDHSGRSDRSGQCGHSDRSTTASHGTAPGGTTGSRRRELWTRRPYGQIHSFVA
                     TPPGRTTDHRPWPTVFLVHGGPHTHDRDAYDTRTEALVRAGFTVVRTNYRGSTGYGPR
                     WRDDFGHRVGLAQLEDLAAVRGHLIDAGVSEPGRTGLCGYSWGGYLTLLAMGVQPRLW
                     DVGLAVAPVADYTAAYRATTPALREVDDRLFGGTPEQVPHRYRAACPMTYVGRVRGPL
                     FLAASADDEKCPPEQIERYLAALRHRDVPHRIRWLGGGHDVGRAPSGHAAAWAAMVRY
                     ADDTLRASPKTAGRRTSGRTGLHHPVHHTEERPTP"
     misc_feature    18929..19675
                     /locus_tag="Sfla_0018"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     misc_feature    19043..19612
                     /locus_tag="Sfla_0018"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:249771"
     gene            19759..19926
                     /locus_tag="Sfla_0019"
                     /db_xref="GeneID:11368226"
     CDS             19759..19926
                     /locus_tag="Sfla_0019"
                     /inference="similar to AA sequence:KEGG:Tbis_3002"
                     /note="KEGG: tbi:Tbis_3002 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921020.1"
                     /db_xref="GI:357409284"
                     /db_xref="GeneID:11368226"
                     /translation="MKRHGLRIDPISATERERGIIIHPDTQASLDKAVPVQPSPAGDC
                     RAGGCSAGVLP"
     gene            20046..21209
                     /locus_tag="Sfla_0020"
                     /db_xref="GeneID:11368227"
     CDS             20046..21209
                     /locus_tag="Sfla_0020"
                     /inference="protein motif:PFAM:PF00067"
                     /note="PFAM: cytochrome P450;
                     KEGG: stp:Strop_2290 cytochrome P450"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004921021.1"
                     /db_xref="GI:357409285"
                     /db_xref="GO:0004497"
                     /db_xref="GO:0005506"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0020037"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002397"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="GeneID:11368227"
                     /translation="MLHSDGGLRLWIVPRYADVRAALSDHRFAQDVRRAQALADSRVE
                     GVNLGAEITHMLSSDPPDHTRLRRVVQAAFSRKRVQEMRPMVERITLELLDELDPAAA
                     RHTTRTTTATATATATATVDLIRDFAFPLPILVVCELLGLPPQDRNLYREWSTAIVTQ
                     EGDHTAFQQAVHDMGSYVLAIADQRIRRNDRPADLLTDLLAARERGELTDDEIVGMVA
                     LLLIGGHETTVNLLGTSCLALLRNPDQTAWLRADPTRMPMAVEEFLRYDSPICMATTR
                     FTTQPVDIGGVEIPQDEFVLLSLGAANRDPARFQDPDRLVLNRQDTGHLAFGGGIHRC
                     LGALLGKLETEIALTALLARFPGITLACQEHDLRWRNTMMLRGLETLPLTLNR"
     misc_feature    20064..21206
                     /locus_tag="Sfla_0020"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(22230..22553)
                     /locus_tag="Sfla_0021"
                     /db_xref="GeneID:11368228"
     CDS             complement(22230..22553)
                     /locus_tag="Sfla_0021"
                     /inference="similar to AA sequence:KEGG:SCAB_53321"
                     /note="KEGG: scb:SCAB_53321 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921022.1"
                     /db_xref="GI:357409286"
                     /db_xref="GeneID:11368228"
                     /translation="MSAIRPWGQAKLAGGHVAAIEVLVDLLVCAVLLLASVGVIGTEP
                     TTRAEETAAWQSAGQLYFGWLVVGATSLALLRMPKALLAHVSTMLLSPIALFVLLLLL
                     SSGRG"
     gene            complement(23143..24201)
                     /locus_tag="Sfla_0022"
                     /db_xref="GeneID:11368229"
     CDS             complement(23143..24201)
                     /locus_tag="Sfla_0022"
                     /inference="similar to AA sequence:KEGG:SACE_6179"
                     /note="KEGG: sen:SACE_6179 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921023.1"
                     /db_xref="GI:357409287"
                     /db_xref="GeneID:11368229"
                     /translation="MGWWRKFVPVVWQETLLWEEEPQPLPVPRSLREVAATVAAPAAP
                     EVGQDPLPVVAEEGWAGEYASFCLSFVRGLDESELLRRFGALADTHRPRSRGQAQADA
                     QRWMAGLLPVVRAGRCGQWAFGIEEGHRWEGNRSEVLRRLSRGTQAVSLSFSGATTMS
                     YYEDGEVVTVYDTRRSYQQPGEGDPFDIFPELPAHGPAVGRLLPDGRTSLGSLEVPTE
                     RTPLLQRATLRAVCRVVSDHFGIDLPPGALTGELASAQDCQEWTGDTVRRPNLPSTSP
                     RPPRRACAPCWQHKCAVWLPRPASIPTPRSSKLFIERARTSATVWTTTHHSAYGCAQS
                     LRTRRQHGACPGTTRAIF"
     gene            24386..24523
                     /locus_tag="Sfla_0023"
                     /db_xref="GeneID:11368230"
     CDS             24386..24523
                     /locus_tag="Sfla_0023"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921024.1"
                     /db_xref="GI:357409288"
                     /db_xref="GeneID:11368230"
                     /translation="MPVRLIRMILAEPVPQLLVHPTAPQNGINTQRLIPSRELEETVP
                     R"
     gene            complement(24608..25537)
                     /locus_tag="Sfla_0024"
                     /db_xref="GeneID:11368231"
     CDS             complement(24608..25537)
                     /locus_tag="Sfla_0024"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: mva:Mvan_2522 integrase catalytic subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_004921025.1"
                     /db_xref="GI:357409289"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:11368231"
                     /translation="MTETAPEAVVAFIGNQRVEHGVPHRVSCRVLGVSEAWFYKWRRR
                     PDEPTKREVRRARLEERIVHFFTASGGTYGSPRITLDLWAEGWQVSVNTVAEIMAELG
                     LRGRKPPRRRSLTRQGKRKAAPDLVNRRFDAVAPDVLWFGDMTEIETGEGKVYLATVI
                     DAFSRRCLGYAMGEHHDAALVGASLKMATTTRGGRREGTIFHSDRGSEYTSGTYNTLC
                     DRLGVVQSMGRVGSALDNAAAESFNSLIKVEYIHRRRFATRTEARLKIGTWIIGFYNP
                     RRRHSAAGGLPPEEFEQIITEARNKSRQRCQAA"
     misc_feature    complement(24662..25447)
                     /locus_tag="Sfla_0024"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    complement(25205..25378)
                     /locus_tag="Sfla_0024"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(24791..25135)
                     /locus_tag="Sfla_0024"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(24674..24877)
                     /locus_tag="Sfla_0024"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(25534..25941)
                     /locus_tag="Sfla_0025"
                     /db_xref="GeneID:11368232"
     CDS             complement(25534..25941)
                     /locus_tag="Sfla_0025"
                     /inference="protein motif:PFAM:PF01527"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: mva:Mvan_2521 transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_004921026.1"
                     /db_xref="GI:357409290"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:11368232"
                     /translation="MPDRPDLPLVAWSPCLQGKLGFMGSKKKPPYDAEFREGAVRIVV
                     ETGRPAGEVAEELGINPGTLHSWVSRWRRNGTTSSDRPVRPAAASGGGRVREAERAEL
                     ERLRREMTEKNKRIRELEMERDVFKRCMALWVK"
     misc_feature    complement(25543..25872)
                     /locus_tag="Sfla_0025"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(25615..25869)
                     /locus_tag="Sfla_0025"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            complement(25955..26298)
                     /locus_tag="Sfla_0026"
                     /pseudo
                     /db_xref="GeneID:11368233"
     gene            26398..26759
                     /locus_tag="Sfla_0027"
                     /pseudo
                     /db_xref="GeneID:11368234"
     gene            complement(27171..28376)
                     /locus_tag="Sfla_0028"
                     /db_xref="GeneID:11368235"
     CDS             complement(27171..28376)
                     /locus_tag="Sfla_0028"
                     /inference="protein motif:PRIAM:3.2.1.39"
                     /note="KEGG: sma:SAV_967 glycosyl hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucan endo-1,3-beta-D-glucosidase"
                     /protein_id="YP_004921027.1"
                     /db_xref="GI:357409291"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11368235"
                     /translation="MPPRHQRNLSRRKLITALAGAAVAVPAAAVIAPHALATKDPAEG
                     NSKAAGALPLTIVNNSGSFANTSVRVYVVGNQDGRQVRLTPEGTLAPISLSDNGADGF
                     TDYSIPLSGGGETTLSLPYMSGRIYVALGDKLKIKAVADGNGNAALQYPAGWVTSDPN
                     YTVLHDCAEFTYNAAGMFCNTTMVDMFSVPMSIGLTGAKNQTTGSLRDGGRAQAFAAV
                     SRIPEFADLVLDDRRIVAPGHGLDSGIFAEDYFDPYIDEVWSTYTGKDLTVTTNAGTF
                     TGRVRGDRFVFDGPASVSFDRPSTRDVLFCDGKLAAPNDGTTGPVAAVLGAGFNRSTL
                     ISDPAQPTADPAAFYRSSQITNHYSAAIHAATEEGKAYGFAFDDVADFASYIQDTAPK
                     GARLTLTPF"
     misc_feature    complement(27180..28223)
                     /locus_tag="Sfla_0028"
                     /note="glycoside hydrolase family 64 (beta-1,3-glucanases
                     which produce specific pentasaccharide oligomers) and
                     thaumatin-like proteins; Region: GH64-TLP-SF; cl02511"
                     /db_xref="CDD:261317"
     gene            complement(28435..29700)
                     /locus_tag="Sfla_0029"
                     /db_xref="GeneID:11368236"
     CDS             complement(28435..29700)
                     /locus_tag="Sfla_0029"
                     /inference="protein motif:PFAM:PF00722"
                     /note="KEGG: mau:Micau_3365 glycoside hydrolase 16
                     protein;
                     PFAM: glycoside hydrolase 16; Ricin B lectin;
                     SMART: Ricin B lectin"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase 16"
                     /protein_id="YP_004921028.1"
                     /db_xref="GI:357409292"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="GeneID:11368236"
                     /translation="MAAHRARRWSLGGLVLLLSAVLAATFLVSTTGPATSRANAAGPQ
                     VWADEFDGSAGSAPDRSKWTLETGGSGNGNNELQYYTDDSRNASLDGRGNLVITALKN
                     SDSGLRCWYGTCQYTSARLNTAKTFTQAYGRYEARIKIPRGQGIWPAFWMLGDDLGSV
                     GWPNSGEIDIMENVGHEPGTVHGTIHGPGYSGGGGITASHTLPNGKAFADDFHTFAVD
                     WSPNAITWSVDGQIYQTRKPDDVNGKKWVFDHPFFIVLNLAVGGNWPGSPDGATSFPQ
                     TMTVDYVRVSASDSSDGGSRTGAIKGIGGMCVDVAGASGADRTPIQLHNCTGVDAQKW
                     TLGSDGTVRALGKCLDVQGGSTAPGAVVQLYACNGTKAQQWAHTTARDLTNIGADKCL
                     DAKGNSSADGTRLQTWTCTGAANQKWTVR"
     misc_feature    complement(<28846..29616)
                     /locus_tag="Sfla_0029"
                     /note="Beta-glucanase/Beta-glucan synthetase [Carbohydrate
                     transport and metabolism]; Region: SKN1; COG2273"
                     /db_xref="CDD:225182"
     misc_feature    complement(28846..29565)
                     /locus_tag="Sfla_0029"
                     /note="Laminarinase, member of the glycosyl hydrolase
                     family 16; Region: GH16_laminarinase_like; cd08023"
                     /db_xref="CDD:185693"
     misc_feature    complement(order(29143..29145,29185..29187,29194..29196,
                     29200..29202,29248..29250,29260..29262,29341..29343))
                     /locus_tag="Sfla_0029"
                     /note="active site"
                     /db_xref="CDD:185693"
     misc_feature    complement(order(29185..29187,29194..29196,29200..29202))
                     /locus_tag="Sfla_0029"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185693"
     misc_feature    complement(28444..28803)
                     /locus_tag="Sfla_0029"
                     /note="Ricin-type beta-trefoil; Carbohydrate-binding
                     domain formed from presumed gene triplication. The domain
                     is found in a variety of molecules serving diverse
                     functions such as enzymatic activity, inhibitory toxicity
                     and signal transduction. Highly specific...; Region:
                     RICIN; cd00161"
                     /db_xref="CDD:238092"
     misc_feature    complement(28447..28803)
                     /locus_tag="Sfla_0029"
                     /note="Ricin-type beta-trefoil lectin domain; Region:
                     Ricin_B_lectin; pfam00652"
                     /db_xref="CDD:250032"
     misc_feature    complement(order(28453..28455,28477..28479,28483..28485,
                     28522..28524,28582..28587,28606..28608,28612..28614,
                     28651..28653,28705..28710,28729..28731,28735..28737,
                     28774..28776))
                     /locus_tag="Sfla_0029"
                     /note="putative sugar binding sites [chemical binding];
                     other site"
                     /db_xref="CDD:238092"
     misc_feature    complement(order(28447..28455,28576..28584,28699..28707))
                     /locus_tag="Sfla_0029"
                     /note="Q-X-W motif; other site"
                     /db_xref="CDD:238092"
     gene            complement(29921..30160)
                     /locus_tag="Sfla_0030"
                     /pseudo
                     /db_xref="GeneID:11368237"
     gene            30420..30998
                     /locus_tag="Sfla_0031"
                     /db_xref="GeneID:11368238"
     CDS             30420..30998
                     /locus_tag="Sfla_0031"
                     /inference="similar to AA sequence:KEGG:SGR_7000"
                     /note="KEGG: sgr:SGR_7000 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921029.1"
                     /db_xref="GI:357409293"
                     /db_xref="GeneID:11368238"
                     /translation="MSAPIVIHHPSPAGGRQVTICGRIAGLAYDDHDLLEFLRRAGLP
                     DAKQLLDRNGWSSEAGGRTRTWQRSGALVLERDARDLSLPHVLTRGPESSSLAGIGRG
                     SPVLTGHGGWAAARGEVRTGRTGRCRGGSRPPGPEVRRLITGTIAPHAAPDPHDKRVR
                     HIVAQLNSVEPNLDLIARGKGGHDAAETTPES"
     gene            31122..32807
                     /locus_tag="Sfla_0032"
                     /db_xref="GeneID:11369358"
     CDS             31122..32807
                     /locus_tag="Sfla_0032"
                     /inference="protein motif:PFAM:PF02776"
                     /note="PFAM: thiamine pyrophosphate TPP-binding
                     domain-containing protein; thiamine pyrophosphate central
                     domain-containing protein;
                     KEGG: sgr:SGR_6206 acetolactate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate TPP-binding
                     domain-containing protein"
                     /protein_id="YP_004921030.1"
                     /db_xref="GI:357409294"
                     /db_xref="GO:0000287"
                     /db_xref="GO:0030976"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="GeneID:11369358"
                     /translation="MSDAEHRKQTPDGAAELLVRCLENEGVEVVFGVPGEENIRFTNA
                     LARSEKIRYVLTRHEQAASFMAEMHGRLTGSAGVMSATLGPGAINLMLGVADAMTNST
                     PVVAITAQVGKERNYKESHQFVDLVSMFAPVTKWSADVPATQAIPEMVRRAFKTAESE
                     RPGAVYLAVPEDVDGATDGSDLRPLRRDVVQPEAPSPKQIERAVELLREARRPVLLAG
                     HGAARGGAGESLTAFATALDVSTATTFHGKGVLPDDHPCATGTFGFMRRDYTNFGFEE
                     ADVVIAVGYELQEFDPSRINPDGDKKIIHIHRFPAEVDDSYSVDVGIIGDISASLDAL
                     ATALDGLRWTIDDEDTTATRALLAKELAQGAADERYPLAPQRIIADTRAALGRDDIVL
                     VDTGALKMWMARLYPTYAPNTCIISNGLSTMGFSLPGALAVQLARPQTKVLAAVGDGS
                     FLMHSQEIETAVRENIPLTVLIWEDNGYGLIKWKMDLEVGENSNTDFGNPDIVQYARS
                     FGAKGYHIESAGDLLPTLREALADPGVSIINCPVDYAENMNLIEHLGHLDSAL"
     misc_feature    31161..32804
                     /locus_tag="Sfla_0032"
                     /note="acetolactate synthase; Reviewed; Region: PRK08322"
                     /db_xref="CDD:236239"
     misc_feature    31167..31634
                     /locus_tag="Sfla_0032"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(31206..31208,31221..31226,31236..31238,31248..31250,
                     31275..31295,31302..31304,31311..31316,31323..31328,
                     31332..31340,31374..31376,31395..31397,31407..31409,
                     31416..31421)
                     /locus_tag="Sfla_0032"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(31221..31229,31236..31238,31248..31250,31278..31280,
                     31284..31295,31299..31301,31374..31376,31383..31388,
                     31392..31397,31404..31406,31506..31508,31515..31517)
                     /locus_tag="Sfla_0032"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(31221..31223,31296..31298,31374..31376,31386..31388)
                     /locus_tag="Sfla_0032"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    31719..32123
                     /locus_tag="Sfla_0032"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    32241..32771
                     /locus_tag="Sfla_0032"
                     /note="Thiamine pyrophosphate (TPP) family, Acetolactate
                     synthase (ALS) subfamily, TPP-binding module; composed of
                     proteins similar to Klebsiella pneumoniae ALS, a catabolic
                     enzyme required for butanediol fermentation. ALS catalyzes
                     the conversion of 2...; Region: TPP_ALS; cd02010"
                     /db_xref="CDD:238968"
     misc_feature    order(32304..32315,32382..32384,32388..32390,32463..32471,
                     32544..32546,32550..32552,32556..32561,32751..32753)
                     /locus_tag="Sfla_0032"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238968"
     misc_feature    order(32379..32381,32463..32468,32475..32480,32487..32489,
                     32496..32498,32508..32510,32553..32555,32571..32573,
                     32583..32585,32592..32594,32598..32603,32610..32615,
                     32622..32624,32634..32636,32643..32648)
                     /locus_tag="Sfla_0032"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238968"
     gene            complement(32863..33262)
                     /locus_tag="Sfla_0033"
                     /pseudo
                     /db_xref="GeneID:11369359"
     gene            33305..33969
                     /locus_tag="Sfla_0034"
                     /pseudo
                     /db_xref="GeneID:11369360"
     gene            complement(34304..35818)
                     /locus_tag="Sfla_0035"
                     /db_xref="GeneID:11369361"
     CDS             complement(34304..35818)
                     /locus_tag="Sfla_0035"
                     /inference="protein motif:PFAM:PF01645"
                     /note="PFAM: ferredoxin-dependent glutamate synthase;
                     KEGG: sgr:SGR_6207  glutamate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-dependent glutamate synthase"
                     /protein_id="YP_004921031.1"
                     /db_xref="GI:357409295"
                     /db_xref="GO:0015930"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="GeneID:11369361"
                     /translation="MRARNIGASAAAALALVAARDLVQKKHALLRNFPVVGHARYLLE
                     RIGPELRQYVVTSNDEERPFSRDQRSWIYASAKEENNYFGFGTDNDVEHVQGHAYVKQ
                     RTFAGRLPDLRDAQAPLPSAKVLGGPRGRAKAFRPASVVNISAMSFGSLSGAAVTALN
                     KGAALAGTMHNTGEGGLSPYHLNGGELVLQIGTSYFGCRNEDGTFNLDKLKSVVASGP
                     VKAIEIKLSQGAKPGLGGMLPGVKVTDEIAGIRGIPAGKDCASPSRHTAFHDVDSMLD
                     FVELLATETGLPVGIKSAIGEMGFWEELATLMERGDRGVDFVTIDGGEGGTGAAPLIF
                     ADSVSLPFRMGFSRVYSVFAERGLTDDITFIGSGKLGLPENAVVAFALGVDMVNVGRE
                     AMLSIGCIQAQKCHTDACPTGIATQDPWLTRGIDAPSKAIRAAMYLRTLRRELLRVSG
                     AVGVAHPSLITPTDIDILNGDYEARTLASVYDYKDGWGSLGPKLADEIAELLTA"
     misc_feature    complement(34415..35698)
                     /locus_tag="Sfla_0035"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(34589..34591,34604..34606,34622..34624,
                     34646..34651,34712..34714,34718..34720,34835..34843,
                     34943..34945,35066..35068,35126..35128,35144..35146,
                     35249..35251,35297..35299,35378..35389))
                     /locus_tag="Sfla_0035"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(34646..34651,34712..34714,34718..34720,
                     34838..34843,34943..34945,35144..35146,35249..35251,
                     35297..35299,35378..35389))
                     /locus_tag="Sfla_0035"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(34835..34840,35066..35068,35126..35128))
                     /locus_tag="Sfla_0035"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(34589..34591,34604..34606,34622..34624))
                     /locus_tag="Sfla_0035"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     gene            complement(36540..36962)
                     /locus_tag="Sfla_0036"
                     /pseudo
                     /db_xref="GeneID:11369362"
     gene            37789..38761
                     /locus_tag="Sfla_0037"
                     /pseudo
                     /db_xref="GeneID:11369363"
     gene            38883..39929
                     /locus_tag="Sfla_0038"
                     /db_xref="GeneID:11369364"
     CDS             38883..39929
                     /locus_tag="Sfla_0038"
                     /inference="protein motif:PFAM:PF02770"
                     /note="PFAM: acyl-CoA dehydrogenase domain-containing
                     protein;
                     KEGG: rer:RER_12650 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004921032.1"
                     /db_xref="GI:357409296"
                     /db_xref="GO:0003995"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="GeneID:11369364"
                     /translation="MTGSTERRLVVPERPVSPGHEGEFEARALRAETSARFAGAVAAM
                     ESGRLLFPLPGSGRTAERFAALKAVAEDDLCLARLVEGHVDAVAILAELDGPAAEPGS
                     RWGVWAAEPPGEGLSATRQPDGGWTISGLKQYCSGAHSCTHALVTARVKDGRRLFAVS
                     LSDTSYEPLEGTWRALGMAGSDTPDVRFHEAPAEPVGAVEDYVNRPGFQHGGIGVAAC
                     WLGGARAVARPLYAAAARGSDPHTTAHLGAVDIDVHAAELTLNAAATAIDTDPLDSKG
                     EARQLSLRVRGLVEAVCGRTLDHVGRATGAGPLCHDQRHARNVADLTVYIRQHHAERN
                     LAELGALLSEGEGL"
     misc_feature    38940..39686
                     /locus_tag="Sfla_0038"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    39153..39716
                     /locus_tag="Sfla_0038"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     gene            39926..40696
                     /locus_tag="Sfla_0039"
                     /db_xref="GeneID:11369365"
     CDS             39926..40696
                     /locus_tag="Sfla_0039"
                     /inference="protein motif:PFAM:PF02585"
                     /note="PFAM: LmbE family protein;
                     KEGG: fal:FRAAL6435 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_004921033.1"
                     /db_xref="GI:357409297"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:11369365"
                     /translation="MSTRSDDPPPYANPIQAPGTAEGLWAAWSGWDAMHEFPLPAAGS
                     VVVVAAHPDDEVLGFGGTLARLSDLGHQMTVVAVTDGEGSHPHSRVLRPHELAAIRSE
                     ETRAALGRLGAGHADVVQLHIPDSQVARYEDDLCKALAPLCRGAALVAAPWSGDMHSD
                     HEAAGRATRAAAQAVGASFVEYPIWLWHWAQPGDPRVPWSRAAQLPLNLEVQARKRHA
                     VDAFASQILPLGPGAQDAAILPPEEIAHHLRPREVVFQ"
     misc_feature    40076..40405
                     /locus_tag="Sfla_0039"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; pfam02585"
                     /db_xref="CDD:251394"
     gene            40693..41310
                     /locus_tag="Sfla_0040"
                     /db_xref="GeneID:11369366"
     CDS             40693..41310
                     /locus_tag="Sfla_0040"
                     /inference="protein motif:PFAM:PF08242"
                     /note="KEGG: nml:Namu_3271 LmbE family protein;
                     manually curated;
                     PFAM: Methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="type 12 methyltransferase"
                     /protein_id="YP_004921034.1"
                     /db_xref="GI:357409298"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:11369366"
                     /translation="MSTPAEYFEGMYAGRSDPWHLQERWYEHRKYALTVGSLPRPRFR
                     RAFEPACSVGQLTRLLAQRCDEVVAADRVESAVATARRRTADLSHVAVSRLTVPQEWP
                     EGTFDLIVLSELLYYFDGRRLDELLSRATASLDAGGTLVTVHWNHPVQEHLYTGAQLA
                     ERLSREPGLVLDVDHTEEDFVLQTFSRVLPGEDPPLSPAGFEGLL"
     misc_feature    40825..41127
                     /locus_tag="Sfla_0040"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(40837..40857,40903..40908,40969..40977,41026..41028)
                     /locus_tag="Sfla_0040"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            41307..42071
                     /locus_tag="Sfla_0041"
                     /db_xref="GeneID:11369367"
     CDS             41307..42071
                     /locus_tag="Sfla_0041"
                     /inference="protein motif:PFAM:PF00535"
                     /note="PFAM: glycosyl transferase 2;
                     KEGG: cms:CMS_1024  glycosyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="YP_004921035.1"
                     /db_xref="GI:357409299"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:11369367"
                     /translation="MTGLAAIAVVIPAHNEEAPLSAALASVRRATRHPAVRSVRQLVV
                     VAADACTDRTIQVAVREGAVVAALDARSPGEARATGARLALDTLGVDPAAVWIASTDA
                     DSEVPSRWLAHQRVCADRGWDAVVGTIRPQGWPPVLEGVMSDHVRAYATAGSTEHPSS
                     LHPHVHGANLGVRADAYLSVGGFPSRTTGEDHALVAALQAHRYRVLRTRRFPVLTSAR
                     LAARARGGYADHLAQLVGDAQSLEPKHFDADRATTH"
     misc_feature    41325..>41951
                     /locus_tag="Sfla_0041"
                     /note="Glycosyltransferases, probably involved in cell
                     wall biogenesis [Cell envelope biogenesis, outer
                     membrane]; Region: COG1215"
                     /db_xref="CDD:224136"
     misc_feature    41331..41879
                     /locus_tag="Sfla_0041"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(41340..41342,41346..41348,41442..41444,41607..41609,
                     41613..41615)
                     /locus_tag="Sfla_0041"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            42253..42567
                     /locus_tag="Sfla_0042"
                     /pseudo
                     /db_xref="GeneID:11369368"
     gene            42742..43599
                     /locus_tag="Sfla_0043"
                     /db_xref="GeneID:11369369"
     CDS             42742..43599
                     /locus_tag="Sfla_0043"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: fre:Franean1_2339 XRE family transcriptional
                     regulator;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein; PAS domain
                     containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921036.1"
                     /db_xref="GI:357409300"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11369369"
                     /translation="MFTTGSVATIPCREWPGTLPRRYNRPVDFPRALRELRTRRHLSQ
                     LDLALRAGTTQRHLSFIESRRSDPGRNMVVRLAEALELSLRERNELLLAAGYAPAYPE
                     SSLDDQALAPVRAAIDHILRGHLPYPALVVDGAGDLIAANTAFDLITEGAAAELVGPG
                     RNIYRLALHPEGLAPRIRNLAEWARHILARLGHLEELHAELVGYVPELERCAGLLGFA
                     VPLRLQSSYGELNLMTTVTTFATAVDVTLSELKLEAFLPADPATAGALTAAARAAASA
                     EAGQAPGNM"
     misc_feature    42823..>42999
                     /locus_tag="Sfla_0043"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    42832..42999
                     /locus_tag="Sfla_0043"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(42841..42843,42853..42855,42928..42930)
                     /locus_tag="Sfla_0043"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(42850..42852,42925..42927)
                     /locus_tag="Sfla_0043"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(42871..42876,42907..42909,42916..42918,42928..42933)
                     /locus_tag="Sfla_0043"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(43578..44000)
                     /locus_tag="Sfla_0044"
                     /db_xref="GeneID:11369370"
     CDS             complement(43578..44000)
                     /locus_tag="Sfla_0044"
                     /inference="similar to AA sequence:KEGG:Sros_0084"
                     /note="KEGG: sro:Sros_0084 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921037.1"
                     /db_xref="GI:357409301"
                     /db_xref="GeneID:11369370"
                     /translation="MIEIDPQYLAHRYMAQWTVADGVERRVAIEQLWSEDATHTLQPP
                     AEIREIAAQLGFANTTLEAQGYDAIETRVARSYERFVETGGLTFRARADAVRLHGVVK
                     FGWETVSTETGDVVGGGMEILVLDDDGRIKADYMFPGA"
     gene            complement(44667..44999)
                     /locus_tag="Sfla_0045"
                     /db_xref="GeneID:11369371"
     CDS             complement(44667..44999)
                     /locus_tag="Sfla_0045"
                     /inference="similar to AA sequence:KEGG:slr1856"
                     /note="KEGG: syn:slr1856 anti-sigma B factor antagonist"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921038.1"
                     /db_xref="GI:357409302"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="GeneID:11369371"
                     /translation="MHVTTLIDATTAWIIPDGEIDQGALPKLHAVLEALPQDVTELVW
                     DLQSTPFMDMAGLHLLVDPQPPTHPRHITVTGMHPQPLHLLHTAAQVFPTLGFTELLP
                     DARAHEAA"
     misc_feature    complement(<44817..44993)
                     /locus_tag="Sfla_0045"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain found in the C-terminal region of
                     sulphate transporters as well as in bacterial and archaeal
                     proteins involved in the regulation of sigma factors;
                     Region: STAS; cl00604"
                     /db_xref="CDD:260524"
     gene            complement(45785..47125)
                     /locus_tag="Sfla_0046"
                     /pseudo
                     /db_xref="GeneID:11369372"
     gene            complement(47487..47710)
                     /locus_tag="Sfla_0047"
                     /pseudo
                     /db_xref="GeneID:11369373"
     gene            complement(47717..47914)
                     /locus_tag="Sfla_0048"
                     /pseudo
                     /db_xref="GeneID:11369374"
     gene            48194..49543
                     /locus_tag="Sfla_0049"
                     /db_xref="GeneID:11369375"
     CDS             48194..49543
                     /locus_tag="Sfla_0049"
                     /inference="similar to AA sequence:KEGG:SAV_6206"
                     /note="KEGG: sma:SAV_6206 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921039.1"
                     /db_xref="GI:357409303"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="GeneID:11369375"
                     /translation="MSEGALGARLSAAIGRGDADAVRGLLECGADPNTAFVDGLSAMC
                     AAISAFDTEVVSALVEGAADPSLVQPDGSTPLERAVDAGSPEAVMALLSDDVVLRLST
                     AAREGLLDSARRWYSNGVVEELRRLTGACGPVGSVRMPDDGYNYVDQVSSGGRTVRAG
                     HGSILTALEWSFRVPTPVDAIIDRAVRTDEDHVDWWTACWTLSRQRNQETWSAVVAHR
                     FHPDRAHRRFVTLYLQLLNWAVGETPFRSQESGDLLAVWALEEADGAVLARVLDTYTD
                     HEHPLLESVGLQLCSHPDPRVREQVPYALVEEFVVASAAARAALAALVHDPVPEVRMA
                     ACRVGRRYSGLLPDITLSLLALATDPDPSVRLAAAEQLALSSDRSATVADTLADLLDE
                     EDQLIRLEAAYGLVLRDDPRTAEAIDRVGELGPGFEHDHRASALWAWRWQRNRPTAR"
     misc_feature    48221..48472
                     /locus_tag="Sfla_0049"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:257303"
     misc_feature    <48221..48469
                     /locus_tag="Sfla_0049"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    49256..>49444
                     /locus_tag="Sfla_0049"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            complement(49804..51216)
                     /locus_tag="Sfla_0050"
                     /db_xref="GeneID:11369376"
     CDS             complement(49804..51216)
                     /locus_tag="Sfla_0050"
                     /inference="protein motif:PFAM:PF00067"
                     /note="PFAM: cytochrome P450;
                     KEGG: sgr:SGR_410  cytochrome P450"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004921040.1"
                     /db_xref="GI:357409304"
                     /db_xref="GO:0004497"
                     /db_xref="GO:0005506"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0020037"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017973"
                     /db_xref="GeneID:11369376"
                     /translation="MDRTEKLMNVDRSACHGQPPVPPGPGTLAHSRALRFWLDPANLD
                     QAGPVVRTRTGPATAYQVNDPALLRKVGSDENTFRFWGPDPSLRDFTENGVVGIEGAA
                     HRERRTVMRPAFTASRLTALGPEVQARTLSLLADLPADRPLDMRVEMSRLACGLLVSC
                     ILNSELAPGTLSKIAAARSTLSGGIFWRYALAPWPWVPVPRRRASSRALTELDEAVHE
                     VRDRHRPDPDGQDLVSLLEAAAPGNPHVVLRDIRALLIAGMETSASTLSWACYELGRY
                     PHYQQALQDEADAAPDTSRLQADQLPLATAFVQEVTRLHGIPFLVRRTRHETCQGGVR
                     IPAGAVVTLPLGALRRDRNRYPDPDVFDPQRWLPNAEPPSAPAALLAYGLGPRYCPGA
                     AAADAMLPVALATLASSRTLRPARPGRRIGVSLELTPTPKGLTMYATPREPRTADTRP
                     TPGANIDSRSGVVSTTDAQA"
     misc_feature    complement(49951..51189)
                     /locus_tag="Sfla_0050"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(51336..51755)
                     /locus_tag="Sfla_0051"
                     /db_xref="GeneID:11369377"
     CDS             complement(51336..51755)
                     /locus_tag="Sfla_0051"
                     /inference="similar to AA sequence:KEGG:Adeh_3557"
                     /note="KEGG: ade:Adeh_3557 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921041.1"
                     /db_xref="GI:357409305"
                     /db_xref="GeneID:11369377"
                     /translation="MERDALSVTAAASGGAAGLIALNTAYPTFAQAVMTQVLTQGGHT
                     VVTAVVGKVAGKGGGKMAAKLTKPLLQMKAHATALKFSLMLGSKAVTGIVPFLGAVAG
                     GAINAHFVNKFADAAETYYRAKLAYPGGPAGDVRVPV"
     gene            complement(51737..52069)
                     /locus_tag="Sfla_0052"
                     /db_xref="GeneID:11369378"
     CDS             complement(51737..52069)
                     /locus_tag="Sfla_0052"
                     /inference="similar to AA sequence:KEGG:Mpe_A0979"
                     /note="KEGG: mpt:Mpe_A0979 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921042.1"
                     /db_xref="GI:357409306"
                     /db_xref="GeneID:11369378"
                     /translation="MAADITAEMFLKAFNSVGGDSSAAARAVTNYKTLSGWRASQIAQ
                     AAAAGAAAMAIPVAHIATLAADFAVLLRKMAVCAWGIGHKLCAVVEAEEDLAIILGLW
                     SGRWNGTP"
     gene            52276..52464
                     /locus_tag="Sfla_0053"
                     /db_xref="GeneID:11369379"
     CDS             52276..52464
                     /locus_tag="Sfla_0053"
                     /inference="similar to AA sequence:KEGG:Msil_0720"
                     /note="KEGG: msl:Msil_0720 rhomboid family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="YP_004921043.1"
                     /db_xref="GI:357409307"
                     /db_xref="GeneID:11369379"
                     /translation="MDLFHLSDALLSHLTDLVPYVQFVAAAGGAVAAVRRAARAGRRR
                     LNARRAPNTGTSRPTVAD"
     gene            52528..55070
                     /locus_tag="Sfla_0054"
                     /pseudo
                     /db_xref="GeneID:11369380"
     gene            complement(55140..55333)
                     /locus_tag="Sfla_0055"
                     /pseudo
                     /db_xref="GeneID:11369381"
     gene            complement(55492..56715)
                     /locus_tag="Sfla_0056"
                     /db_xref="GeneID:11369382"
     CDS             complement(55492..56715)
                     /locus_tag="Sfla_0056"
                     /inference="similar to AA sequence:KEGG:AMED_1429"
                     /note="KEGG: amd:AMED_1429 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921044.1"
                     /db_xref="GI:357409308"
                     /db_xref="GeneID:11369382"
                     /translation="MNYEYEMSYALPDSVEGLLQRGRGLGAVRALRAPRESAAFVYDG
                     IRRDWLWDQSDERSVYLARLVCDLDLSPMPVVNMLAGDEEACLRACGVLELLALAGSV
                     EAKDGLRAYVRKGEHWVRVLERMSVGWPPEWWEDLGDVARVRMSAEAELPWHSEPWTR
                     FGIAVQSQPLVPRPSLNGLSTAELLRLLSGSHTGDHTKIDALRALNARKPAEELIPLV
                     PWLGMSNDLRPLPMLGRAVRRLGTLAVPAAHSWAQAERPWLALLGTEILADHPGPEAL
                     PGLVNELAEQWAAQDWCGPGQTARRLARFGPDAAGAVPYLRRFWLHTPHSYERTAYLQ
                     ALAAISGDDGLEHIYTESLWDCQKTTRLLGITSAPTIPETLDRLAVLRDDPMETTEVR
                     AAAGTRLAAPDGRLS"
     gene            56790..56924
                     /locus_tag="Sfla_0057"
                     /pseudo
                     /db_xref="GeneID:11369383"
     gene            complement(57162..58904)
                     /locus_tag="Sfla_0058"
                     /db_xref="GeneID:11369384"
     CDS             complement(57162..58904)
                     /locus_tag="Sfla_0058"
                     /inference="protein motif:PRIAM:3.2.1.8"
                     /note="PFAM: glycoside hydrolase 10;
                     KEGG: amd:AMED_5064 glycosyl hydrolase/beta-1,4-xylanase;
                     SMART: glycoside hydrolase 10"
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,4-beta-xylanase"
                     /protein_id="YP_004921045.1"
                     /db_xref="GI:357409309"
                     /db_xref="InterPro:IPR001000"
                     /db_xref="GeneID:11369384"
                     /translation="MDLGRGTWRRLTAVALVMAVAAGCTRQGESAGGGNDEDLLRNHD
                     WTRMPGTIARNDILRISALDRHIVEQDSSGGQPNPPLNLAGPHLRSDGDFTVTARMSG
                     VGDGGGDSWLRLYGQVPVIYDEWRQERPSLRVGVTAGGRVKVQIWDGEGDEPVTSKEF
                     DCGCSGTVTVAVSSIGDTFRLKADGRRLGTVQDPGVFAEGTVWFGLEADASTHERREG
                     WRLTQLIARAESGDSLRVIKAPQLRQEQSDDSLRARAAEVGRPFDVGTALAENPLLTD
                     SRYRSLAGSQFSMLTPENAFKPQFLHPRRGVYDFRDADLLVRFARANDMKVHAHTLVW
                     HEALPDWMRENDDPEEVRRTMLRHIATVAGHFKGKVAEWDVVNEPMSDDEKSYTNGDL
                     GLRSEQSPWFEAMGEEYIDEAFRAAHRADPQARLFLNEYGVEEEGERWDALYDLVTRL
                     KERGVPIDGVGFQNHEYAPGDRIDPETFRSHVRDLAELGVQARVSEMDVPVGEDEEDG
                     RQIQADEMAGKLRVCLEEPNCTSFSTWGFTDRYGSTADTKIYPPRTADSLPWDAALRP
                     KPAYERLLDAFDEA"
     misc_feature    complement(57174..58157)
                     /locus_tag="Sfla_0058"
                     /note="Glycosyl hydrolase family 10; Region:
                     Glyco_hydro_10; pfam00331"
                     /db_xref="CDD:249776"
     gene            complement(59406..60488)
                     /locus_tag="Sfla_0059"
                     /db_xref="GeneID:11369385"
     CDS             complement(59406..60488)
                     /locus_tag="Sfla_0059"
                     /inference="protein motif:PFAM:PF01266"
                     /note="KEGG: sgr:SGR_6332  oxidoreductase;
                     manually curated;
                     PFAM: FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004921046.1"
                     /db_xref="GI:357409310"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:11369385"
                     /translation="MNYSRTRELDVVVIGAGQAGLSAAYHLRRIGLLPGENFVVLDHA
                     PRPGGAWQFRWPSLTYGKVHGMHSLPGMELTGADDDRPSSEVIGAYFEAYERRFDLQV
                     HRPVEVSAVREGQEGRLLVETSKGTYASRALISATGTWDRPFWPRYPGQETFKGRQLH
                     TADYPGPEEFAGLKVVVVGGGASGTQHLMEIAEVAAETYWVTRRPPVFREGPFGMKQG
                     RAAVAMVEERVRRGLPPQSVVSVTGLPLNDAVRRAREQGVLDRLPMFERITPCGVAWA
                     DGRSVEADVILWATGFRAAVDHLAPLRLREPGGGIRVEDTRAVRDGRVHLVGYGPSAS
                     TIGANRAGRAAARSVSRLLESHGVPA"
     misc_feature    complement(59544..60461)
                     /locus_tag="Sfla_0059"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox_2; pfam07992"
                     /db_xref="CDD:254568"
     misc_feature    complement(59871..60455)
                     /locus_tag="Sfla_0059"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            60574..60996
                     /locus_tag="Sfla_0060"
                     /db_xref="GeneID:11369386"
     CDS             60574..60996
                     /locus_tag="Sfla_0060"
                     /inference="protein motif:PFAM:PF01894"
                     /note="PFAM: protein of unknown function UPF0047;
                     KEGG: sco:SCO1141 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921047.1"
                     /db_xref="GI:357409311"
                     /db_xref="InterPro:IPR001602"
                     /db_xref="GeneID:11369386"
                     /translation="MPDTFTTHVLNVTTGRTETVLDLTDDCTQFLARASHGRDGLLNI
                     FVPHATAGIAILETGAGSDDDLLTALQTLLPADDRWRHRHGTPGHGRDHVLPALVPPH
                     ATLPVLRGRLELGTWQSVCLVDTNVDNRDRQVRLSFLG"
     misc_feature    60592..60993
                     /locus_tag="Sfla_0060"
                     /note="Uncharacterized protein family UPF0047; Region:
                     UPF0047; cl00439"
                     /db_xref="CDD:260424"
     gene            complement(61044..61784)
                     /locus_tag="Sfla_0061"
                     /db_xref="GeneID:11369387"
     CDS             complement(61044..61784)
                     /locus_tag="Sfla_0061"
                     /inference="protein motif:PFAM:PF09995"
                     /note="PFAM: Protein of unknown function DUF2236;
                     KEGG: sma:SAV_1062 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921048.1"
                     /db_xref="GI:357409312"
                     /db_xref="InterPro:IPR018713"
                     /db_xref="GeneID:11369387"
                     /translation="MRRRSRGICEGDAPIAAATETVTVTAAGDGRGARSASVAETRSA
                     CSRCAVCTETAPFRRRTVGAASAVSPPRGHSRGVRPSGLRGDLRGQLQRTSTFLTNTM
                     RGTADSAWSARERVRAGHVRNHGVTDEGVPYRLTPPCAHRVPPSGRRCHDEAPLLSRG
                     PPRRRPTFIPPIRSLSRPPRPISWERDSCLDGDVIQPPRSRPGRGTSADRRAKGSHDA
                     LAAKAVPASAPGCGGHGAMTMRQGPGRT"
     misc_feature    complement(<61359..61544)
                     /locus_tag="Sfla_0061"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2236); Region: DUF2236; cl01472"
                     /db_xref="CDD:260952"
     gene            63260..64144
                     /locus_tag="Sfla_0062"
                     /db_xref="GeneID:11369388"
     CDS             63260..64144
                     /locus_tag="Sfla_0062"
                     /inference="similar to AA sequence:KEGG:FRAAL5032"
                     /note="KEGG: fal:FRAAL5032 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921049.1"
                     /db_xref="GI:357409313"
                     /db_xref="GeneID:11369388"
                     /translation="MTTGEAHVDKSRWPKDVPDSGLTKGLALPLESYMVPYSDQVVID
                     SALRDLQTECMSTYGFTVNLPRPGVHPPASSNSMNIERRYGITDRAEAEKYGYLLSPE
                     QQKYTAQQAPDLPGIQVEVLTGHTRPEPVEAPVGSDVGYSGVGENTKPARAEYKGRKL
                     HKDGCAGWSKRQLELNESDAGFVTQLASTGLSETRPHKSVEQAVKRWSACMKDKGRKA
                     SDPYRAMEQGLVETDTQDSIALALDDIDCKEQTRLIEVWFKEESAVQKRLIKENKDQL
                     DVVKTRTRDVLTAAKAVK"
     gene            64209..68672
                     /locus_tag="Sfla_0063"
                     /db_xref="GeneID:11369389"
     CDS             64209..68672
                     /locus_tag="Sfla_0063"
                     /inference="similar to AA sequence:KEGG:Svir_33340"
                     /note="KEGG: svi:Svir_33340 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921050.1"
                     /db_xref="GI:357409314"
                     /db_xref="GeneID:11369389"
                     /translation="MVATALAIPLGLPAQAEEPKPPADAAQGWSDATRSQEEFSPEPS
                     AIPVKDRVRILGEDYEKSSDTAVTTSGDGTGFHVLAGKEEDGYQLRTVASLFEDGFAS
                     DTWIGNHCVTGSGRYAAVSYAPRMFTNKPELMVRGAFTAVVDLESGKVTKLPFQSSLA
                     YFSPGCGQGDQAVFTQLTHDGDEKQQTRLISVDAATGKQRQPVTLAGQVTSAIPTAEG
                     IVAAHGNKVVRINGRTEKPLATTRAVPFQITADAEGGITYIDRELDKDASRTPTSWAE
                     HLAPTAVARGKEAEPVTVATGRLNAWDLTRSARGEVFVTGNATSKTLPARIHNPGKLP
                     TGAAISSNAQAALTTTWSDGKTTLVNPEDAAKPRPARTTLRMLDSGTSVTLDLRPGVN
                     RVSKVSEGHALSPALPGGGPLASGPYGSEATGQAGEDKAGEGISTQSFRTQALTAQSD
                     SPSEGTGERYCAVARNDAKKQAFQPTPRQVEWAVNQAVVGELNFYRSSNWKNTGTGGY
                     QPQGLFPATVLAGDPNGTLDNEDPDVTDKWHIPAQVMLGITAQESNMWQATRFAVPGV
                     TSNSLIGNYYGVDYAPDGEQLDPWKINWADADCGYGITQATDGMRLAGKTKPGETALS
                     TLAQEAVALDYTANVAAGVRILSEKWNQTYSAGMKINGGHPKWIENWFFALWAYNSGF
                     YDSVDSAGHWGVGWTNNPANPLWKANRVPFLQSATNNAGDDYSHAAHPQDWPYQEKVI
                     GWAARPISAMFAPGDFQAGYRPAWWTTNGDRANAKPPVDLFCDSSNSCVSSKIGDNDS
                     NDPGMGACSLDAGNSDTNPHWLHCWWHEEITKEQWKDCERLAECGNGVHRFSTSYGEQ
                     ADAGSYPPNCSIGSLPTNALVVDDLPDGVTPAGVDTARGCGAVKSSGTFNFTFVPWDT
                     KMDLTDDDTDNPTTVTTYPGKIDTHQIGAGYGNHFWFAHTRSPESYPANANRMKVTGA
                     WKLNAPLTNTTRQAKVFAHIPDHGAQTSNAVYRIQTVDGEEEVSVSQTANESNKWVDL
                     GAYDFGDQAPEVRLDNFNGGDGSADIAFDAVAFVPGTYNGQKMTGNMTVDLTAPDPAP
                     VEPGDEIAEDFYPGVALLSSGAASPTPKAARSSASCSIVSVSITRKRTNACIHDEVTT
                     TFFTDGAPSGRSYFDYYNTIYLDARSDEFSQVTTMVLKSMTGALNTVTMDYQAKCRGY
                     CTVTSVNWSGSKVFAKGDTVVRTITTRFKWTPSAGTTKNVITPYWTFGGSGNGVPMPV
                     PTEVEKSKLDIRCDNSITNAGTGCVFPGYTPTYVMNSKKFPGAAAHIDLMWRKTKINW
                     GNHNGGKPLTYLGNKMATDDPTKTQQARNRQLICERRWKTYKDTGLFSDMWSADAGKP
                     ITDKKSCDEFTFANSLQSGGNVNGPNPVSYSGAECVQTYLRRNPDDSMSLNLRPDAPA
                     PTWKEPCGRSSMSNWVNTQSMQPFGTFISNERLMEDDDYWLDLDGFTAPTP"
     gene            complement(68876..69445)
                     /locus_tag="Sfla_0064"
                     /db_xref="GeneID:11369390"
     CDS             complement(68876..69445)
                     /locus_tag="Sfla_0064"
                     /inference="protein motif:SMART:SM00860"
                     /note="SMART: Cell wall assembly/cell proliferation
                     coordinating protein, KNR4-like;
                     KEGG: sro:Sros_2654 beta-1 3-glucan synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cell wall assembly/cell proliferation
                     coordinating protein, KNR4-like protein"
                     /protein_id="YP_004921051.1"
                     /db_xref="GI:357409315"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="GeneID:11369390"
                     /translation="MTIEESWSRVMGLLEQHAPGDHADLPGPATENMLVAAEERMGVV
                     LPQDLRAWLLQNNLDLPEEDVDEDVECSGYAGFPDEGSFFLGIRSIESLYTNRSRPGG
                     FDPPDQPDNPFWRNEWIPFLSDQDGWAGKFIDTRDGRIGRWFVGEITVTGEYESLAQY
                     FDSLAEMLTKIADGDHPVCKVDEGRLLWL"
     misc_feature    complement(68942..69364)
                     /locus_tag="Sfla_0064"
                     /note="SMI1 / KNR4 family; Region: SMI1_KNR4; smart00860"
                     /db_xref="CDD:214864"
     gene            70117..71007
                     /locus_tag="Sfla_0065"
                     /db_xref="GeneID:11369391"
     CDS             70117..71007
                     /locus_tag="Sfla_0065"
                     /inference="similar to AA sequence:KEGG:Avi_2331"
                     /note="KEGG: avi:Avi_2331 bacteriophage tail fiber
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921052.1"
                     /db_xref="GI:357409316"
                     /db_xref="GeneID:11369391"
                     /translation="MVRRTGGREHLRRVSERRRPVFSEPEVQRTSARTVLMAAVLTGV
                     SAVVVSLITGLGSSLQGLVADTLFGEDKPAATARPVSKASSAVAVAVLPGESSAFLVS
                     GQRVSEADRAVLTGPYDQAALGRLFRKAGAVSLIKTAYKLSVTNTSSSPVTVVDIVPV
                     ITRRTPALDATMIEPLGGVAEDTIPAELDLGERNPGFTQEGKPYFTGKSQVLEPGDGF
                     VMAVESKLLSKEYVEYQLRVDYIDGKGKKQSLQVNEDPDVVHPVFRVSGPIDDDAEYT
                     DHWRPAESGRAWTLTVPAGD"
     gene            complement(71080..71458)
                     /locus_tag="Sfla_0066"
                     /pseudo
                     /db_xref="GeneID:11369392"
     gene            complement(71488..71907)
                     /locus_tag="Sfla_0067"
                     /db_xref="GeneID:11369393"
     CDS             complement(71488..71907)
                     /locus_tag="Sfla_0067"
                     /inference="similar to AA sequence:KEGG:SAV_4000"
                     /note="KEGG: sma:SAV_4000 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921053.1"
                     /db_xref="GI:357409317"
                     /db_xref="GeneID:11369393"
                     /translation="MTRALRCAGITFAALATLTACGGRPEPCPALDLIPRVGVSWRAE
                     SLPYDAATTYRLCAAQDCTTGALQAYGDQAHVSLDLPESFDDRTPQVTLRLSDDSGTP
                     VLNAARTVTLQQAEDGCEQALTGTLQLTADGELKDVR"
     gene            complement(71904..72026)
                     /locus_tag="Sfla_0068"
                     /db_xref="GeneID:11369394"
     CDS             complement(71904..72026)
                     /locus_tag="Sfla_0068"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921054.1"
                     /db_xref="GI:357409318"
                     /db_xref="GeneID:11369394"
                     /translation="MLTRRVRNRWIACSKAEDREILCTDIKPAEDALPGLVKKR"
     gene            complement(72217..73167)
                     /locus_tag="Sfla_0069"
                     /db_xref="GeneID:11369395"
     CDS             complement(72217..73167)
                     /locus_tag="Sfla_0069"
                     /inference="protein motif:PFAM:PF07398"
                     /note="PFAM: protein of unknown function DUF1503;
                     KEGG: sma:SAV_3579 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921055.1"
                     /db_xref="GI:357409319"
                     /db_xref="InterPro:IPR010872"
                     /db_xref="InterPro:IPR017517"
                     /db_xref="GeneID:11369395"
                     /translation="MKNGQAVHQGSGAGRQRVAAVGGEDVRSGEPTATVKSAVPSPEH
                     GGRTTGVEKNLDFPDLLRLIDERSTAFRAVVAAAPGLDAQVPTCPGWTLFDLVKHLGG
                     GDRFWAAIVGAGSADAPPAEAVAARAALEVPREREALIAWLDASTQLLLGALRAAGPE
                     SGCWTWWPASQSPQTAGGTARHRVQETAVHTYDAQLAGGVPQPLPVELALDGVEEFLF
                     TVCATPSAWPHKPTAFDFHSVEGRSWRLTVDGDGARITRIPTPAAATGEDSDVAGASV
                     HGTASELVLYLYDRIQADSLHVDGDVGLLDLLRAWEPEEK"
     misc_feature    complement(72586..72987)
                     /locus_tag="Sfla_0069"
                     /note="Mycothiol maleylpyruvate isomerase N-terminal
                     domain; Region: MDMPI_N; pfam11716"
                     /db_xref="CDD:256569"
     misc_feature    complement(72400..72981)
                     /locus_tag="Sfla_0069"
                     /note="uncharacterized Actinobacterial protein TIGR03083;
                     Region: TIGR03083"
                     /db_xref="CDD:234103"
     gene            complement(73232..73858)
                     /locus_tag="Sfla_0070"
                     /db_xref="GeneID:11369396"
     CDS             complement(73232..73858)
                     /locus_tag="Sfla_0070"
                     /inference="similar to AA sequence:KEGG:SAV_823"
                     /note="KEGG: sma:SAV_823 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921056.1"
                     /db_xref="GI:357409320"
                     /db_xref="GeneID:11369396"
                     /translation="MRDGIRWLVDLEHWMSSVVFARGISAQEPAVRMGGDRDAATEPI
                     TDAEAWGLGEWYRPGEHGDGVVRVGEQEGWAFALEYGDSTGGDRLAEISQKGIEAVHY
                     VPMQEHPPATVFHARDGVEVCGFGLREEVWRWGREPDLLLPDLISGHVLQPDGKTRGA
                     PETEHYTDAYRRTLGVIEQRFGLSLSPAYLKEARLPAYAVRGTPDMHV"
     gene            74140..75126
                     /locus_tag="Sfla_0071"
                     /db_xref="GeneID:11369397"
     CDS             74140..75126
                     /locus_tag="Sfla_0071"
                     /inference="protein motif:PFAM:PF00532"
                     /note="KEGG: cai:Caci_4409 LacI family transcriptional
                     regulator;
                     PFAM: periplasmic binding protein/LacI transcriptional
                     regulator; regulatory protein LacI;
                     SMART: regulatory protein LacI"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_004921057.1"
                     /db_xref="GI:357409321"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:11369397"
                     /translation="MADVAQAAGVSSATVSYVISGKRPVAEHTRRVVEKAIADLGFSV
                     NTVARSLRTGRSSIVALVVPDLSNPFFAQLAASLQEELRVLGLHVMVCDTKADREEER
                     AFLREAVQQRFAGVVITPFRLVAKDFLVLSEAGIPAVVSADLPFGDNDLVTPDARAAI
                     RAALTEVTEAGRRHIAMVAGPRDATGGDPRLNLLRSLAAQFGTALPGRLVVRGEHTRE
                     AGAVGFERLMRIRPRPDAVFCANDVVAIGAMDKAEELGIDIPGDVALIGHDDASFASL
                     VRPRLTTVRYPAADVGKAAARLLIERLDGRSVRRTVHVKAEFISRGTVRTGP"
     misc_feature    74140..75114
                     /locus_tag="Sfla_0071"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    74143..74298
                     /locus_tag="Sfla_0071"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(74143..74145,74167..74181,74185..74190,74197..74199,
                     74212..74217,74224..74226,74263..74265,74272..74274,
                     74281..74286,74290..74295)
                     /locus_tag="Sfla_0071"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    74263..74292
                     /locus_tag="Sfla_0071"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    74311..75081
                     /locus_tag="Sfla_0071"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    order(74311..74313,74350..74358,74365..74370,74374..74379,
                     74398..74412,74416..74418,74449..74451,74458..74460,
                     74467..74475,74791..74793,74875..74877,74887..74889,
                     74896..74901)
                     /locus_tag="Sfla_0071"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107262"
     misc_feature    order(74347..74352,74359..74361,74494..74496,74560..74562,
                     74599..74601,74707..74709,74782..74784,74944..74946,
                     74995..74997)
                     /locus_tag="Sfla_0071"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     gene            75467..76834
                     /locus_tag="Sfla_0072"
                     /db_xref="GeneID:11369398"
     CDS             75467..76834
                     /locus_tag="Sfla_0072"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: amd:AMED_4087 periplasmic substrate-binding
                     component of ABC-type sugar transport system"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_004921058.1"
                     /db_xref="GI:357409322"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:11369398"
                     /translation="MAVHKRVSIVRRGLIGGMALTLTALTACGGGGSEDGAGSAAGAA
                     CEPSSGKVTLDYWSWVPGMQKAVDVWNGENPDIQVTLKTTPSGNAGTYQNLSNALKAD
                     KAPDLGQIEYDSLASFRLKGGLTDIAKCAGVTEAEPKFVDWTWSQVDFGADGKDGVWA
                     VPQDTGPMALFYRKDIFDKLGLTAPTTWEEYAADARKIKSAKKGQYITHFSQTDPNWF
                     TGLLWQNKATMFERDGENWKVSVDRPESRQVADYWQKLIDEKLVATDLQGFSPALYKA
                     WNDDEVVTWISAAWGYSTIRDNAKSTAGKWAVAPMPQWEKGRKQAGNWGGSTTAVLAG
                     SKHPAEAAKFALWLNSDAKALEILNREGGLYPAAKDGLTMPALQQPVDFYGKQEIFDV
                     FAEASADVDTEFTWGPTMTDTYRFLSDGTAKATGGGSTLGDVLKDTDAQSADSLRKQS
                     LKVTD"
     misc_feature    75608..76813
                     /locus_tag="Sfla_0072"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    75650..76522
                     /locus_tag="Sfla_0072"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            76899..77825
                     /locus_tag="Sfla_0073"
                     /db_xref="GeneID:11369399"
     CDS             76899..77825
                     /locus_tag="Sfla_0073"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: scb:SCAB_87481  integral membrane transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_004921059.1"
                     /db_xref="GI:357409323"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11369399"
                     /translation="MTPTRTVASSRTPVTAAPRRRHTAPLAFLAPFLIPFVLFTLVPV
                     GYAFWQSLHKTERTGGTFGRTETVFAGFQQYADVMSEPFFMESLLRVALFALVQIPVM
                     IALALTLALLLDSAVARLKRFFRLVYFVPYGIPGVVAALMWAFLYDPRLSPVVDVLRS
                     VHLDVDLLGPDAILWSIGNVVTWTYTGYNMLIMYAALQAVPADLSEAARVDGAGPWTI
                     ALRIKVPVIRPALVLTGVFSLIGTFQLFTEPQVFRAISTSVTSTYTPNLAAYSLAAGD
                     HYSEAAALSVLLAVATFALSFLFLRFTARRQG"
     misc_feature    76971..77816
                     /locus_tag="Sfla_0073"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    77253..77777
                     /locus_tag="Sfla_0073"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(77268..77279,77283..77312,77319..77324,77328..77330,
                     77439..77444,77448..77450,77460..77462,77469..77474,
                     77478..77480,77490..77495,77502..77504,77553..77555,
                     77595..77600,77607..77609,77628..77639,77646..77651,
                     77688..77690,77697..77699,77727..77732,77739..77744,
                     77748..77753,77760..77765,77772..77777)
                     /locus_tag="Sfla_0073"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(77286..77330,77628..77645)
                     /locus_tag="Sfla_0073"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(77328..77330,77424..77426,77646..77648,77682..77684,
                     77697..77699,77727..77729)
                     /locus_tag="Sfla_0073"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(77505..77543,77559..77564,77574..77576)
                     /locus_tag="Sfla_0073"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            77822..78718
                     /locus_tag="Sfla_0074"
                     /db_xref="GeneID:11369400"
     CDS             77822..78718
                     /locus_tag="Sfla_0074"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: jde:Jden_0380 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_004921060.1"
                     /db_xref="GI:357409324"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11369400"
                     /translation="MTLLTRTEGAHAPSPVRPRRAPRLSTVPVFVFMVLVAGYMLLPV
                     YWLLVSATKSQSDLVDTPGLLPAEWHLGDNLSALLTQQDGVYVRWLVNSLAYAGAGAA
                     VGTLLAAMAGYALAVYEFKGREAVFSVILGGVLVPATALALPLFLLFAEVDATNTFWS
                     VFLPSIVSPFGVYLSRIFAAASIPGEVVEAARIDGAGEWTIFRSIALRMMSPALVTVF
                     LFQFVVIWNNFLLPLIMLQDERLYPVTLGLFTWQSQTSRAPELQTLTLVGALVSVVPI
                     VITFLLLQRYWRAGLAAGAVKS"
     misc_feature    77870..78712
                     /locus_tag="Sfla_0074"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    78089..78643
                     /locus_tag="Sfla_0074"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(78137..78142,78149..78154,78167..78169,78197..78208,
                     78212..78235,78236..78238,78242..78244,78317..78322,
                     78326..78328,78332..78334,78341..78346,78350..78352,
                     78362..78367,78374..78376,78425..78427,78467..78472,
                     78479..78481,78500..78511,78518..78523,78560..78565,
                     78593..78598,78605..78610,78614..78619,78626..78631,
                     78638..78643)
                     /locus_tag="Sfla_0074"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(78215..78235,78236..78244,78500..78517)
                     /locus_tag="Sfla_0074"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(78242..78244,78302..78304,78518..78520,78554..78556,
                     78563..78565,78593..78595)
                     /locus_tag="Sfla_0074"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(78377..78415,78431..78436,78446..78448)
                     /locus_tag="Sfla_0074"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            78715..80763
                     /locus_tag="Sfla_0075"
                     /db_xref="GeneID:11369401"
     CDS             78715..80763
                     /locus_tag="Sfla_0075"
                     /inference="protein motif:PRIAM:3.2.1.23"
                     /note="KEGG: mau:Micau_1715 beta-galactosidase;
                     PFAM: Glycoside hydrolase 42 domain protein;
                     Beta-galactosidase trimerisation domain protein;
                     Beta-galactosidase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="YP_004921061.1"
                     /db_xref="GI:357409325"
                     /db_xref="InterPro:IPR003476"
                     /db_xref="InterPro:IPR013529"
                     /db_xref="InterPro:IPR013738"
                     /db_xref="InterPro:IPR013739"
                     /db_xref="GeneID:11369401"
                     /translation="MTDPWYALAERLGGIAYGGDYNPEQWPQDVWQEDVRLMREAGVN
                     LVTVGVFSWSRFEPRPGTYDWNLLDTVLDLLHAHGIAVDLATPTAAPPPWFSKAHPTS
                     LPRTASGTRLTHGSRQAFCPSSPDYARAADAIVTALATRYACHPAVVMWHVHNEWGNH
                     NALCYCDASAAAFRTWLRDRYGTLDELNELWGTDFWGQRYGDWEEIDPPRETTAFRNP
                     GQELDYRRFSSDALLARHRAETALLRELAPGIPVTTNLLGTLEKKIDGHSFARHSDIV
                     SIDHYLVAADPANHIDLALNADLARGMAGGRPWLLMEHSTSAVNWQPVNVPKGPGEMR
                     RNSLTHLARGADGIMFFQWRQSRAGAEKWHSAMLPHGGTAARTWGEVTGLGAEIAGLA
                     EVRGTRVRASVALLFDWHAWWALELEARPSERLRYLDTVRQWYAALWDLGVTCDLVAP
                     DADLASYAAVVAPSLYLVSAANAEALHTYVRGGGHAVFGPFSGAVDAYDRMHPGAHPG
                     AFRDLLGLVVDEYVPLREDESVLLSDGSRTRLWTERVESRGCTVRLRFADGPVPGGPA
                     VTRNSYGDGAGWYAAATLPAPALRGLLDAVCREAGAAPAASVPAGVEAVRRAADDRSY
                     LFLINHTGEDVSVPLDGRTRLDGSVPPGPVVVPAGDVVVLREGGTAEQPARPHREEDR
                     "
     misc_feature    78763..80634
                     /locus_tag="Sfla_0075"
                     /note="Beta-galactosidase [Carbohydrate transport and
                     metabolism]; Region: LacA; COG1874"
                     /db_xref="CDD:224786"
     misc_feature    78772..79887
                     /locus_tag="Sfla_0075"
                     /note="Beta-galactosidase; Region: Glyco_hydro_42;
                     pfam02449"
                     /db_xref="CDD:251301"
     misc_feature    79921..>80268
                     /locus_tag="Sfla_0075"
                     /note="A4 beta-galactosidase middle domain: a type 1
                     glutamine amidotransferase (GATase1)-like domain; Region:
                     A4_beta-galactosidase_middle_domain; cd03143"
                     /db_xref="CDD:153237"
     misc_feature    80545..>80637
                     /locus_tag="Sfla_0075"
                     /note="Beta-galactosidase C-terminal domain; Region:
                     Glyco_hydro_42C; pfam08533"
                     /db_xref="CDD:254860"
     gene            80763..82922
                     /locus_tag="Sfla_0076"
                     /db_xref="GeneID:11369402"
     CDS             80763..82922
                     /locus_tag="Sfla_0076"
                     /inference="protein motif:PRIAM:3.2.1.22"
                     /note="KEGG: sma:SAV_1082 alpha-galactosidase;
                     PFAM: glycoside hydrolase clan GH-D"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_004921062.1"
                     /db_xref="GI:357409326"
                     /db_xref="InterPro:IPR000111"
                     /db_xref="InterPro:IPR002252"
                     /db_xref="GeneID:11369402"
                     /translation="MPHIEIDRPSGTVLLRASDTSYVLRVDTAAGTVRTLHWGASLSL
                     DDARALLEPDPATDSFRSPLDGTEELAVDGQVRFAPPALDVRYGDGTSAVEPVVDGYD
                     VRRDGDSSELSVRLRDHGRPLAWTLHYRVRQDCPVIERWTVFRHTGPGPTEPGEEPAL
                     SLVRHSAAQWNLPVLPAYRMSSVHGQWAGEFQLRRTPLAVGETTVSSRRGHTGHQSNP
                     WLALDAGDATEETGEVWTVALATAGSWRMTAVRSAEGRCGVLGGSGHEGVEITLAPGA
                     SWTTPVSTGLYAPGGFGGASRAYHSYVRRYVLPAPDEPRPVLYNSWEATAFDVTFDGQ
                     RELADLAARVGAELFVVDDGWFGARDSDRAGLGDWTPRPGAFPDGLRPLADHVHGLGM
                     RFGLWVEPEMVNPDSDLFRAHPEWVLHLPDRTAHTLRNQLVLDFSRPEVTDWALTWLL
                     RTVDAFAVDFLKWDFNRSFTEAGSSGRHPDARRVFVGHALGAHEVMDRLRAARPALRI
                     ETCSGGGGRVDLASLARTDQAWTSDNTDAVDRLSIQYGFSQLYPAQVMGAWVTDSPNP
                     ITLRTVPLRFRLHSAMAGALGIGGDLTRWPEAELDETAAYVALYKTVRSTVQTGRQYR
                     LGSPADSYHAVQYVARDSDESVVFQWRAGPEERAVLPRLRLRGLVPEAVYRVDDDSEI
                     TRAGTVRSGAALMAHGLSAQLPQGGYASRMLTLRREG"
     misc_feature    80799..82859
                     /locus_tag="Sfla_0076"
                     /note="Alpha-galactosidase [Carbohydrate transport and
                     metabolism]; Region: GalA; COG3345"
                     /db_xref="CDD:225882"
     misc_feature    81591..82775
                     /locus_tag="Sfla_0076"
                     /note="Melibiase; Region: Melibiase; pfam02065"
                     /db_xref="CDD:251067"
     gene            complement(83019..83327)
                     /locus_tag="Sfla_0077"
                     /db_xref="GeneID:11369403"
     CDS             complement(83019..83327)
                     /locus_tag="Sfla_0077"
                     /inference="similar to AA sequence:KEGG:CC1G_06217"
                     /note="KEGG: cci:CC1G_06217 ATP-dependent DNA helicase
                     recQ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921063.1"
                     /db_xref="GI:357409327"
                     /db_xref="GeneID:11369403"
                     /translation="MSRSVGPHTADPCPRCLVEAVRPGSPMTVEGRDVVGYLCEQCTH
                     VWNRPVEGDLEVHDVVRVDLPGATLYGTVRQVEEDRVQVRVQDGQRLLWAERWRLILY
                     "
     gene            83591..83842
                     /locus_tag="Sfla_0078"
                     /db_xref="GeneID:11369483"
     CDS             83591..83842
                     /locus_tag="Sfla_0078"
                     /inference="protein motif:PFAM:PF03621"
                     /note="PFAM: MbtH domain protein;
                     KEGG: saq:Sare_0352 MbtH domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="balhimycin biosynthetic protein MbtH"
                     /protein_id="YP_004921064.1"
                     /db_xref="GI:357409328"
                     /db_xref="InterPro:IPR005153"
                     /db_xref="GeneID:11369483"
                     /translation="MSDHTESVYRVVLNDEEQYSIWQADRELPAGWRAEGTEGTKQEC
                     LEHIGRVWTDMRPASLRRRMESDAAGAAGGQGGRQSIPV"
     misc_feature    83597..83791
                     /locus_tag="Sfla_0078"
                     /note="MbtH-like protein; Region: MbtH; cl01279"
                     /db_xref="CDD:260868"
     gene            83875..85014
                     /locus_tag="Sfla_0079"
                     /db_xref="GeneID:11369484"
     CDS             83875..85014
                     /locus_tag="Sfla_0079"
                     /inference="protein motif:PFAM:PF00291"
                     /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
                     subunit;
                     KEGG: saq:Sare_0366 cysteine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-5'-phosphate-dependent protein subunit
                     beta"
                     /protein_id="YP_004921065.1"
                     /db_xref="GI:357409329"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0030170"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="GeneID:11369484"
                     /translation="MNSVSQPRYRPAPVARADQEAIPPDATDPSGPAPTAYGADRTGA
                     LSAVGGTPLVELTRLLPGARFRVWAKLESVSPGGSIKDRSAYTMLSHAVATGAVVPGT
                     GTVVESSSGNLGVGMAQMCRAMDLRFICVVDPRTNPQNIAIMRALGAEVHTVDEGDPV
                     TGEFQPVRIARVRELVAAVPGAYWPNQYANPRNAWAHRITMTEIVEDLGQAPDYLFCT
                     ISSSGTLRGCGDLIRDHRLPTRVITVDAEGSAIFRPPTARRLIPGHGAAVRPPLYRGG
                     LADEVVHVSDLDSLVGCRRLALREGLLLGGSSGAVATALERLSGRIPDGSSCVLLMPD
                     RGERYLNTIYDDGWVKAQFGEVTHLWKDEVADVADTSEMTEVAPC"
     misc_feature    84016..84903
                     /locus_tag="Sfla_0079"
                     /note="cysteine synthase; Region: PLN02565"
                     /db_xref="CDD:166206"
     misc_feature    84019..84894
                     /locus_tag="Sfla_0079"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    order(84031..84039,84076..84078,84094..84096,84100..84102,
                     84229..84231,84238..84240,84286..84291,84298..84303,
                     84310..84315,84490..84495,84763..84771,84775..84783,
                     84853..84855,84883..84885,84892..84894)
                     /locus_tag="Sfla_0079"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(84115..84117,84208..84210,84529..84546,84661..84663,
                     84793..84795,84871..84876)
                     /locus_tag="Sfla_0079"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    84115..84117
                     /locus_tag="Sfla_0079"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            85008..86030
                     /locus_tag="Sfla_0080"
                     /db_xref="GeneID:11369485"
     CDS             85008..86030
                     /locus_tag="Sfla_0080"
                     /inference="protein motif:PFAM:PF02423"
                     /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
                     KEGG: saq:Sare_0367 ornithine
                     cyclodeaminase/mu-crystallin"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase/mu-crystallin"
                     /protein_id="YP_004921066.1"
                     /db_xref="GI:357409330"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="GeneID:11369485"
                     /translation="MLTLGNGDVRRLLDGREREVLDAVREAYLRHADEETSLPHSVFL
                     RFPDDTRNRIIGLPAYLGGPEPLAGMKWIASFPGNVADGLERASAAIIVNSMRTGQPV
                     ALVEGSTISARRTAASAALAAASLPAEDGQETGVALIGCGVINFEVLRFLLVVRPELT
                     DVTVFDLDAGRAEEFRERCASEFGGAGRVVRVADSAEEALGTHRLVSLATTATVPHLD
                     LRACRPGTLVLHVSLRDVTVEGVLDAVNVVDDPDHVCRAATSVHLAETRSGSRSFIDS
                     TLGELLRKTDAGHRDPRRITLFSPFGLGVLDLALAGLVLRRARAAGVGTEITGFLPEP
                     RATGSG"
     misc_feature    85008..85997
                     /locus_tag="Sfla_0080"
                     /note="2,3-diaminopropionate biosynthesis protein SbnB;
                     Region: dehyd_SbnB_fam; TIGR03944"
                     /db_xref="CDD:188459"
     misc_feature    85011..85997
                     /locus_tag="Sfla_0080"
                     /note="Shikimate / quinate 5-dehydrogenase; Region:
                     Shikimate_DH; cl19124"
                     /db_xref="CDD:267477"
     gene            86375..86995
                     /locus_tag="Sfla_0081"
                     /db_xref="GeneID:11369486"
     CDS             86375..86995
                     /locus_tag="Sfla_0081"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: saq:Sare_0350 LuxR family transcriptional
                     regulator;
                     PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004921067.1"
                     /db_xref="GI:357409331"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:11369486"
                     /translation="MRNPVRVSVIALDPVLEAGTLSALDGFAEVRPVVGGQRPDVTVV
                     VVDRVAEPVLDLLRRTRAAEHRPEVVLVATELGPVEALHAIATGARGLLRRRETSGPR
                     LAHAVLAAAGGDCAVPPDLLDGLLEQRAEGADPGVADSWGAAGLSERERAVLRLVADG
                     HETSAIADELCYSVRTVTTVLHNVTQRFRLKNRAHAVAYVLRAGLL"
     misc_feature    <86534..86992
                     /locus_tag="Sfla_0081"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    86810..86980
                     /locus_tag="Sfla_0081"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(86813..86821,86858..86866,86888..86893,86897..86902,
                     86906..86920,86951..86953)
                     /locus_tag="Sfla_0081"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(86846..86848,86852..86854,86858..86860,86951..86959,
                     86966..86968,86975..86980)
                     /locus_tag="Sfla_0081"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            86992..87672
                     /locus_tag="Sfla_0082"
                     /db_xref="GeneID:11369487"
     CDS             86992..87672
                     /locus_tag="Sfla_0082"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: ami:Amir_3573 transcriptional regulator, LuxR
                     family;
                     PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004921068.1"
                     /db_xref="GI:357409332"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="GeneID:11369487"
                     /translation="MSPARLPGHHVPGIPASYGPAPVRVHVRAANDGLRRSWHQRLTR
                     AGIPLAEDSQPGPGVVLLAAGRTVDEAVDSCSPPDDPDRRGFLVAAQLVSPDSVLRAV
                     RVGARTILRTADAHPEQLVAAVHSAHHGDGRVPYGVLVRLLGTAQRPVAPAPGVPRAQ
                     QAVAPLTPRQTVVLTLVAEGHGNAVIARALSCSEHTVKNVIYELMARLQVRNRAHAVA
                     RAVRAGLI"
     misc_feature    <87271..87627
                     /locus_tag="Sfla_0082"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    87487..87636
                     /locus_tag="Sfla_0082"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(87490..87498,87535..87543,87565..87570,87574..87579,
                     87583..87597,87628..87630)
                     /locus_tag="Sfla_0082"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(87523..87525,87529..87531,87535..87537,87628..87636)
                     /locus_tag="Sfla_0082"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(87748..88173)
                     /locus_tag="Sfla_0083"
                     /db_xref="GeneID:11369488"
     CDS             complement(87748..88173)
                     /locus_tag="Sfla_0083"
                     /inference="protein motif:TFAM:TIGR00223"
                     /note="TIGRFAM: aspartate 1-decarboxylase;
                     KEGG: tcu:Tcur_4486 aspartate 1-decarboxylase;
                     PFAM: aspartate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="YP_004921069.1"
                     /db_xref="GI:357409333"
                     /db_xref="GO:0004068"
                     /db_xref="InterPro:IPR003190"
                     /db_xref="GeneID:11369488"
                     /translation="MFRTMFKSKIHRATVTQADLHYVGSLTIDEDLMDAADLLPGEQV
                     QIVDITNGARLETYVISGERGSGVIGINGAAARLVQPGDLVIIISYASVADAEAKALV
                     PCVVHVDQHNRQVSLTGSDLAEPVPGSGTVRGDLLRPGN"
     misc_feature    complement(87838..88167)
                     /locus_tag="Sfla_0083"
                     /note="Aspartate alpha-decarboxylase or L-aspartate
                     1-decarboxylase, a pyruvoyl group-dependent  decarboxylase
                     in beta-alanine production; Region: Asp_decarbox; cd06919"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(87871..87873,87898..87906,87916..87918,
                     87940..87945,87949..87954,88000..88014,88018..88020,
                     88027..88029,88033..88035,88045..88050,88057..88059,
                     88063..88065,88105..88116,88138..88143,88147..88149,
                     88153..88167))
                     /locus_tag="Sfla_0083"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(88000..88002,88099..88104,88141..88143,
                     88147..88149))
                     /locus_tag="Sfla_0083"
                     /note="active site"
                     /db_xref="CDD:132994"
     gene            complement(88225..89595)
                     /locus_tag="Sfla_0084"
                     /db_xref="GeneID:11369489"
     CDS             complement(88225..89595)
                     /locus_tag="Sfla_0084"
                     /inference="protein motif:PFAM:PF05977"
                     /note="PFAM: protein of unknown function DUF894 DitE;
                     KEGG: saq:Sare_0365 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921070.1"
                     /db_xref="GI:357409334"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="GeneID:11369489"
                     /translation="MSRVAEDAGVVPAPPPLRRNRDFMLLWSGSAVAIIGSTASTVAY
                     PLLVLAVTGSPSAAGVVGFVVLLPALLFQLPAGVLVDSWNRRRVMIWCDGLRAAGAAT
                     VVLALLAGELRLAHVMVVGFVEGTLTVLNGLASTAAVPNVVHRSQLSAALAGNEARGR
                     AATMIGTPLGGILFGLGRAVPFVLETLAYLVSLATLLGIRKEFQTARPGEPAPAGNGP
                     GGDAATGSRRDRALRQAGRMAEGLTWLWRRPLLRTTALLVAGSNLLFRALFLVMIVLL
                     AEEGAGPAAIGLLIGVAGGCGMLGSLVAGWFGRTLRLNALVIGANWVWALLMCVLAFS
                     GGLWPAAIAYTAMWFVGPIWNVAVGSYQLTVTPDDLRGRVLSASSLLANGALPLGALV
                     GGLLLDAFGVRAAATVLAGWMVLMALAATLARPVRRATMTAINDPAGPAPAESAAVPT
                     TAADSH"
     misc_feature    complement(88324..89529)
                     /locus_tag="Sfla_0084"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(88393..89529)
                     /locus_tag="Sfla_0084"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(88438..88440,88447..88452,88459..88464,
                     88471..88476,88507..88509,88516..88521,88531..88533,
                     88540..88545,88552..88554,88693..88695,88705..88707,
                     88714..88716,88726..88728,88738..88740,88780..88782,
                     88789..88794,88801..88806,88813..88815,89107..89109,
                     89125..89130,89137..89142,89176..89178,89185..89190,
                     89197..89202,89209..89214,89365..89370,89374..89379,
                     89389..89391,89398..89403,89410..89412,89461..89466,
                     89470..89478,89485..89487))
                     /locus_tag="Sfla_0084"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            89891..90811
                     /locus_tag="Sfla_0085"
                     /db_xref="GeneID:11369490"
     CDS             89891..90811
                     /locus_tag="Sfla_0085"
                     /inference="protein motif:PFAM:PF02668"
                     /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
                     KEGG: saq:Sare_0364 taurine catabolism dioxygenase
                     TauD/TfdA"
                     /codon_start=1
                     /transl_table=11
                     /product="taurine catabolism dioxygenase tauD/tfdA"
                     /protein_id="YP_004921071.1"
                     /db_xref="GI:357409335"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="GeneID:11369490"
                     /translation="MTAATGKDSPADQLTAARQEIRARLREHGAVLLRGFGHDGVDGF
                     EQTVRTIGGEPLTYAERSSPRSTIKGQVYTSTDYPPSEEIFLHNENSYQATWPLTLFF
                     SCVTPPDTLGSTPLADTRRVLAAIAPEVREEFAARGWMVVRNFTDGFGVPWQHAFNTE
                     DRAQVEAYCARNGVVAEWTAGGLRTRARREAVHNHPVTGERVWFNHLTFFHVTTLGPD
                     LCAALREMYDEPDLPTNTYYGDGAPVPDEVVSHLRDCYRAEQRRFDWQQGDVLVVDNM
                     LAAHAREPFTGPRKIAVAMAEPSSGPVERG"
     misc_feature    89924..90775
                     /locus_tag="Sfla_0085"
                     /note="Taurine catabolism dioxygenase TauD, TfdA family;
                     Region: TauD; pfam02668"
                     /db_xref="CDD:251459"
     gene            90873..97388
                     /locus_tag="Sfla_0086"
                     /db_xref="GeneID:11369491"
     CDS             90873..97388
                     /locus_tag="Sfla_0086"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: saq:Sare_0363 amino acid adenylation
                     domain-containing protein;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; condensation
                     domain protein; phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921072.1"
                     /db_xref="GI:357409336"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369491"
                     /translation="MAPVDGGYPLSFAQEQLWLLDQLRSGDAAEYLMHETFRIRGPLD
                     TGALTAALTETAARHEVLRTRYADEDGVAVQVIDEPEPVKPEFADLGDVPADRREQSL
                     REFGASWAGTPIDLRRDHSWRVAVVRLAPEDWALLLTFHHIAFDGWSWGLLADELREL
                     YGVFASDRDPTPEPLEPVELQYADYAEWQREWWSAQPELMDQQLRYWRQQLAGAAPLE
                     LPTDRPRPPRWDASGDTVAFTVPASLATRFSALAKEQGTTVFMAGLAAYQLLLARYSG
                     AEDIAVGVSLANRDDARLERLIGLFLNTVVLRTDLGGAPDFRELLSRVKHTTLDAYSH
                     QEVPFERVVAALAPERDAGRNPVFQAGFALHNAHRRPFALPGMRVTRVDGGTRSSAFD
                     LSLHLTERPDGSMGGEFIYPTALFDRDRIERMAENFLHLLDQAVTTPGTPVERLELTA
                     PAERATLTTWGQGTPRPAGEDRSGHGLVRLVLDRAAATPRATAVADDGGHLDYAGLAE
                     RVTQLAGRLHTEGVRPGDPVAVSLHRGPELVTAILAVLAVGGVHVPLAPDLPDVRRDF
                     LLTDSGAELVLTEEALRDLFRDSPRVRALDGEWSAARTAPGGPPETFPYPAGPDDAAC
                     LVYTSGSTGTPKGVVVTHGGLRNRVLWSVEAYAMTAADRLLQKTTIGFDASLWEFLSP
                     LVSGGTVVMAPADAHRDPSVMAAAMARHRVTLLQLVPSVLRLLVQEPALSDCTALRLV
                     SSAGEPLTTELCERLRAVVPGVGISNTYGPTECSIDSTAHRWTGEGLPGSGTVSIGAP
                     LPGVGVSVVDRADVLVPVGVPGELCVRGAGLARGYRGRPGQTAERFGVDPYAAVPGGR
                     WYRTGDLVRWRTDGTLEFLGRTDDQVKIHGVRVEPAEIEALLLTHPGAAASAVVARVG
                     AHGERELTAYAVPSAPGGADARLRAELLAHLAARLPAAVVPSRLVLLDALPLTASGKV
                     DRRALPGPEEAAQPPAATATDRTAPRTATERAVTEAMAAVLEVPEPGPDDDFFALGGH
                     SLLAIRLVLGLRRAFGIEMTVAELFADRTPAALAARIDRAVGAADAAEAAQDRDGAGI
                     VPVPRDGELPLSFGQRRMWFLDRLEPGSEEYLIPLALRLRGPLDTAAFRGALDEVARV
                     HEVLRTRYADRDGDPVQLVDPPGPVAFRLVDLTGTGDGTKDLAARARELLEEALCAPF
                     DLSAEHPLRVSVIRAAPEDHWVALAAHHIAFDAWSTKVFLRDLDTAYTALAAGRPTPL
                     RPGPVQYADFAAWQRGREDGPENGRHLEHWLERLDGLTPVELPSDRPRTATRDAAGDT
                     VVVDVPESVARAVTELANRHGATPFMTLLGAFQVLLHRYTGRTDIAVGVPVAARTREE
                     TEGLLGLFVNSLVIRTDLGGDPAFSGLLARVKEVCLEAFAHQDVPFEQLVEELGTERD
                     LSRNPLFQVMFEHQHMGGLTTTLGGLRAEPLKAGPRTAKFDLTLTVKERPDGRMHCWF
                     EYASALFDRATVERMSAHYLRLLESLTAAPDTAVAALELMPEAERRQLLGSWPDPYAA
                     RLPEIVPEAERDLTVPELFVRQAARTPDATALVFGAEELDYAALEARSARFARRLRAL
                     GAGPETVVASCQERGIDAVVTLLGVLRAGAVYVPLDPRHPRRRLSRTVEDSGARFVVT
                     TTEHADSLTGDGHQVLTVDTLDGAADPAEALPDVPAAPDNLAYMIYTSGSTGRPKGVM
                     IDHRAYAHHCRIAADAYGIGPGERVVQLSSLTFDVSMEQIAAPLLTGAAVVIADPLFW
                     SPAELPARLAEHGVTVMETTPAYYREVMTYDTSVLTGLKLINLSSDVVTVADARQWSA
                     SGLPGRFVCCYGPTEATVTCLLHTGAAGHDGERGTASMPLGRPFAGTGAYVLDARLRP
                     VPVGVPGELCVGGVRLARGYHGRPELTAGQFVPDPFGGAGERLYRTGDLVRYRPDGTL
                     EFLGRIDQQVKVRGLRIELGEIEAALTGHPGVGAAAVTAPEITPGDRQLAAYVTGRDD
                     SPAPDPDVLREYLRERLPDYMVPALWTALDTLPMTSSQKIDRKSLPAPATRTERAFVS
                     PRDPAEETVAAIWAEALGLEQVGAEDDFFALGGHSLLATRVLARIQESFAVDIPLRRL
                     FENTTVATLAAAVTEAVEAAIAQLSDAEVAELLSPEGAR"
     misc_feature    90894..91805
                     /locus_tag="Sfla_0086"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    91590..93578
                     /locus_tag="Sfla_0086"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    91869..92144
                     /locus_tag="Sfla_0086"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    92358..93803
                     /locus_tag="Sfla_0086"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(92745..92747,92754..92771,92775..92780)
                     /locus_tag="Sfla_0086"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(92754..92759,93102..93107,93168..93185,93255..93257,
                     93456..93458,93492..93494,93501..93503,93783..93785)
                     /locus_tag="Sfla_0086"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    93879..94073
                     /locus_tag="Sfla_0086"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    94155..95060
                     /locus_tag="Sfla_0086"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    94845..96836
                     /locus_tag="Sfla_0086"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    95124..95399
                     /locus_tag="Sfla_0086"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    95607..97055
                     /locus_tag="Sfla_0086"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(96006..96008,96015..96032,96036..96041)
                     /locus_tag="Sfla_0086"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(96015..96020,96357..96362,96423..96440,96516..96518,
                     96714..96716,96750..96752,96759..96761,97035..97037)
                     /locus_tag="Sfla_0086"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    97113..97295
                     /locus_tag="Sfla_0086"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            97385..104602
                     /locus_tag="Sfla_0087"
                     /db_xref="GeneID:11369492"
     CDS             97385..104602
                     /locus_tag="Sfla_0087"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: saq:Sare_0362 amino acid adenylation
                     domain-containing protein;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; condensation
                     domain protein; phosphopantetheine-binding; Thioesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921073.1"
                     /db_xref="GI:357409337"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020726"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369492"
                     /translation="MTHQTLDPAALRARLLRQRLRGAAATAPSDGITRAPRGGPLPLS
                     FAQQRLWVLDQLSPGSTAYLMTAALRLSGPLDTGALRGALDALVARHEVLRTRYPVVG
                     GDPVQVIDAPAPVDLAEEDLTGLDPQDRAGRLAALGTSGRQPVDLADGPVVRAVLARC
                     AAEEHTLFVTVHHIAADGWSEDLLVRELTERLRQPAGPEPSAPALQYADFAVWQRARL
                     GEDRLEDGLGYWRRRLAGVAPLELPTDRPRPAVRDDTGAVAPFTVPAEVAARLSRLAR
                     ERGATPFMATLAAFKVLLSRYTGSTDIAVGTPVSGRDRAEAQQMLGLFLNTLVLRTDL
                     SGDPGFGEVLTRLREGALDDYGHQEVPFERLVNALAPERDPSRTPLFSAMFLWEGADG
                     QDSRETGGAGRLAVERLAVGERTAKFDLTLSVTEQPDGSLSGGLNYATALFDAATAAR
                     MASHFTRLLDAAVADPEAPVGGLELMSGPELHEVVHRWNDTAVPFPAGTLHGLFEAQA
                     AATPDAVAVTDEDGTLGYAELNHRADAVAAALRARGAGPGTVTGVCLERSRGLLVALL
                     GVLKAGSAYLPLEPELPLERRQYMLADSGARILLTDTGAGPAGVPEDVTVLPLARGGL
                     LPEGVPGRDGAAPGPGDAAYVIYTSGSTGRPKGVLVEHRAIVNRLHWMQREFGLDATD
                     RVLQKTPMGFDVSVWEFFWPVATGATLVMARPGGHRDPVYLARTIAEESVTTLHFVPS
                     MLRAFLAGPVPALPSLRRVVCSGEALPGDLVTASVNRLGIAPHNLYGPTEAAVDVTST
                     PCVPGQRVTIGKPIANTRAYIVDAALRPVPVGVPGELLLGGVQLARGYLSRAALTADR
                     FVPDPFGGAEGGRLYRTGDLARYLPDGSIDYLGRLDHQVKVRGQRVELGEIEEVLHEH
                     PAVAAAAVTVHEQSLVAYLTGRPGEASPDSGAIRVWLRERLPDAMVPGHWMVLDALPL
                     TASGKTDRKALPAPDRSRDSRAGEYTAPRGPVERAIAEELAVALDLDQVGVHDRFFDL
                     GGDSIRAIRAVGALRGRGLELSVQHLFTHPTVAGLATVATETAGTGQGHQLVAPFVQL
                     DPADRERLPDGLADAYPLGEVQAGMVYELLADPEANTYQNVSSFHFTDDGPFSLPALR
                     ESIRRLVDRHEILRTSFRLSGFSAPLQLVHRQAEAEVGFTDLRGLAPAEQRAAMAKFR
                     TAEQREPFDLERAPLLRYHVHRTGEGTWTLTHTECHAILDGWSHHSVIQEIRADYDRI
                     REDAGCAVTPPPQARYADFIALERQALGSAEDRAFWQGRISGFPRLELPAPTALAESG
                     GPAHEVRVSWAGLDPALRGLAARTGTSLKTVLYTAHLTLLGLISGQRRFFAGAVCNGR
                     PELPDGDEVRGMYLNTVPFAVDLDAPSWEELLRAVFAEEAAVWPHRRYPLPAMQREWG
                     TGTPLVDVVFGYLDFHVLDQSGSAPEAVTDSSPNEFTFDVWTFPGELRMTCRPGWAGR
                     DRLEAMATAFVEVLRAMAERPESAPGAFSAAALARPTVAPAHVPPPPEVTLAELIARH
                     SRPGDVALIDGDSTVTYGELEARANQFAHLLRARGVRAEDPVAVCLERGPETVIALLG
                     VVKAGGCYVPVDPEYPEERIGYMLADSGAGLLVTHAALADRLSGLLTGGIRTVLLDAG
                     RGELETHPHTAPEAGTSPDNTAYLIYTSGSTGRPKGVQITHRNVVRLVHGENHAEIGP
                     RDTVLVVSPLAFDASAFELWGTLANGGRLAFAPPGTPTTAGVAEVLRERRVTVAFLTT
                     SLFHLMVESCPEALTGLRALLAGGDVLSPDRVRTALGHGLRVSNMYGPTECTTFATGQ
                     HALTVEQTDRPLPIGTPIAHTTTLVTDEDLNPVPYGVTGELLLGGPGVARGYLGRPDL
                     TADRFVPDPTGARPGGRLYRTGDLVRQDPDGVLHFLGRRDHQVKVRGHRIELGEVEAG
                     LNRLPGVHEAAAAVRPGPDGDKQLVGYVVPAEHTAFDPSALRTALRQRVPGFLVPSAW
                     VRLDELPLNANGKLERTALPEPGGVDTGGETVAPRTAAERAMAEVWAEVLNLEQVGAH
                     DDFFLLGGHSLLILRAIALLRERHGLELTVRAFVEHHTLDAIAAAAERGETGDASRSA
                     LMWLRKEGGQAPLFCVHPGGGSAHWYQRLVPHLAEDLPVAALEWPGLQSGPGRPVPTA
                     SEMAQRYVTEIRRARPHGPYRLLGWCGGSGITAEMADRLRGDGEEVTFILLDPGLDSH
                     ERQGLWEEFRLIESCTAKLEELAAAGPEEDTGALRDEILRLLNHLVDDADPETGIVLP
                     ERNGAGVWLPSARIWREVMEMTLTYRHRYFPGTLHLIISDELARGEHEVALGQTYEEY
                     LNRWRELNADVEAHRVPGDHFGVMRLPHVTSLAATLAALLD"
     misc_feature    97499..98389
                     /locus_tag="Sfla_0087"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    98171..100129
                     /locus_tag="Sfla_0087"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    98453..98737
                     /locus_tag="Sfla_0087"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    98918..100333
                     /locus_tag="Sfla_0087"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    order(99317..99319,99326..99343,99347..99352)
                     /locus_tag="Sfla_0087"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    order(99326..99331,99671..99676,99734..99751,99806..99808,
                     100007..100009,100043..100045,100052..100054,
                     100313..100315)
                     /locus_tag="Sfla_0087"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    100394..100582
                     /locus_tag="Sfla_0087"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    100694..101590
                     /locus_tag="Sfla_0087"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    102047..103489
                     /locus_tag="Sfla_0087"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS), including Bacillus subtilis
                     termination module Surfactin (SrfA-C); Region:
                     A_NRPS_Srf_like; cd12117"
                     /db_xref="CDD:213325"
     misc_feature    102086..103294
                     /locus_tag="Sfla_0087"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    order(102458..102460,102467..102484,102488..102493)
                     /locus_tag="Sfla_0087"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213325"
     misc_feature    order(102467..102472,102806..102811,102866..102883,
                     102950..102952,103151..103153,103187..103189,
                     103196..103198,103469..103471)
                     /locus_tag="Sfla_0087"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213325"
     misc_feature    103550..103741
                     /locus_tag="Sfla_0087"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    103814..104563
                     /locus_tag="Sfla_0087"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    103817..>104287
                     /locus_tag="Sfla_0087"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(104844..107150)
                     /locus_tag="Sfla_0088"
                     /db_xref="GeneID:11369493"
     CDS             complement(104844..107150)
                     /locus_tag="Sfla_0088"
                     /inference="protein motif:PFAM:PF04737"
                     /note="KEGG: saq:Sare_0360 lantibiotic dehydratase
                     domain-containing protein;
                     manually curated;
                     PFAM: Lantibiotic dehydratase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lantibiotic dehydratase domain-containing
                     protein"
                     /protein_id="YP_004921074.1"
                     /db_xref="GI:357409338"
                     /db_xref="InterPro:IPR006826"
                     /db_xref="InterPro:IPR006827"
                     /db_xref="GeneID:11369493"
                     /translation="MSDDGAPLLGRRWRLWEQFSLRGPGFPVGGVLDLAPVDLSVYAD
                     KFAGGVLSGPDWVEFEGVFGEVAARTAVRLQEVAGSSDFTAAVAWQNRTVLRTGLRPF
                     LGWVPSASNRSSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGRVDRSVGGVEIDAG
                     EGLTESSSVFFSSWSIDALARTLSADDRLMAWIPPRRMPYIRADSDDGPVRIPGRTPQ
                     QAPPRLVALLRLADGRRPPAELARALRMTPAEVTAGLAELVRRRWVTWRLDVPSGPRP
                     DRELRAILERVGDPELRRGALEPLEVLERGRERVEAAGRDAGALCEALAALEEDFTRI
                     TDTASQRAKGTHTAPNRSLVYSDTRRSATARVGSEVLDAMAPLDPLMTSAAWLMARLG
                     ARVEERATEVYEKLAAASGGDRVNLADFWFGCMPILHGAAVTDAQEVLEEFQRRWARI
                     IPVPDGARQVRTTHAAIASQVAEAFPPVPAAWTAARYLSPDVLIVAHDTESVGRGDFE
                     LVLGELHLASNTVGASLFVSQHPEPAELLRITGQDHPGPRLLPLLPKEHKSRLSVRVR
                     NVLVRPEDYYIALLELTADPHRDRTVLSADAHVTRRGDRLVALLPDGGEFAVTDVFGH
                     VLTTLAMDMFRLFPDADHVPRVAVDKLVVSRESWRFTGGDLEFAEEKSEARRYVRARN
                     WRDGRGLPRYVFVVSPTEPRPFYVDFDAPVYVNILAKAARRLARKDPQAKLTVTEMLP
                     SPEHAWLTDDQGNAYTSELRFVAVDQHH"
     misc_feature    complement(<106668..106904)
                     /locus_tag="Sfla_0088"
                     /note="Lantibiotic dehydratase, N terminus; Region:
                     Lant_dehyd_N; pfam04737"
                     /db_xref="CDD:147079"
     misc_feature    complement(104973..106439)
                     /locus_tag="Sfla_0088"
                     /note="Lantibiotic dehydratase, C terminus; Region:
                     Lant_dehyd_C; pfam04738"
                     /db_xref="CDD:252771"
     gene            complement(107143..107439)
                     /locus_tag="Sfla_0089"
                     /pseudo
                     /db_xref="GeneID:11369494"
     gene            complement(107499..108515)
                     /locus_tag="Sfla_0090"
                     /db_xref="GeneID:11369495"
     CDS             complement(107499..108515)
                     /locus_tag="Sfla_0090"
                     /inference="protein motif:PFAM:PF00291"
                     /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
                     subunit;
                     KEGG: ami:Amir_3582 pyridoxal-5'-phosphate-dependent
                     protein beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-5'-phosphate-dependent protein subunit
                     beta"
                     /protein_id="YP_004921075.1"
                     /db_xref="GI:357409339"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0030170"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="GeneID:11369495"
                     /translation="MTAAGTRLGPADVRAAAVRIRGPVRRTPLLAADALPALFGPGQR
                     GLLLKAEHLQHGGSFKARGAANAMLGQDSVTVVAGSSGNHGIAVAALARRIGAEATVV
                     MAAGAGRAKADAIRRLGARVLTVDGGVAARDQRARELAEDTGALLVPSSDDELVVAGQ
                     GTVVLEILEEAPDIDLLFVPVGGGGLLAGSCLAAALAARPPRVIGVEPRQACRYAVSL
                     EAGSPVEVPASQTVADGLRGQRPGEITFPIIQRRVDELVAVEDGEILRAMELLHRAGL
                     PAEPSGSVALAGALRRGFHGRTAVVVSGGNSPSALAAMGVGGAAEAGPAAPPSPVPPL
                     SVLQ"
     misc_feature    complement(107598..108485)
                     /locus_tag="Sfla_0090"
                     /note="Tryptophan synthase beta superfamily (fold type
                     II); this family of pyridoxal phosphate (PLP)-dependent
                     enzymes catalyzes beta-replacement and beta-elimination
                     reactions. This CD corresponds to
                     aminocyclopropane-1-carboxylate deaminase (ACCD),
                     tryptophan...; Region: Trp-synth-beta_II; cl00342"
                     /db_xref="CDD:260370"
     misc_feature    complement(order(107604..107609,107673..107675,
                     107958..107972,108267..108269,108336..108341))
                     /locus_tag="Sfla_0090"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:107202"
     misc_feature    complement(108336..108338)
                     /locus_tag="Sfla_0090"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107202"
     gene            complement(108512..110065)
                     /locus_tag="Sfla_0091"
                     /db_xref="GeneID:11369496"
     CDS             complement(108512..110065)
                     /locus_tag="Sfla_0091"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: saq:Sare_0357 amino acid adenylation
                     domain-containing protein;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921076.1"
                     /db_xref="GI:357409340"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="GeneID:11369496"
                     /translation="MVSFLDTVRAHAVRTPEATALRAPGRTISYRGLDAWIDRLAHVL
                     TDRGIVRERVCAIALEPGPESVVAVAAVLRAGGAFLTLDVTQPPARLAAMVRSGGATA
                     LLTRGTVRGHAGLMAQGTVIDLDELGEPDSWDGSHRVRAAGTPAVRPEVSGRQLAYVS
                     HTSGSTGTPNAVLIERAGLDSYLHFVARDYGLGPHTVALQVAPLGYDASIRDTFAPLV
                     AGGTVVLAERSTLLRADSFAEILRREGVDTLLSVTPSFLTFLAQQDRAEERLGGLRTV
                     VASGESLLPFLSSGSRRLLPGSLVNQYGPTECTMTATRYAVPPEPDTTTDLIGTAIDG
                     MTVTLTGPDGRETPPGEVGEITLGGIGVARGYRGRPELTADRFRPDPGGPPGARAYGT
                     GDLARVGQHGVLEYLGRSDRQVKIRGYRVDPAEIEGVLLSHPRVTGAVVTAEPDERGK
                     TFLQAHVTGSLDAVTNAELRRHLARTLPPHMMPRGFQRIERLPTTRTGKTDRAALLAR
                     APQSAGRTP"
     misc_feature    complement(108551..110020)
                     /locus_tag="Sfla_0091"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(108743..109981)
                     /locus_tag="Sfla_0091"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(109556..109561,109565..109582,
                     109589..109591))
                     /locus_tag="Sfla_0091"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(108569..108571,108839..108841,
                     108848..108850,108884..108886,109082..109084,
                     109148..109165,109223..109228,109577..109582))
                     /locus_tag="Sfla_0091"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     gene            complement(110059..112410)
                     /locus_tag="Sfla_0092"
                     /db_xref="GeneID:11369497"
     CDS             complement(110059..112410)
                     /locus_tag="Sfla_0092"
                     /inference="protein motif:PFAM:PF04737"
                     /note="PFAM: Lantibiotic dehydratase domain protein;
                     KEGG: saq:Sare_0356 lantibiotic dehydratase
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lantibiotic dehydratase domain-containing
                     protein"
                     /protein_id="YP_004921077.1"
                     /db_xref="GI:357409341"
                     /db_xref="InterPro:IPR006826"
                     /db_xref="InterPro:IPR006827"
                     /db_xref="GeneID:11369497"
                     /translation="MDAEKQAEDQEAVYLPGGRWRLWEQFSLRGPGFPVGGVLDLAPV
                     DLSVYADKFAGGVLSGPDWVEFEGVFGEVAARTAVRLQEVAGSSDFTAAVAWQNRTVL
                     RTGLRPFLGWVPSASNRSSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGRVDRSVG
                     GVEIDAGEGLTESSSVFFSSWSIDALARTLSADGRLMAWIPPRRIPFARLERRDGGGV
                     VQLPARPEQPVPAELLPLLELVDGRRTLGDLARELSLPADRAEERLRELVRRRWVTWR
                     LEVPSGARPDRELRAVLERVGDPELRRGALEPLEVLERGRERVEAAGRDASALCEALA
                     ALEEDFTRITDTASQRAKGTRTAPNRSLVYSDTRRSATARLSTAVLDELTPLSLCLTA
                     VGWLTSRYAESMRARIRESFDRVRGDRPTTDLASLWFACLPAPHAASMPEADRIGAEL
                     RDRWARIIDAPEGARRVQLSSSDIADRVREEFDGPRDGWSLSRYVSPDVLIMAKDAAS
                     VERGDFELVLGELHIAMNTVAASLFVNQHPAVEELIAETDRDFPGPRLMPMLPKELPL
                     KWSARSRPALDRPEDYFVAVAEHTSDPHRDRTVLSAEVTVTDRDGRLTAVLPDGSEFD
                     VLDVFSHALTNRVMDRFALRIDADHVPRVAVDKLVVSRESWRFTGGDLEFAEEKSEAR
                     RYVRARNWRGERGLPRYVFVVSPTEPRPFYVDFDAPVYVNILAKAARRLARKDPQAKL
                     TVTEMLPSPEHAWLTDDQGNAYTSELRFVAVDQEHRQGGVPSW"
     misc_feature    complement(<111907..112143)
                     /locus_tag="Sfla_0092"
                     /note="Lantibiotic dehydratase, N terminus; Region:
                     Lant_dehyd_N; pfam04737"
                     /db_xref="CDD:147079"
     misc_feature    complement(110212..111588)
                     /locus_tag="Sfla_0092"
                     /note="Lantibiotic dehydratase, C terminus; Region:
                     Lant_dehyd_C; pfam04738"
                     /db_xref="CDD:252771"
     gene            complement(112417..113361)
                     /locus_tag="Sfla_0093"
                     /db_xref="GeneID:11369498"
     CDS             complement(112417..113361)
                     /locus_tag="Sfla_0093"
                     /inference="protein motif:PFAM:PF00185"
                     /note="PFAM: aspartate/ornithine carbamoyltransferase
                     Asp/Orn-binding region; aspartate/ornithine
                     carbamoyltransferase carbamoyl-P binding domain;
                     KEGG: saq:Sare_0355 aspartate/ornithine
                     carbamoyltransferase carbamoyl phosphate-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate/ornithine carbamoyltransferase"
                     /protein_id="YP_004921078.1"
                     /db_xref="GI:357409342"
                     /db_xref="GO:0016597"
                     /db_xref="GO:0016743"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="GeneID:11369498"
                     /translation="MPQAERRHLISIDDLSDEELRHIALRGAEFSAGSADDARPLADT
                     VVGVLFRKTSTRTRTAFSAGALRLGARLITYGPGDLQENTGETVEDSAAVLSRMIDVL
                     VARTAGPEHELRAYAAQRRMAVVNAMSQGEHPTQALADLTTLLRRFGRIEDLHVIYVG
                     EGNNTASALALALSRFPGTRLTLRTPPGYGVAPEYLERAAVSAKRSGARIEERHDMAD
                     LPAADVVYTTRWQTTGTVKPTADWREVFAPFQVTEKTMASSPDAVFMHDLPAHRGEEV
                     TADVLDGPASIAFDQAENKYHSARAVLEWCAADRSSER"
     misc_feature    complement(112444..113343)
                     /locus_tag="Sfla_0093"
                     /note="ornithine carbamoyltransferase; Provisional;
                     Region: PRK00779"
                     /db_xref="CDD:234835"
     misc_feature    complement(112921..113343)
                     /locus_tag="Sfla_0093"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    complement(112444..112908)
                     /locus_tag="Sfla_0093"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            complement(113394..114767)
                     /locus_tag="Sfla_0094"
                     /db_xref="GeneID:11369499"
     CDS             complement(113394..114767)
                     /locus_tag="Sfla_0094"
                     /inference="protein motif:TFAM:TIGR00709"
                     /note="KEGG: saq:Sare_0354 diaminobutyrate--2-oxoglutarate
                     aminotransferase;
                     TIGRFAM: 2,4-diaminobutyrate 4-transaminase;
                     diaminobutyrate/2-oxoglutarate aminotransferase;
                     PFAM: aminotransferase class-III"
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-diaminobutyrate 4-transaminase"
                     /protein_id="YP_004921079.1"
                     /db_xref="GI:357409343"
                     /db_xref="GO:0008483"
                     /db_xref="GO:0030170"
                     /db_xref="GO:0047307"
                     /db_xref="InterPro:IPR004637"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR012773"
                     /db_xref="GeneID:11369499"
                     /translation="MPRRLRAATSRPVGTAGENRKDPITMTLAFTPPTTAPPEGPDVA
                     VFERYESHVRSYCRKFPVVFERAKGARLYAEDGRVFTDFFCGAGSLNYGHNPGPIKER
                     IADYLASDGMMHGLDMYTVAKRSFLVALTEHILRPRGLEYTAQFSGPTGADAVEAALK
                     LARKATGRRGIFAFSGGYHGMTRGSLAVTGNGRARRAGGVHGQDEVTFIPYEDGPQGP
                     FDSIAFIERLLADSSSGVELPAAVIVEPLQMEGGVYQASADWLRRLRVVTERHGILLI
                     CDEIQSGCGRTGTFFAFEESGIVPDIVTVSKSISGYGLPLALTLFRPGLDVWEPGEHT
                     GTFRGNQLAFVAATAAAELWSDPDFLDRLPVPARRLAEFGAELVAAEPEIVIRGRGMV
                     LGIDLGRKGGGKRAEEVQRYAFDHGLIVELSGRDDEVIKVLPPLTVTPEELDHGIGVL
                     RAALLSS"
     misc_feature    complement(113406..114632)
                     /locus_tag="Sfla_0094"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(113406..114587)
                     /locus_tag="Sfla_0094"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(order(113847..113849,113925..113930,
                     113934..113936,114033..114035,114225..114227,
                     114231..114236,114312..114320))
                     /locus_tag="Sfla_0094"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(113847..113849,113925..113927,
                     113934..113936,114033..114035,114231..114236,
                     114312..114317))
                     /locus_tag="Sfla_0094"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(113847..113849)
                     /locus_tag="Sfla_0094"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(114840..118118)
                     /locus_tag="Sfla_0095"
                     /db_xref="GeneID:11369500"
     CDS             complement(114840..118118)
                     /locus_tag="Sfla_0095"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: saq:Sare_0353 amino acid adenylation
                     domain-containing protein;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; condensation
                     domain protein; phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921080.1"
                     /db_xref="GI:357409344"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369500"
                     /translation="MDSADAQETGSGRPMSFAQRRLWFLDSLRPGTPADLLPLALRIR
                     GDLDDKALTGAFAAILARHEVLRTRYPAVDGEPVAVVELTAEAPWSRRDLRHLPSGQR
                     ESLLAELVAAELVRPLSLESAPPLRLTLVRLAEREHVLLIVVHHIAFDFFSWPVLTQE
                     LAAGYRARTIGPEPESEPLTFQYADAAAQQAARLAGPRAERQLAYWRERLAGLEPLEL
                     PADRPRPAVWDGAADIARFTIPSELTEKIDRVAREHRATRFMVLLAAFQAVLARLTGR
                     NDVAVGTPVSGRGRPPLDKLIGLFVNSVVLRAHLGGAPSFTELLGRVRKDTLDALTHA
                     ELPFERIVTELAQQRDLSRNPLFQISFQLLSLPEEPDHLPGLDTEMISTPASGSAFDV
                     SLDLLSHPDGRISGRMQYATALFDPDTAERIGAAFTTLLTAVVAEPDAPVARLAARLP
                     SLPGRERRRLLAQGNDTAMEVPDVPWTELFAQQVSRTPGAVAVSGPGGTLTYAELDSR
                     ANQLAHRLAAKGAGPGIPVGVLLERGPTLLAALLAVHKAGAVYLPLDPGYPAGRIGYL
                     LQDAGAGALISERELVKRLDRTGTLSRPAEEHTLLLDDPAEAARTAAAPCSAPRHHPG
                     PDELAYIFYTSGSTGHPKGVMVEHRALTHFLVAMAGRLPLRPGGTFLGITTVSFDPSL
                     MELCLPLTTGARLLLADREQARDPERMAALIATAGTALVQATPVTLRMLLDTGWRPGA
                     GLTVLSGGEKLHTELAVRLAADGARVWDLYGPTETTVWATTACLDPHGRNVDWQLRGN
                     TRLVLLDARMQPVGEGAVGEIHIGGSGLGWGYHARPAQTAGAFVPDPFADRPGARLYR
                     TGDLARRRPDGSLEILGRADHQVKIRGHRIEPGEIETALLATGAFRAVLVRAVPHPDG
                     DQRLAGYLVPKGGTAPGHEELRTVLLATLPDYMVPEAFVTLDALPRTPNGKVDRAALP
                     PVASWGRTGTTTGAPPRTDRERTVAGVWEEVLGVQAIGVDHDFFQLGGHSLLATRVAV
                     RLRAALGIDVPVRALFEHPTVAALSAALPGFPTVAAGPPAPVLGARRRARRPAAARST
                     DGRR"
     misc_feature    complement(117189..118079)
                     /locus_tag="Sfla_0095"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    complement(115425..117404)
                     /locus_tag="Sfla_0095"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(116850..117122)
                     /locus_tag="Sfla_0095"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(115206..116657)
                     /locus_tag="Sfla_0095"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS), including salinosporamide A polyketide
                     synthase; Region: A_NRPS_Ta1_like; cd12116"
                     /db_xref="CDD:213324"
     misc_feature    complement(order(116193..116198,116202..116219,
                     116226..116228))
                     /locus_tag="Sfla_0095"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213324"
     misc_feature    complement(order(115224..115226,115497..115499,
                     115506..115508,115542..115544,115800..115817,
                     115872..115877,116214..116219))
                     /locus_tag="Sfla_0095"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213324"
     misc_feature    complement(114945..115139)
                     /locus_tag="Sfla_0095"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(118551..118955)
                     /locus_tag="Sfla_0096"
                     /db_xref="GeneID:11369501"
     CDS             complement(118551..118955)
                     /locus_tag="Sfla_0096"
                     /inference="protein motif:PFAM:PF02452"
                     /note="PFAM: PemK family protein;
                     KEGG: sro:Sros_4560 transcriptional modulator of
                     MazE/toxin, MazF"
                     /codon_start=1
                     /transl_table=11
                     /product="PemK family protein"
                     /protein_id="YP_004921081.1"
                     /db_xref="GI:357409345"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR003477"
                     /db_xref="GeneID:11369501"
                     /translation="MQRGEVWWVDFDERRPVVLLSDDEPSGFQVMQVVAPAGVDISGL
                     GVEVPIGAQEGLPLEGVLRFAFPRPGFTPCTWLTTVAREDLVERAGVLSSAKLSEVGA
                     ALHAARQGREWTPMAAARLREIGEARRIGGLE"
     misc_feature    complement(118635..118952)
                     /locus_tag="Sfla_0096"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:251304"
     gene            complement(119314..120048)
                     /locus_tag="Sfla_0097"
                     /db_xref="GeneID:11369502"
     CDS             complement(119314..120048)
                     /locus_tag="Sfla_0097"
                     /inference="protein motif:PFAM:PF00975"
                     /note="PFAM: Thioesterase;
                     KEGG: fal:FRAAL2559  thioesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="YP_004921082.1"
                     /db_xref="GI:357409346"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="GeneID:11369502"
                     /translation="MTSGPALASPWFVRPPSADASARLFCFPFSGSGASAFGAWSATA
                     GDAEICPVQFPGRENRLAHPHYASYENLAEQLVEALTPLLDTPFAFFGHCAGALPAYE
                     SVLRLAAAGLPVPRRLYVSGQPAPHEAARDRMLTLGEDELRAELVTFLRGRGIDPRPD
                     MIDMGMFVLLRDHAAAGAYRRAEPARIDCPITVLHWSEDTDVSLADLQGWRRYADSVE
                     IHVVEGGHYDFMDAPAQLLAILADGR"
     misc_feature    complement(119323..120006)
                     /locus_tag="Sfla_0097"
                     /note="Predicted thioesterase involved in non-ribosomal
                     peptide biosynthesis [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: GrsT; COG3208"
                     /db_xref="CDD:225749"
     misc_feature    complement(119332..119883)
                     /locus_tag="Sfla_0097"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(120045..121295)
                     /locus_tag="Sfla_0098"
                     /db_xref="GeneID:11369503"
     CDS             complement(120045..121295)
                     /locus_tag="Sfla_0098"
                     /inference="protein motif:PFAM:PF00067"
                     /note="PFAM: cytochrome P450;
                     KEGG: fal:FRAAL2558 cytochrome P450 monooxygenase
                     (fragment)"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004921083.1"
                     /db_xref="GI:357409347"
                     /db_xref="GO:0004497"
                     /db_xref="GO:0005506"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0020037"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002397"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="GeneID:11369503"
                     /translation="MRLTPGPSRDIDLDTVDLFDLDLYGTGDPHAVWDAMRAQAPLHH
                     QTLADGREFWSVTRYEDVCRVLGDHREFTSERGTVPTHLGQDDVAAGVLLTSTDPPRH
                     TEVRRPLGSRLTARAVRSWEDSIRRSVTRFLEPALDGEVFDLAEKALLLPAIVTGPLL
                     GIPEKDWEELVQLTAMVAAPSDPHFQLGSEAATLAISHHELVGYVTEWVKDRRRSGAE
                     DDSLLHHLMSVRPGGAPLSDQEIALDGYSILLGANVTTPHTVSGTVQALIERPEQYDK
                     AQADPGLIPDLVEEGLRWTSAACNFMRYATTDVPVAGGVIPAGAAVVAWIGSANRDAA
                     LFTAPHTFDINRPNAKRQIAFGYGPHFCIGAPLARLTLRVFFEELLHRFDSLELAGEP
                     DHLRSYFIAGMTHLPVTAQKRHTP"
     misc_feature    complement(120069..121295)
                     /locus_tag="Sfla_0098"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(121292..121606)
                     /locus_tag="Sfla_0099"
                     /db_xref="GeneID:11369504"
     CDS             complement(121292..121606)
                     /locus_tag="Sfla_0099"
                     /inference="protein motif:PFAM:PF00550"
                     /note="PFAM: phosphopantetheine-binding;
                     KEGG: fal:FRAAL2557 non-ribosomal peptide synthetase
                     (fragment)"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="YP_004921084.1"
                     /db_xref="GI:357409348"
                     /db_xref="GO:0048037"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="GeneID:11369504"
                     /translation="MEPAPQLIHPPGGQEETERHHDASSGGPVPLEDEIAALWGELLD
                     RPEAGAEDEFFALGGNSLTGIQIIERLARDYGVLLSVRDFYLAQTPARVAGLIERGRS
                     ST"
     misc_feature    complement(121316..121510)
                     /locus_tag="Sfla_0099"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(121676..121927)
                     /locus_tag="Sfla_0100"
                     /db_xref="GeneID:11369505"
     CDS             complement(121676..121927)
                     /locus_tag="Sfla_0100"
                     /inference="similar to AA sequence:KEGG:POSPLDRAFT_93397"
                     /note="KEGG: ppl:POSPLDRAFT_93397 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921085.1"
                     /db_xref="GI:357409349"
                     /db_xref="GeneID:11369505"
                     /translation="MAGKEEYGKTCHSDLSDNTATRGGCAGAGGERPAGHRTECRVVA
                     AGPASRRMPDDARVPAAGVLRCGRWAVGRERQRSRPHHT"
     gene            complement(122064..122228)
                     /locus_tag="Sfla_0101"
                     /db_xref="GeneID:11369506"
     CDS             complement(122064..122228)
                     /locus_tag="Sfla_0101"
                     /inference="similar to AA sequence:KEGG:CPS_3716"
                     /note="KEGG: cps:CPS_3716 glycosy hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921086.1"
                     /db_xref="GI:357409350"
                     /db_xref="GeneID:11369506"
                     /translation="MKSAGVFVATVLFALMIGAVGGTATAAGETGRTGVLVTSSATND
                     GDSGWGRFAG"
     gene            complement(122502..124019)
                     /locus_tag="Sfla_0102"
                     /db_xref="GeneID:11369507"
     CDS             complement(122502..124019)
                     /locus_tag="Sfla_0102"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: mxa:MXAN_4079 non-ribosomal peptide synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="YP_004921087.1"
                     /db_xref="GI:357409351"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369507"
                     /translation="MSDLDASLIRMLVDSLARHRDAVAVIDDGVAHTYAELDEVSAEI
                     AGGLAAHGIGPGDVVDVHATRSWSRCAAVLGVWRVGAGVLSIDPAMPPAWTGKLVSSA
                     GCAMVLRAEECAPVGAGVAEHTFRSIRGTRRDEVATGPLCYVIPTSGSTGDPKAVAVP
                     PVVLADLGNWHVRRWSHDRPPNTLHMSSIGFDMVYEDTVATWLAGASLVVVNDQDRLD
                     PFTLIDIIREHEVARLFQPVVGLHGLAAAACVAGVGTPSLREISVAGEQLVINEEVRK
                     FCADGDLTLVNQYGPSETHVVTQYRLTGDVAEWPDRPPIGTAVVDAELLCLVDGRLRP
                     FTVGETRELVIAGNCVGVGYAGDDVLTAKKFRDVPHRDGRVRRCYFSGDLVTFDGADF
                     HFVSRLDDQLKVNGYRVEPGEVESVIAQVAGVRRAAVVGVKVGASTQLAAYYTPASGA
                     EVCRDDLIRSCDFGLPRFMVPRHFVELEELPSTRNGKVDRAKLREMFQERSMSRG"
     misc_feature    complement(122541..123959)
                     /locus_tag="Sfla_0102"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(122733..123923)
                     /locus_tag="Sfla_0102"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(123555..123560,123564..123581,
                     123588..123590))
                     /locus_tag="Sfla_0102"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(122559..122561,122796..122798,
                     122829..122831,122838..122840,122871..122873,
                     123144..123161,123225..123230,123579..123581))
                     /locus_tag="Sfla_0102"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(122616..122618,122796..122807,
                     122829..122831,122838..122840,122871..122873,
                     123144..123161,123225..123230,123291..123293,
                     123300..123305,123309..123311,123456..123461,
                     123579..123581))
                     /locus_tag="Sfla_0102"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(122616..122618,122634..122636,
                     122799..122807,123228..123230,123291..123293,
                     123300..123305,123459..123461))
                     /locus_tag="Sfla_0102"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(124016..124816)
                     /locus_tag="Sfla_0103"
                     /db_xref="GeneID:11369508"
     CDS             complement(124016..124816)
                     /locus_tag="Sfla_0103"
                     /inference="protein motif:PFAM:PF05721"
                     /note="PFAM: Phytanoyl-CoA dioxygenase;
                     KEGG: ava:Ava_C0003 phytanoyl-CoA dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="YP_004921088.1"
                     /db_xref="GI:357409352"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="GeneID:11369508"
                     /translation="MLTESQITEYRSEGFLLLEDVFDTGDIAALRREVTDLYGTEHPG
                     RIFEEDGTTVRGIHGCHTTGALFSRLVRLPELLTAAEQLLESKVHVFQCKVNAKKALR
                     GEVWQWHQDYSVWGPKDGMPEPRAVNVALLLDDATEHNGPLLVVPGSHRNGAIAPWRP
                     EPEGTSRWEADLSAKLKFALDAEQMAKVTAESEIRSVVGRAGSLLFFHPCIAHGSGAN
                     MAPTDRTMAFVSYNSVDNELREVPRPRPEFVASRDYRPLELVDGGLIA"
     misc_feature    complement(124046..124813)
                     /locus_tag="Sfla_0103"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     cl17312"
                     /db_xref="CDD:266621"
     gene            complement(124933..125205)
                     /locus_tag="Sfla_0104"
                     /db_xref="GeneID:11369509"
     CDS             complement(124933..125205)
                     /locus_tag="Sfla_0104"
                     /inference="protein motif:PFAM:PF00550"
                     /note="PFAM: phosphopantetheine-binding;
                     KEGG: fal:FRAAL2543  peptide synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="YP_004921089.1"
                     /db_xref="GI:357409353"
                     /db_xref="GO:0048037"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="GeneID:11369509"
                     /translation="MNRPLAVTTNERNAMTADRVRAIWHRELQRDDIMPDDDFFALGG
                     DSLVMVRIQAAFIDELDAEVPMDQLFLNPTVRSISAYVDSRAALAP"
     misc_feature    complement(124960..125154)
                     /locus_tag="Sfla_0104"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(125202..126788)
                     /locus_tag="Sfla_0105"
                     /db_xref="GeneID:11369510"
     CDS             complement(125202..126788)
                     /locus_tag="Sfla_0105"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: fal:FRAAL2542 non-ribosomal peptide
                     synthetase;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921090.1"
                     /db_xref="GI:357409354"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="GeneID:11369510"
                     /translation="MILQGKRVPLPPSPVVHRRFEEHVRATPDAVAVVWSGEQVTYAE
                     LDARANRFAHLLTARGHGPGAKVGVCLDYSIDMVVAILGTLKAGAAYVPLDPAYPAAR
                     LRLLLGQVPGLALIVASSTTAAMVESGGVEVIDLEQLADHLATLPATVPDVHVTGDDL
                     CYAVFTSGSTGTPKLTAVRHEGWFNLMNWMQLEYGLHRGSHHLVVSAFGFDLSQRALM
                     TPLFCGATQHLMASRNFDVMLAHRMLTRYDIRVVHCASSTLYLLVDWESARGGDALAR
                     LDYILFGGEALKSERLARFARRPGTTCTLLHQYGVAECTDVATSYDLAHYRPGEHDIA
                     PVGRPVHNTAIHVLDADMHEVEAGLYGEICISGAGVGAGYLGAGGPENAKFTTLDVDG
                     KPVRLYRTGDRGRIDDSGELVVAGRMDDQVKVRGTRIDPTDVERALGRLVGIREAAVV
                     AVRDDGGEVELNAFVVPSGNDLAEDDLRARLLWTLPRNMLPSRFTNIPRIPLSPHGKV
                     DRAALAEICRPRGADSGSAA"
     misc_feature    complement(125250..126707)
                     /locus_tag="Sfla_0105"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(125442..126668)
                     /locus_tag="Sfla_0105"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(126267..126272,126276..126293,
                     126300..126302))
                     /locus_tag="Sfla_0105"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(125268..125270,125538..125540,
                     125547..125549,125583..125585,125781..125783,
                     125853..125870,125934..125939,126288..126293))
                     /locus_tag="Sfla_0105"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     gene            complement(127186..127962)
                     /locus_tag="Sfla_0106"
                     /db_xref="GeneID:11369511"
     CDS             complement(127186..127962)
                     /locus_tag="Sfla_0106"
                     /inference="protein motif:PFAM:PF10014"
                     /note="PFAM: Protein of unknown function DUF2257;
                     KEGG: pay:PAU_00240 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921091.1"
                     /db_xref="GI:357409355"
                     /db_xref="InterPro:IPR018724"
                     /db_xref="GeneID:11369511"
                     /translation="MQTLTETPALVENGFARWDLAEEFGISETDASFQSLRAEFVDLP
                     PDPYATEEGRNRRYARGIFLPWSREFSWIPDTHLGESGWMNGYWQADHNPDYVGVLRK
                     LPAMSEAARNNPIIHEILSFDFAQTRWSQSDAAFPLHVGVHLIKLAVDDSGSEAISSP
                     NELHQDGEPFVFAHLVYRTNVVGGSNVIAPPKYRGKLPEDVPEGEALAEFELTKPLES
                     YGVTDEKVSHYVSPIRRGEGPETGERAVVLVDFTPMRQHI"
     misc_feature    complement(127210..127854)
                     /locus_tag="Sfla_0106"
                     /note="2OG-Fe dioxygenase; Region: 2OG-Fe_Oxy_2;
                     pfam10014"
                     /db_xref="CDD:255696"
     gene            complement(128021..129010)
                     /locus_tag="Sfla_0107"
                     /db_xref="GeneID:11369512"
     CDS             complement(128021..129010)
                     /locus_tag="Sfla_0107"
                     /inference="protein motif:PFAM:PF05118"
                     /note="PFAM: Aspartyl/Asparaginyl beta-hydroxylase;
                     KEGG: sna:Snas_2689 aspartyl/asparaginyl beta-hydroxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/asparaginyl beta-hydroxylase"
                     /protein_id="YP_004921092.1"
                     /db_xref="GI:357409356"
                     /db_xref="GO:0004597"
                     /db_xref="InterPro:IPR007803"
                     /db_xref="GeneID:11369512"
                     /translation="MQEISSLKNLPATVMLRDDLDIERLEADLAALSGSEFWALQRSF
                     EDGAVGEESDVDWKVLPLRAPAGDLQRTDPGGPGRDGFADTPLMAKAPYLSRILSELG
                     TELRSVRLMALAPGVSVEEHSDTPLGLPYGYVRLHIPLVTNPGAVMVLDGVEQRWQPG
                     TLWYADFERPHALRNSGDRARIHLVADVATNDRLLALFPDSFRADLPASDIAYYRPVL
                     PLTSRELEEFGCSFAVPFSFMEWGEPVVDDHESDLPAEVTAEEGVLVLRAEGHAPVEL
                     LHLGAGEFRLLGWSEERLLRLDLFDDDPRVELSTRRGRRRQVVRRPALRPATV"
     misc_feature    complement(128447..>128731)
                     /locus_tag="Sfla_0107"
                     /note="Aspartyl/Asparaginyl beta-hydroxylase; Region:
                     Asp_Arg_Hydrox; cl17820"
                     /db_xref="CDD:266860"
     gene            complement(129130..130419)
                     /locus_tag="Sfla_0108"
                     /db_xref="GeneID:11369513"
     CDS             complement(129130..130419)
                     /locus_tag="Sfla_0108"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: amd:AMED_8560 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004921093.1"
                     /db_xref="GI:357409357"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11369513"
                     /translation="MSGTAGHGTVKGRDFRLFWFGETVSLLGNGIAVVALPFVAVLTL
                     HAGTFVVGLLTSVAYLPWLLLGLPAGAWVDRLPRRPVMLVSDAVSFVAFVSVPIAACA
                     HVLTIPHLLAAAFICGCASVFFTTAQRAYLPTLLSDAELLSGNARLQGSESTAEVIGP
                     GLAGMLVQAFGAVAGLLANALSFLVSWISLRAIRVTEPPPSPPPEVRRRRLRTEVRDG
                     LRFLFRDRILRTLAVFSAVSNIALTGMSSIEVAFLVRTVGAGEAVVGAVLTLCGLGGV
                     LGVLVSHQVSRRYGSARAVVICLCGAAPFTLLFPLTGPGAGLAFFVVGGVGVGAGVVA
                     ANIITDTFRQRYCPPDLIGRVSASAAVISFGAIAVGGLLGGVLGELSGVRETMWMMTG
                     MYTLATVALVCSPIRKLRDFPESDESLRAAEAEKAVP"
     misc_feature    complement(129214..130377)
                     /locus_tag="Sfla_0108"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(129322..130377)
                     /locus_tag="Sfla_0108"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(129319..129321,129328..129333,
                     129340..129345,129352..129357,129388..129390,
                     129397..129402,129412..129414,129421..129426,
                     129433..129435,129583..129585,129595..129597,
                     129604..129606,129616..129618,129628..129630,
                     129670..129672,129679..129684,129691..129696,
                     129703..129705,129952..129954,129970..129975,
                     129982..129987,130021..130023,130030..130035,
                     130042..130047,130054..130059,130210..130215,
                     130219..130224,130234..130236,130243..130248,
                     130255..130257,130309..130314,130318..130326,
                     130333..130335))
                     /locus_tag="Sfla_0108"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(130416..134384)
                     /locus_tag="Sfla_0109"
                     /db_xref="GeneID:11369514"
     CDS             complement(130416..134384)
                     /locus_tag="Sfla_0109"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: bsu:BSU31960 siderophore
                     2,3-dihydroxybenzoate-glycine-threonine trimeric ester
                     bacillibactin synthetase;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; condensation
                     domain protein; phosphopantetheine-binding; Thioesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921094.1"
                     /db_xref="GI:357409358"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369514"
                     /translation="MAPVSYAQRRLWFLNRVNGDSGVYNCPLVVRMRGDLDRAALAAA
                     LVDLADRHEVLRTVYPAVQGEPVQHVSARPPELEVVTCQEDGLAAMLSAAVDRGFDLT
                     ADLPVRATLFAPAPREHVLALVLHHIACDEGSWQPLLTDLATAYRARAAGGPPRWEPI
                     PVTYRDYAVWQRDLLGEEDDPASLLSAQLSFWREQLAGLPAELDLPFDRSRPATADHR
                     GACVPMKLDGDLHRRLLAVAADHGCTTFMVLQAGIAVLLSRLGAGTDIPLGTAVAGRL
                     DDALEGVVGFFVNTLVLRSDVSGDPTFGELLHRVRDADVAALDHQDVPFERLVEDLNP
                     ERSLARHPLFQVMLTLSAGEAETFSLPGLTCAEEPLDWEVAKFDLSFDFREHRTPDGE
                     AAGIDGSLEYATALFDRATVDHIADALPRLMRQLVSAPRRPVGDADPLSAEHRHQALV
                     AWNDTALPVSRTSVPELFEAQAARTPRATAVVCGNTRLTFAELNSRANVLARRLRDLG
                     AGAERLVALALPRSAESVVAMLAVLKTGAAYLHVDLEYPPDRIEHMLRDAAPLAVVTD
                     TATAAAHGFGQLPVVFADRIGTPSGPVADLNCRVRPDSAAYVIYTSGSTGRPKGVVTP
                     HAALSNLYAFHRAGLIARTEAAAGRPLRSAVTASLSFDTSWEALFWMLAGHELHVVRD
                     DVRRDAVALTDYVRAVGIDVLDVTPTYAEHLLDEGLLSGTGAPLVLLLGGEAAGQSLW
                     TRIREAAGTLCLNLYGPTECTLDALWWDAADSPHPLIGRPIGNTRVFVLDERLRPVAP
                     GVPGELYVTGPGVARGYLNRPAATAERFVACPYAAEGETGTRMYRTGDLVRWDRQGRL
                     DYLGRVDDQVKVRGFRIELGEVETALAGCPGVAQAAAAVREDTVGGKRLVGYVQSAAD
                     HGFDPRELRNRLASVLPDHMIPSFFQPIDRLPMTPNGKLDRSALPPPDFARRPASRGP
                     RGPYEEVLCDLFAQVLGLSRVGAEENFFELGGHSLLAVRLLSRVRAVLGGRLTLVDLF
                     QAPTAADLADRLGAGARHDPLAPLLPLRTGGDRPALFCLHPAAGISWGYAGLLGHIDA
                     GYPVYGLQARGLTDAKACGGAWRAMVEDHVEQIRSVQPRGPYRLIGWSFGAVLAHLVA
                     TDLQADGDEVDLLVLLDGYPPDSVPGYRPLEDGSPETFTELLDSLGYDLPEGGGEPLG
                     FDAYERTVRRPGSTLEWLTREEAAALSRVFVDNDRIYQELRPRTYRGDMVFVSATEGR
                     PADAPAPESWRGHVTGTLEVHDVDCAHGEIAQAEPMSRIGAVVAQKLALLDTPRATAV
                     ER"
     misc_feature    complement(133491..134384)
                     /locus_tag="Sfla_0109"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    complement(130455..134378)
                     /locus_tag="Sfla_0109"
                     /note="enterobactin synthase subunit F; Provisional;
                     Region: entF; PRK10252"
                     /db_xref="CDD:236668"
     misc_feature    complement(133140..133430)
                     /locus_tag="Sfla_0109"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(131511..132959)
                     /locus_tag="Sfla_0109"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(132528..132533,132537..132554,
                     132561..132563))
                     /locus_tag="Sfla_0109"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(131529..131531,131802..131804,
                     131811..131813,131847..131849,132054..132056,
                     132111..132128,132186..132191,132549..132554))
                     /locus_tag="Sfla_0109"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(131259..131453)
                     /locus_tag="Sfla_0109"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(130434..131195)
                     /locus_tag="Sfla_0109"
                     /note="Thioesterase domains of type I polyketide synthases
                     or non-ribosomal peptide synthetases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: COG3319"
                     /db_xref="CDD:225856"
     gene            complement(134394..135164)
                     /locus_tag="Sfla_0110"
                     /db_xref="GeneID:11369515"
     CDS             complement(134394..135164)
                     /locus_tag="Sfla_0110"
                     /inference="protein motif:PFAM:PF00975"
                     /note="PFAM: Thioesterase;
                     KEGG: sgr:SGR_3257  thioesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="YP_004921095.1"
                     /db_xref="GI:357409359"
                     /db_xref="GO:0048037"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="GeneID:11369515"
                     /translation="MSGPQDTTLVPLHRTPNARRTLVGLSFFGGGTAAYQPWTGHMPA
                     DTDLVVVCYPGREGRFAEDFARDWEELATDVARSLREADLGPYILFGHSMSGWMAFDV
                     ASRLDGDEARRPRALVLSSCNAPDRGLTESELLPTPQDPDERLLEWLETHGLLPRHVR
                     EHAGLTEVALELMRADVDVRNTFVYRGAEVSVPLQVFLGADDPLISSDAAVRWNALTS
                     GAYRYDVLGGGHFYTPEIWQSLPSRIAETTFAPTGPVS"
     misc_feature    complement(134460..135122)
                     /locus_tag="Sfla_0110"
                     /note="Predicted thioesterase involved in non-ribosomal
                     peptide biosynthesis [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: GrsT; COG3208"
                     /db_xref="CDD:225749"
     misc_feature    complement(134424..135083)
                     /locus_tag="Sfla_0110"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(135161..135433)
                     /locus_tag="Sfla_0111"
                     /db_xref="GeneID:11369516"
     CDS             complement(135161..135433)
                     /locus_tag="Sfla_0111"
                     /inference="protein motif:PFAM:PF03621"
                     /note="PFAM: MbtH domain protein;
                     KEGG: gbr:Gbro_3740 MbtH domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="balhimycin biosynthetic protein MbtH"
                     /protein_id="YP_004921096.1"
                     /db_xref="GI:357409360"
                     /db_xref="InterPro:IPR005153"
                     /db_xref="GeneID:11369516"
                     /translation="MNNPFDAEDGSYLVLANAERQHSLWPAAIDVPAGWSTVFGADTR
                     TACLAHVEKNWTDMRPAGLAAAMDEGPQPAANGTADGGPTSTGTSR"
     misc_feature    complement(135227..135433)
                     /locus_tag="Sfla_0111"
                     /note="MbtH-like protein; Region: MbtH; cl01279"
                     /db_xref="CDD:260868"
     gene            complement(135548..136528)
                     /locus_tag="Sfla_0112"
                     /db_xref="GeneID:11369517"
     CDS             complement(135548..136528)
                     /locus_tag="Sfla_0112"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: sma:SAV_3667 erythropoiesis-stimulating
                     protein;
                     PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004921097.1"
                     /db_xref="GI:357409361"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:11369517"
                     /translation="MLTTFGLELMEEAVYRELSASPPPAAEEIADRLAAAPGLVRECL
                     DRLLELGLVRPSFEVPDGFTAVDPILSLQESLAGQHEELVRRQRRLAETHAEVVRLLM
                     SDASGRPGRGEQVERLLGMDDVQRRVDRLAGEAVREVLAFVPGGARSTPELSAARRND
                     AALLSRAVSIRAVGTDTDSYDAATLAHVRWLTGNGGRFRGCATPLPEMIVFDGSVALV
                     PLDPRNTAAGALQVADPGLVAPLVVLFEQTWSSAAPLDPGRLPADDIPNGKERALLRL
                     VAEGCTDAAAAGQLHVSHRTARRMMAVLMERLGARSRFEAGVKAARRGWL"
     misc_feature    complement(<136010..136528)
                     /locus_tag="Sfla_0112"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1378"
                     /db_xref="CDD:224296"
     misc_feature    complement(135563..135724)
                     /locus_tag="Sfla_0112"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(135590..135592,135623..135637,
                     135641..135646,135650..135655,135677..135685,
                     135722..135724))
                     /locus_tag="Sfla_0112"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(135551..>135721)
                     /locus_tag="Sfla_0112"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(order(135563..135568,135575..135577,
                     135584..135592,135683..135685,135689..135691,
                     135695..135697))
                     /locus_tag="Sfla_0112"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(136568..144505)
                     /locus_tag="Sfla_0113"
                     /db_xref="GeneID:11369518"
     CDS             complement(136568..144505)
                     /locus_tag="Sfla_0113"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; condensation
                     domain protein; phosphopantetheine-binding;
                     KEGG: sen:SACE_4287  non-ribosomal peptide synthetase;
                     SMART: Polyketide synthase, phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921098.1"
                     /db_xref="GI:357409362"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020806"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369518"
                     /translation="MNQSAVEDILPLSPLQEGLLFHALFDRQKHSPYLAQFAVDLDGP
                     VDSALLRAAAETVMRRHATLRSGFRYRKTGEPIRVVRRDVQLDWREIETGQDDTPERI
                     AELTEQDWARGIDVGGSSLIRFTLLRRTDRRHRLLVTAHHLLLDGWSFALLFQELFAV
                     YSRAGGTAGLPPVRPYRDYLAWVARQDRVGAERHWAMALEGVSEPTFVASADSPSGPP
                     PEEVAVLLPSETTALLTAYARSNHVLLNTVCQGIWAILVGSLTGRDDVVFGSTVSGRP
                     AELAGADSMIGMLINTVPVRVRLDPAASLSALFEQIQAGRAASLDHDHLGLTEIQRVT
                     GLPTALFDTNVVFDNFPMHDYKVDSPDGELEVGVTFRDSAHYPLTLAVEPGERLALRL
                     HYRPDLFTADRAAELADRLVLLLEQVAENPDRPLSALTLLSPEQHDRVVRTWNATAVE
                     LPEVTLADLWSEQVRRTPEATALVASDERLSYAELDRRVGLLAAQLAHRGAGPDRVVA
                     VALPRSVELVVAILAVVRAGAAYLPVDLDHPAGRIAAMVADAGPILALTDSENAGALP
                     GPTPKLLLDEPIAPVSARPVPPLPAHSAYVIFTSGSTGRPKGVVVPHAAIVNRLLWMQ
                     AEYRLTGADRVLQKTPAGFDVSVWEFFWPLISGATLVLAKPGGHRDPAYLAELIQRES
                     VTVTHFVPSMLQAFLREPGAAGCTGLRRIISSGEALAAETRRELFDTLGSCELHNLYG
                     PTEAAVDVTSWQCHRGDEGSTVPIGRPLANVSAYVLDGGLRPVPPGVVGELYLGGVQL
                     ARGYTGRPALTAERFVACPFAAGERMYRTGDLARWTPGGELEYVGRADAQVKIRGFRV
                     EPGEIEAVLAGHPAVVQAAVVLREDRPGDQRLVAYAVPRAPGLTDRELRRFMADSLPD
                     YMVPAAVVLVGAMPTTTNGKLDRAALPEPDRAAHTVREPRSPREEILCELFAEVLGVP
                     RVGIDDHFFDLGGHSLLALRLLSRIRSVLGEGFEIRDLFAEPTVAGLARLTGAARPAL
                     TARTGAEPVPLSYAQRRLWFLNRMERDQGTYNVPVAVRLTGVLDRDALAEALADVARR
                     HESLRTVFPEEGGEPYPVGLDSVPAIEVVEVAPPDLADAMAERVRHRFDLTAHAPVRV
                     TLFASAPHEHVLLLVVQHIAADGWSLRPLLRDLGLAYTARRAGSAPDWPPQPVRYADY
                     TLWQRELLGDAEDTTSLMARQIDYWRDHLADLPAELTLPADRPRPAVPTQSGGTVAVH
                     WEPELHSRLLELARSAGCTLFMVLQAGFAALLTRMGAGTDIPFGTPVAGRSDSALDDM
                     VGFFVNTLVLRTDTAGDPGFAELLRRVRDTDLEAFAHQDVPFERIVEVLRPERSLSQN
                     PLFQVMIQVQPADTTTPGFAGLKAEPAPVSWDVAKFDLSLELVDGRDDRGAPAGLTGY
                     LEYAEELFDRTTAEQLVTRLRRLLEQVLAEPERPVGAVDVLSDGERRLFLAAGPVPAL
                     APRPVFLPEAFRQQVARTPDARALVFEDTALTYAELDARVTRLARHLVRRGAGPDRVV
                     AVALPRSTDLVVALLAVLKAGAAFLFVDLAYPARRIAHLLEDSAAALVVTDGESAASL
                     PVREPVLVDSPALDGESAQDLEIALAADHPAYVVYTSGSTGVPKGVMVTHGGLANLLA
                     FYREEVIATAERTRGPRRCRMALTASLSFDTSVVGLLWQASGHELHLIGDDTRRDPAA
                     MARYMERCGIDALDVMPSYAEELIQQGMLDPAGTPPAVLMTGAETVGEKLWTRIREAE
                     GITVYNIYGQTETTVDSLFWTSEESDRPLVGRPIPGVDVFVLDQDLRLVPPKVIGELY
                     VGGAQLARGYMNRPALTAERFVANPFRAGQRMYRTGDLVRWTDEGALEFLGRADDQVK
                     IRGFRVELGEVEAALARHEGVAHAVAVLREDRPGDSRLVGYVLARDTALDARRLREFA
                     RQNLPDYMVPAAIVVIDELPLTPNGKLDSAALPAPVYPTEARRAPRNLREELLCGLFA
                     AVLGRDTVGIDDSFFDLGGHSLLAVRLSSRARSVLGVELPARLLFSTPTVAGLADSLG
                     DVLPARPVLRAGTRPDVLPLSYAQQRLWFLDQWEETGTSYNLPVALRLTGPLDREALG
                     QAWSDVTDRHESLRTVFADRDGRPVQSVSAPGGVRPELVHREVPEAEVEEAIRAAAYH
                     PFDLAAQPPAAAHLFTTGQEDHVLLLVFHHIICDGWSLGPLMRDLSAAYAARVLGDAP
                     QWDELPVHYADYALWQRDLLGAEDDEDSLLSRQLNHWRAQLADLPVELALPTDRPRPG
                     TSDYAGGSAEVAWGPELHRHLLALAKEHGCTLFMVLQAGFAALLSRLGAGTDIPIGTP
                     VAGRTDDALDEVVGFFVNTVVLRTDVSANPSFAELLRRVRATDLGAYEHQDVPFERLV
                     EEVNPPRSLGRHPLFQVMVQLQHAAAGPRFPGLRAAEHHIPSATAKFDLVLDVEERLD
                     KDGAPAGLDGALTYATALFDASTGERLADGLRHVLTQVARDPERTVADLDVPPVQDRR
                     SGDVAVGPASVPGAAPTATVPRTAHEEVLGELFAQVLGRDSVGLDDNFFALGGHSLLA
                     IQLISRVRSALGLELPVRELFRAPTAAGVAAYLAEARPARPALRPADAH"
     misc_feature    complement(143606..144490)
                     /locus_tag="Sfla_0113"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    complement(141899..143830)
                     /locus_tag="Sfla_0113"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(143285..>143494)
                     /locus_tag="Sfla_0113"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(141686..143104)
                     /locus_tag="Sfla_0113"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(142685..142690,142694..142711,
                     142718..142720))
                     /locus_tag="Sfla_0113"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(141704..141706,141974..141976,
                     141983..141985,142019..142021,142214..142216,
                     142280..142297,142358..142363,142706..142711))
                     /locus_tag="Sfla_0113"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(141440..141631)
                     /locus_tag="Sfla_0113"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(140507..141397)
                     /locus_tag="Sfla_0113"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    complement(138749..140719)
                     /locus_tag="Sfla_0113"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(140150..140440)
                     /locus_tag="Sfla_0113"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(138536..139969)
                     /locus_tag="Sfla_0113"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(139544..139549,139553..139570,
                     139577..139579))
                     /locus_tag="Sfla_0113"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(138554..138556,138824..138826,
                     138833..138835,138869..138871,139064..139066,
                     139121..139138,139196..139201,139565..139570))
                     /locus_tag="Sfla_0113"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(138293..138481)
                     /locus_tag="Sfla_0113"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(137333..138238)
                     /locus_tag="Sfla_0113"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    complement(136985..137272)
                     /locus_tag="Sfla_0113"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(136619..136813)
                     /locus_tag="Sfla_0113"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(144523..146319)
                     /locus_tag="Sfla_0114"
                     /db_xref="GeneID:11369519"
     CDS             complement(144523..146319)
                     /locus_tag="Sfla_0114"
                     /inference="protein motif:TFAM:TIGR01720"
                     /note="TIGRFAM: non-ribosomal peptide synthase;
                     KEGG: tcu:Tcur_1886 amino acid adenylation domain protein;
                     PFAM: condensation domain protein;
                     phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="non-ribosomal peptide synthase"
                     /protein_id="YP_004921099.1"
                     /db_xref="GI:357409363"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010060"
                     /db_xref="GeneID:11369519"
                     /translation="MREYVDSPIDDASSRVVGGTPVTRHQRVLCQLVADVLGVSGVGI
                     GDGFVALGGDSIIAMQLVGRARKAGLRITVGDVLTRRDMEALAQTATPLDQEPAPVAD
                     NGVGPVVTTPIMHWFRERGGAVDTYNQFAVLRTPSGLTEPRLVSMVQALLDHHDILRL
                     RLSVPGDGADWSLETLPAGAVDAASAVRRIDVAGGPEQDWAGLVRQESDVARDRLRPG
                     EGNVLQAVWFDAGPDRRGVLALVVHHLAVDSLSWRILAADLASAWQAVEQGAAITLDP
                     VPTSFRRWSHILAEQAHTQTAIAELPGWLDRLRPGSGRFGDPVRVPGQDVESRDRSFT
                     ESLPAEFTEALLTTVPSLFNAGINDVLLAGLALALGDWHRGRGTVGDGTALLHLEGHG
                     REEALAEVDLSRTVGWFTSLFPIRLDLGEADRTDAHAVGAEVGNAVKRVKEQVRGVPD
                     KGVRYGLLRYLNPETGELLEEAAQPEFVFNYLGRFEASDDADWSVVAEYGTGLDDTGS
                     GMPMAHSIEVNAATVDRTDGPVLRATWTWADSVVSEADTRELADGWFRMLRALVAHAR
                     EPGAGGLTPSDLTLSSLSQHEIEEIESDLRAF"
     misc_feature    complement(146056..146241)
                     /locus_tag="Sfla_0114"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(145063..145941)
                     /locus_tag="Sfla_0114"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    complement(144547..145023)
                     /locus_tag="Sfla_0114"
                     /note="non-ribosomal peptide synthase domain TIGR01720;
                     Region: NRPS-para261"
                     /db_xref="CDD:233545"
     gene            146517..147908
                     /locus_tag="Sfla_0115"
                     /db_xref="GeneID:11369520"
     CDS             146517..147908
                     /locus_tag="Sfla_0115"
                     /inference="protein motif:PRIAM:2.6.1.50"
                     /note="KEGG: cai:Caci_6293 glutamine--scyllo-inositol
                     transaminase;
                     PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--scyllo-inositol transaminase"
                     /protein_id="YP_004921100.1"
                     /db_xref="GI:357409364"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="GeneID:11369520"
                     /translation="MTIQQPARQTTDLAMFGGDRAVPRELGIRPWPMVTGQDEQAVHR
                     VLRSGRFTSASSGEQEIAGLEREWARFVGTEHCVAVSNGTAALSVALGAAGVEPGDEV
                     IVPALSFIGSATAPLHLMAVPVFVDIDPVTFNLDPAALEAAITSRTKAIVVVHLHGLP
                     ADMDRITEIAARHGITVVEDAAQAHGARYRGRSVGSIGAVNTFSLNVSKNLATCGEGG
                     LITTDDADVATRALMLRQFGELIPARGERSYVAHLLGWNCKPNAIQAAFTRSRLTQLP
                     AEMAVREENVGRLLGRLAAYPGFLVPQVPQDRTHAWHILRIRVEPAAFGLADELAGPL
                     RSVLQRALRAEGVPAVPYQLQPLPAQRVFTGRRGFGGYPWALPGVVDRPYRPGDFPAT
                     LRVLDDSFTIQKAHLHPDSGPLLDRYADAFDKVWLNREALAAIAATTDYTPHWERASE
                     IADTEWAGAFDAR"
     misc_feature    146628..147782
                     /locus_tag="Sfla_0115"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    order(146763..146768,147054..147056,147063..147065,
                     147126..147128,147138..147143,147570..147572)
                     /locus_tag="Sfla_0115"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    order(146763..146768,146838..146840,147054..147056,
                     147063..147065,147126..147128,147141..147143)
                     /locus_tag="Sfla_0115"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    147141..147143
                     /locus_tag="Sfla_0115"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            complement(148013..148978)
                     /locus_tag="Sfla_0116"
                     /db_xref="GeneID:11369521"
     CDS             complement(148013..148978)
                     /locus_tag="Sfla_0116"
                     /inference="protein motif:PFAM:PF02779"
                     /note="KEGG: cai:Caci_6295 transketolase central region;
                     PFAM: Transketolase central region; Transketolase
                     domain-containing protein;
                     SMART: Transketolase central region"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="YP_004921101.1"
                     /db_xref="GI:357409365"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="GeneID:11369521"
                     /translation="MPVVTAEPTVPDEARAAREVYRDVLVELLGEDERYVCLDSDTGL
                     FSATSWGEGARRYLNLGIAEQNLMGVAAGLARSGRIPFVNTMATFAATRALEAVKLDI
                     AWNDLPVRIVATHGGLSAGHLGSTHHALEDLAVMRMLPNMTVLVPADGPATESLVRAG
                     AELPGPVYLRLGRGATPSIAPGAEPLRIGVAQSLRRGSDVTLIATGPHPVLTAVETAE
                     ELARDGIDVAVLNMHTVKPLDREAIVAAATGTRGIVTVEEHWAAGGLGSAVAEVVADL
                     GAACPVRRVAVADRFAAGTGGHRHLLARNGISRATVTEHVRRLLA"
     misc_feature    complement(148019..148927)
                     /locus_tag="Sfla_0116"
                     /note="Transketolase, C-terminal subunit [Carbohydrate
                     transport and metabolism]; Region: COG3958"
                     /db_xref="CDD:226467"
     misc_feature    complement(148460..148924)
                     /locus_tag="Sfla_0116"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(148487..148489,148550..148555,
                     148601..148603,148610..148612,148688..148693,
                     148700..148702,148757..148765,148769..148774,
                     148781..148798,148802..148804,148811..148813,
                     148856..148858,148874..148876,148880..148882))
                     /locus_tag="Sfla_0116"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(148559..148561,148565..148570,
                     148574..148579,148604..148606,148610..148612,
                     148694..148696,148700..148705,148787..148795,
                     148802..148804,148856..148858))
                     /locus_tag="Sfla_0116"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(148700..148702,148712..148714,
                     148787..148789,148793..148795))
                     /locus_tag="Sfla_0116"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(148043..148414)
                     /locus_tag="Sfla_0116"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            complement(148966..149793)
                     /locus_tag="Sfla_0117"
                     /db_xref="GeneID:11369522"
     CDS             complement(148966..149793)
                     /locus_tag="Sfla_0117"
                     /inference="protein motif:PFAM:PF00456"
                     /note="PFAM: Transketolase domain-containing protein;
                     KEGG: cai:Caci_6294 transketolase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="YP_004921102.1"
                     /db_xref="GI:357409366"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="GeneID:11369522"
                     /translation="MSDDHARTARELIVRMCANPEGGHLGGSMSMVEILVTLYRHVLR
                     IDPDRPQAPDRDILLLSKGHGAIGLYAVLAERGFFPAELLASYGTPDSMFTAHPNPAV
                     PGVEMPTGSLGHGLSLGVGFALAARLDGSDRRCFVVLGDGELQEGSVWEAAMAAGSQK
                     LDRLVAIVDRNGLQISGDTEETMGLEPLGDRWRSFGWTVLEVDGHDPEQLRTALSRIP
                     CTPGTPTVLLARTVKGKGLPYIEGQARSHYVRLTERGYRRARAAVTRGERTETTCPS"
     misc_feature    complement(149014..149775)
                     /locus_tag="Sfla_0117"
                     /note="Thiamine pyrophosphate (TPP) family, Transketolase
                     (TK) subfamily, TPP-binding module; TK catalyzes the
                     transfer of a two-carbon unit from ketose phosphates to
                     aldose phosphates. In heterotrophic organisms, TK provides
                     a link between glycolysis and the...; Region: TPP_TK;
                     cd02012"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(149053..149055,149269..149271,
                     149275..149277,149281..149283,149356..149358,
                     149368..149373,149458..149460,149464..149466,
                     149602..149604))
                     /locus_tag="Sfla_0117"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(149221..149223,149269..149274,
                     149320..149322,149332..149334,149341..149346,
                     149353..149364,149452..149454,149458..149463,
                     149497..149499,149503..149508,149530..149532))
                     /locus_tag="Sfla_0117"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238970"
     gene            complement(149790..150854)
                     /locus_tag="Sfla_0118"
                     /db_xref="GeneID:11369523"
     CDS             complement(149790..150854)
                     /locus_tag="Sfla_0118"
                     /inference="protein motif:TFAM:TIGR01902"
                     /note="KEGG: cai:Caci_6288
                     N-acetyl-ornithine/N-acetyl-lysine deacetylase;
                     TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine deacetylase;
                     PFAM: peptidase M20"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
                     /protein_id="YP_004921103.1"
                     /db_xref="GI:357409367"
                     /db_xref="GO:0008270"
                     /db_xref="GO:0050897"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010175"
                     /db_xref="GeneID:11369523"
                     /translation="MTIFSDTAAIDLLHGMLKIPSPSFAEAELAAHVVAAMRGAGLTA
                     RVDGVGNAVGEIRRGPGPTVMLLGHMDTVPGDVPVRLDGDRLYGRGSVDAKGPLATMI
                     CAAANSTGFRGRIVVVGAVEEETTMSRGAMEIRRTHEPPDALIIGEPSGCDTVVLGYK
                     GKLDLRYDVRCEATHPSNVVPKASELAARAWTELLDLLGPEASHARFDSPGPTLTSIS
                     GGLDAATAEFSVRIPPGFDAGGLVAALSERLGPDTLQVVNTVRACRVDRNDPVVRALS
                     VAIRAEGGSPRAKVKTGTSDMNTLAERWTVPMATYGPGDSSLDHSDREHIKLSEYLFG
                     VGVLTRALTGLGEHLTGENR"
     misc_feature    complement(149820..150842)
                     /locus_tag="Sfla_0118"
                     /note="acetyl-lysine deacetylase; Provisional; Region:
                     PRK04443"
                     /db_xref="CDD:235299"
     misc_feature    complement(149820..150836)
                     /locus_tag="Sfla_0118"
                     /note="M20 Peptidase acetylornithine
                     deacetylase/acetyl-lysine deacetylase; Region:
                     M20_ArgE_LysK; cd05653"
                     /db_xref="CDD:193530"
     misc_feature    complement(order(149895..149897,150411..150413,
                     150483..150488,150576..150578,150648..150650))
                     /locus_tag="Sfla_0118"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193530"
     misc_feature    complement(order(149976..149978,150162..150164,
                     150168..150170,150192..150197,150213..150224,
                     150228..150230,150270..150272,150279..150284,
                     150288..150293,150300..150305,150309..150311,
                     150321..150332,150363..150365))
                     /locus_tag="Sfla_0118"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193530"
     gene            complement(150851..151672)
                     /locus_tag="Sfla_0119"
                     /db_xref="GeneID:11369524"
     CDS             complement(150851..151672)
                     /locus_tag="Sfla_0119"
                     /inference="protein motif:TFAM:TIGR00761"
                     /note="TIGRFAM: acetylglutamate kinase;
                     KEGG: cai:Caci_6305 acetylglutamate kinase;
                     PFAM: aspartate/glutamate/uridylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="YP_004921104.1"
                     /db_xref="GI:357409368"
                     /db_xref="GO:0003991"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR011148"
                     /db_xref="GeneID:11369524"
                     /translation="MRDILVVKCGGNAAVRSQAICADVAAVHRGGRPVILAHGGSADI
                     DGLAERLGVPSRRLVAPDGVSTRYTDERTLEVVQLALAGSAKPRLLAELRACGVDAVG
                     LTGLDAGLLVAARKSAHRAVVDGRRVVVRDDHSGRITAVNGDLVSTLLASGLLPVVSP
                     PAVAEDGRVVNTDADRAAAAVAGAVGADTLLLLTGARGVLADRHDERSVLPVCRVPRR
                     GTPPVVTGGMGIKLVAAREALLSGVRRVLIADGRRPRPVQEALAGSCTEVLLEEE"
     misc_feature    complement(150866..151660)
                     /locus_tag="Sfla_0119"
                     /note="Amino Acid Kinases (AAK) superfamily, catalytic
                     domain; present in such enzymes like N-acetylglutamate
                     kinase (NAGK), carbamate kinase (CK), aspartokinase (AK),
                     glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK
                     superfamily includes kinases that...; Region: AAK;
                     cl00452"
                     /db_xref="CDD:260430"
     misc_feature    complement(order(151073..151078,151085..151090,
                     151637..151645,151649..151651))
                     /locus_tag="Sfla_0119"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239033"
     misc_feature    complement(order(151148..151156,151550..151558,
                     151640..151645,151649..151651))
                     /locus_tag="Sfla_0119"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239033"
     gene            complement(151692..152723)
                     /locus_tag="Sfla_0120"
                     /db_xref="GeneID:11369525"
     CDS             complement(151692..152723)
                     /locus_tag="Sfla_0120"
                     /inference="protein motif:TFAM:TIGR01850"
                     /note="SMART: Semialdehyde dehydrogenase NAD - binding;
                     TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase;
                     KEGG: cai:Caci_6304 N-acetyl-gamma-glutamyl-phosphate
                     reductase;
                     PFAM: Semialdehyde dehydrogenase NAD - binding"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="YP_004921105.1"
                     /db_xref="GI:357409369"
                     /db_xref="GO:0003942"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="GeneID:11369525"
                     /translation="MLRVAIVGASGYIGGELLRLLLGHPRVTVVAATSDRLAGRRIDG
                     PHPNLRGHTDLCFVGHDTLENTDFDVLFLAAPHRETMGRMAAFLELARTVIDLSGDFR
                     LRDPEVYASYYGVAHAAPQLIPEFTTGLPEWHRARLTTSDRIAVPGCMATAGILAVRP
                     LALEGLIEGTVRVDARTGSSGSGVSAGAAGAHAERSGALRVFAPSGHRHEAEIAQATD
                     RTVRMTATGVEAVRGVQVLCQVELASGVSEKEIRSVFRAAYANEPFVRVIAQRQGLYR
                     LPEPKILTGSNFCDVGFAVSADDGTALLVGALDNLVKGGAGGAVQCMNVRFGWPERTG
                     LEFFGLHPN"
     misc_feature    complement(151698..152723)
                     /locus_tag="Sfla_0120"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Validated; Region: argC; PRK00436"
                     /db_xref="CDD:234761"
     misc_feature    complement(152310..152717)
                     /locus_tag="Sfla_0120"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; smart00859"
                     /db_xref="CDD:214863"
     gene            complement(152711..153577)
                     /locus_tag="Sfla_0121"
                     /db_xref="GeneID:11369526"
     CDS             complement(152711..153577)
                     /locus_tag="Sfla_0121"
                     /inference="protein motif:TFAM:TIGR00768"
                     /note="KEGG: cai:Caci_6289 lysine biosynthesis enzyme
                     LysX;
                     TIGRFAM: alpha-L-glutamate ligase, RimK family;
                     PFAM: RimK domain protein ATP-grasp"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-L-glutamate ligase"
                     /protein_id="YP_004921106.1"
                     /db_xref="GI:357409370"
                     /db_xref="InterPro:IPR004666"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="GeneID:11369526"
                     /translation="MSPAEPFVVLASRVGASEKRILEALSRRGIAHRHIDSRTWWHPL
                     GDRGAHPIVLNREIGLARATYAAEALEAAGSIVVNSARATALCGDKWRTSAALVEAGL
                     PTPRTALGLTPEAALTALESIGYPAVVKPLQGSWGRLVSALPDRQTAETVLEYVAALP
                     SPQARIVYLQEWIAKPGRDIRVIVVGGEALAATYRRSEHWRTNVARGAVSELCPMTPD
                     IAKLAVRAAQAVEAEIAGVDLIEDGTGELLVLEVNHGVEFSGLQQALGDAVSVADRIV
                     EFLLEKSRSCSE"
     misc_feature    complement(152726..153553)
                     /locus_tag="Sfla_0121"
                     /note="Lysine biosynthesis enzyme LysX; Region: LysX_arch;
                     TIGR02144"
                     /db_xref="CDD:131199"
     misc_feature    complement(152741..153316)
                     /locus_tag="Sfla_0121"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            complement(153574..153738)
                     /locus_tag="Sfla_0122"
                     /db_xref="GeneID:11369527"
     CDS             complement(153574..153738)
                     /locus_tag="Sfla_0122"
                     /inference="similar to AA sequence:KEGG:RoseRS_1058"
                     /note="KEGG: rrs:RoseRS_1058 lysine biosynthesis protein
                     LysW"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysW"
                     /protein_id="YP_004921107.1"
                     /db_xref="GI:357409371"
                     /db_xref="GeneID:11369527"
                     /translation="MVTCPECESSVVPAGTPVIGEIVECGECASELEILTLDPIRAAL
                     APEIEEDWGE"
     misc_feature    complement(153577..153735)
                     /locus_tag="Sfla_0122"
                     /note="Lysine biosynthesis protein LysW; Region: LysW;
                     cl11748"
                     /db_xref="CDD:264473"
     misc_feature    complement(order(153655..153657,153664..153666,
                     153718..153720,153727..153729))
                     /locus_tag="Sfla_0122"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260118"
     misc_feature    complement(order(153577..153594,153601..153603,
                     153610..153612,153634..153636,153640..153642,
                     153652..153657,153673..153684,153691..153693,
                     153715..153723))
                     /locus_tag="Sfla_0122"
                     /note="ArgX binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:260118"
     misc_feature    complement(153577..153579)
                     /locus_tag="Sfla_0122"
                     /note="AAA attachment site [active]"
                     /db_xref="CDD:260118"
     gene            complement(153824..155332)
                     /locus_tag="Sfla_0123"
                     /db_xref="GeneID:11369528"
     CDS             complement(153824..155332)
                     /locus_tag="Sfla_0123"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: amd:AMED_4758 XRE family transcriptional
                     regulator;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921108.1"
                     /db_xref="GI:357409372"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11369528"
                     /translation="MNNRLRNTVRGIGDREREVLGRTGGDTLGEIDRRMNTGPHAVVK
                     NVATGLLLSERAVAGPRQRLLSTRSEGPRESASFADLLKRHRGRSGLTQQQLADFATL
                     SVRAIRDLESGRVRRPRRESVGLLADALRLRDAERQQLHAAGGSPAHLRDALLGLPAS
                     SAPPALPEPPAPPGTLVGREAELQVLLDQVTVYGHRLVSVVGISGIGKTHLVLEAARV
                     LRAKGWRVGWHASAGGTRCCGAHPAAGPDPGGPSPRTADPTADLVAAIGERHDLVVID
                     SGDASGPGGVDVGELLRRCPGLHVVVTGLTPRYLPGERVLPLTAMAVPEEAPGHDHVR
                     LAEVESVALFLSHMRRSQPGFRLREDNAHAVVRLCRWLDGVPRALEYAAGWCLVYPPE
                     LLLARAGRDFSLLSSPAGCGCQDLLSSVARSVDIVAQSCRSVLAEVADRPHWTVGDLD
                     HLVPDPAAALHALLVHGLVRPAGAHLPGRFTALQLVRLLHLRDRPPAAARAC"
     misc_feature    complement(<154925..155104)
                     /locus_tag="Sfla_0123"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(154925..155098)
                     /locus_tag="Sfla_0123"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(154997..154999,155072..155074,
                     155084..155086))
                     /locus_tag="Sfla_0123"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(155000..155002,155075..155077))
                     /locus_tag="Sfla_0123"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(154994..154999,155009..155011,
                     155018..155020,155051..155056))
                     /locus_tag="Sfla_0123"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(<154118..154783)
                     /locus_tag="Sfla_0123"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            complement(155444..155593)
                     /locus_tag="Sfla_0124"
                     /db_xref="GeneID:11369529"
     CDS             complement(155444..155593)
                     /locus_tag="Sfla_0124"
                     /inference="similar to AA sequence:KEGG:Gobs_4080"
                     /note="KEGG: gob:Gobs_4080  oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921109.1"
                     /db_xref="GI:357409373"
                     /db_xref="GeneID:11369529"
                     /translation="MKSVVVFVVTAFCALTIGAFAGTAAAEDGSAGVPVVSSTGPGGD
                     SGWGR"
     gene            156021..157211
                     /locus_tag="Sfla_0125"
                     /db_xref="GeneID:11369530"
     CDS             156021..157211
                     /locus_tag="Sfla_0125"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: ami:Amir_4452 transcriptional regulator, LuxR
                     family;
                     PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004921110.1"
                     /db_xref="GI:357409374"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:11369530"
                     /translation="MNPLPRLPVLIDTIRSFCGSTRPVREMFECDEGGARAHTGVKSE
                     GLMVEQQTDDNVFAVGDTLRAEEAAVYRWLALHGRLDPASMAEETGVDATAVSGAVER
                     LVRIGLVHRGEEGDDRLWAVDPHLVAAVTTAPVERAIAEQQTRLRLFQDQFAQLAVDY
                     DEGRRSASKDLETIPGLTHVRAALNRAAEQCREDMVTVQPGGTRPPEVLQDALRRDSQ
                     MLARGVRMRTVYHHTARFNSPSQAYVATASALGGEYRTAHQLVGRMIIFDRELAFMTR
                     RNDRLGAVVVREPSVVHFLYELFEQLWSQAQPFSDAATDGLEAVAKDLDRTILRLLAS
                     GLKDETIARRLGMSLRTTRKHIADMMQALGAESRFQAGVAVSARGLLNDDGEPDGAPT
                     TALA"
     misc_feature    156207..>156374
                     /locus_tag="Sfla_0125"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    156219..156392
                     /locus_tag="Sfla_0125"
                     /note="Sugar-specific transcriptional regulator TrmB;
                     Region: TrmB; cl17775"
                     /db_xref="CDD:266830"
     misc_feature    <156996..157169
                     /locus_tag="Sfla_0125"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    156996..157133
                     /locus_tag="Sfla_0125"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(157017..157019,157023..157025,157029..157031,
                     157122..157130)
                     /locus_tag="Sfla_0125"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     misc_feature    order(157029..157037,157059..157064,157068..157073,
                     157077..157091,157122..157124)
                     /locus_tag="Sfla_0125"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            complement(157242..157757)
                     /locus_tag="Sfla_0126"
                     /db_xref="GeneID:11369531"
     CDS             complement(157242..157757)
                     /locus_tag="Sfla_0126"
                     /inference="similar to AA sequence:KEGG:PA4021"
                     /note="KEGG: pae:PA4021 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921111.1"
                     /db_xref="GI:357409375"
                     /db_xref="GeneID:11369531"
                     /translation="MPERRVLGQPLRSFVDELALCVAANGGRGPALSWPEDPMTLPAL
                     LELPRPARPAPGVNSTVPGGPGAEELAAELGRRLQLRVRPSFRFLSPDSPVVENVPNG
                     AESTVTVLEGACRCVLSRVGEDPAPGPSHPLGMRLRSGGTLFVPQVHTYRLSEIHVPT
                     TLLRLDLESPD"
     gene            complement(157974..158306)
                     /locus_tag="Sfla_0127"
                     /db_xref="GeneID:11369532"
     CDS             complement(157974..158306)
                     /locus_tag="Sfla_0127"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: cai:Caci_3452 transcriptional regulator, LuxR
                     family;
                     PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004921112.1"
                     /db_xref="GI:357409376"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:11369532"
                     /translation="MDSGMQDSCGERTPDCLIDRLREVVRVLSGREREVLAHIARGAT
                     YREIARRMDVSLHTVDTYIRRIRAKTGSRNRMHLLLLALSVEGSLVSAIEDLGLSVTP
                     KPPGRSPV"
     misc_feature    complement(158055..158225)
                     /locus_tag="Sfla_0127"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(158082..158084,158115..158129,
                     158133..158138,158142..158147,158169..158177,
                     158214..158222))
                     /locus_tag="Sfla_0127"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(158055..158060,158067..158069,
                     158076..158084,158175..158177,158181..158183,
                     158187..158189))
                     /locus_tag="Sfla_0127"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(158363..158521)
                     /locus_tag="Sfla_0128"
                     /db_xref="GeneID:11369533"
     CDS             complement(158363..158521)
                     /locus_tag="Sfla_0128"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921113.1"
                     /db_xref="GI:357409377"
                     /db_xref="GeneID:11369533"
                     /translation="MKSARVRVVAVLRAPMIGTLAGTAAAETGGAGTMASCSLVPGDD
                     NGWGRDPR"
     gene            159000..160241
                     /locus_tag="Sfla_0129"
                     /db_xref="GeneID:11369534"
     CDS             159000..160241
                     /locus_tag="Sfla_0129"
                     /inference="protein motif:PRIAM:3.2.1.39"
                     /note="KEGG: kfl:Kfla_5574 glucan
                     endo-1,3-beta-D-glucosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucan endo-1,3-beta-D-glucosidase"
                     /protein_id="YP_004921114.1"
                     /db_xref="GI:357409378"
                     /db_xref="GeneID:11369534"
                     /translation="MSANLLSAPRTRRARRARVRPAALVAALALAGGSLVVTQVTAAT
                     EAAAVPTTIPLTLTNNSGRGEQVHVYVIGTELSSGRQGWADASGAFHPWPAGGNPPTP
                     APDASIAGPANGQSKTIRMPKFSGRVYFSYGQKLVFKLTTGGLVQPAVQNPSDPNANI
                     LFNWTEYTLNDAGLWINSTQVDMFSAPYAVGVKRPNGTTLATGHLKPGGYKAFFDSLR
                     SQPGGWGGLIKTRSDGTILRALAPGHGIEAGALPASVMNDYVNRVWSKYSSQTLTVQP
                     FKDQPNTKYFGRVQGNTMNFTNSSGAVVTSFQKPDSDSIFGCYKLLDAPNDLVRGPIS
                     RTLCAGYNRSTLLSNPNQPDANNANFYKDAVTNHYSAKVHAQMADGKAYGFAFDDVGA
                     HESLVHEGDPQQAYITLDPFN"
     misc_feature    159156..160229
                     /locus_tag="Sfla_0129"
                     /note="glycoside hydrolase family 64:
                     laminaripentaose-producing, beta-1,3-glucanase
                     (LPHase)-like; Region: GH64-LPHase-like; cd09216"
                     /db_xref="CDD:185755"
     misc_feature    order(159495..159503,159507..159509,159522..159530,
                     159534..159536,159540..159545,159948..159953,
                     160146..160148,160155..160160,160185..160187)
                     /locus_tag="Sfla_0129"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:185755"
     misc_feature    order(159495..159497,159543..159545)
                     /locus_tag="Sfla_0129"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185755"
     gene            160486..161022
                     /locus_tag="Sfla_0130"
                     /db_xref="GeneID:11369535"
     CDS             160486..161022
                     /locus_tag="Sfla_0130"
                     /inference="protein motif:PFAM:PF01872"
                     /note="PFAM: bifunctional deaminase-reductase domain
                     protein;
                     KEGG: sro:Sros_3264 deaminase-reductase domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase/reductase domain-containing protein"
                     /protein_id="YP_004921115.1"
                     /db_xref="GI:357409379"
                     /db_xref="GO:0008703"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="GeneID:11369535"
                     /translation="MSDTSTGKVVVNRVMSLDGFIAGPGHTMDWIFEHMTSATFPEVM
                     AATGAMLIGRGTYEVGKRMSAENTGYDGGAQFVLTHRPPDEPDPEVTFLTCDIEEAVA
                     RAHRAAGDKNLEILGADVAAQCLQRGLVDEILVYVLPVLLGDGVRFAPPGLHRIDLEP
                     LGNVQSGGVTMLRFRVRT"
     misc_feature    160528..160944
                     /locus_tag="Sfla_0130"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cl17426"
                     /db_xref="CDD:266674"
     gene            complement(161153..161653)
                     /locus_tag="Sfla_0131"
                     /db_xref="GeneID:11369536"
     CDS             complement(161153..161653)
                     /locus_tag="Sfla_0131"
                     /inference="similar to AA sequence:KEGG:SAV_1114"
                     /note="KEGG: sma:SAV_1114 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921116.1"
                     /db_xref="GI:357409380"
                     /db_xref="GeneID:11369536"
                     /translation="MDTTPEAVHRRIAAALAAFVAVGAAVSGFLLNGSPTAAVWAVAG
                     GSGTALGMFMVRRRVLATLEESRGTAMELGYAEGIGDMVVVGLHAYAAAVFPMTGPGG
                     VSMAERLKRRDLAYQLTATEGLPHHVAERAAAALEAIDAGRDHERVQSALNDLMRAVH
                     EQRRRV"
     gene            complement(161714..162691)
                     /locus_tag="Sfla_0132"
                     /db_xref="GeneID:11369537"
     CDS             complement(161714..162691)
                     /locus_tag="Sfla_0132"
                     /inference="similar to AA sequence:KEGG:Clim_1318"
                     /note="KEGG: cli:Clim_1318 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921117.1"
                     /db_xref="GI:357409381"
                     /db_xref="GeneID:11369537"
                     /translation="MGNDDLRIAREAKARFGPQLLAHPDVDGVGVGRRRRAGDKTDEY
                     AVVVHLREKQPESKIPPARLLPAELRFTERSGRDVSVRVDVQQHPKPTPQTDRVRPVP
                     GGVSVGTVGAHVGSGTLGGWVWDTVTRQVVALSNAHVFGSRPGVSIIQPSSDDGGVTP
                     DDRIASVMRTGSLDAAIAEPADPSFVSASIVQGGPAVFEIAEATLDMRVQKTGRATGL
                     TFGTVDLIDFDSDYRGSHSDLWIDAEGADFSLGGDSGALYLLAPGSAAFATGRRQAVG
                     LHWGGSGQDGVGHHIRAVFDDLKLSTLPSGTGVPAVDGITEPDRSMRPG"
     gene            complement(162710..163060)
                     /locus_tag="Sfla_0133"
                     /db_xref="GeneID:11369538"
     CDS             complement(162710..163060)
                     /locus_tag="Sfla_0133"
                     /inference="similar to AA sequence:KEGG:AZL_010740"
                     /note="KEGG: azl:AZL_010740 acetyl-CoA carboxylase biotin
                     carboxyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921118.1"
                     /db_xref="GI:357409382"
                     /db_xref="GeneID:11369538"
                     /translation="MGTYVDQAKGDGELLADVPVDTFRSHIRFIEKHNLWDEVRGALA
                     EAGVDTVAMDIRPVRVISELVAAKGSALPEEADHSGAVVTPECGCDSISGRPPVTPVG
                     GGDAGAGDAGARPQ"
     gene            163370..163834
                     /locus_tag="Sfla_0134"
                     /db_xref="GeneID:11369539"
     CDS             163370..163834
                     /locus_tag="Sfla_0134"
                     /inference="similar to AA sequence:KEGG:100182028"
                     /note="KEGG: cin:100182028 similar to capping protein
                     (actin filament) muscle Z-line, alpha 1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921119.1"
                     /db_xref="GI:357409383"
                     /db_xref="GeneID:11369539"
                     /translation="MKLSYDEIVQMLRDRPERTRTYEVESGVIERLPSDTPACLRPMD
                     EDEVQELADYLRVAPSLLHGPFHVVDHTCSSCARTTTFLDFVKTAVDARLHSRDTLRS
                     VLTDDEAAWVTVRGQDGGRPVVCANCGNTLLGALKCGGGEYSEYSSGTYAYA"
     gene            complement(164000..165859)
                     /locus_tag="Sfla_0135"
                     /db_xref="GeneID:11369540"
     CDS             complement(164000..165859)
                     /locus_tag="Sfla_0135"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: avi:Avi_1054 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004921120.1"
                     /db_xref="GI:357409384"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:11369540"
                     /translation="MRFLVIVPVSPSAAGSLTGSGISYRPDLHTAQDSTLAGALSEMC
                     PQVLVTDRPVAREVLRLWREAMPERPIAVVRLTESHGSLRRLPTMHGRATSAILPFSI
                     PMYTVPRQPGSDGGVDEDASVFEALAVAERFAQDREQTTEPFPVTATPSGAASGRTSV
                     LMIGGGVVNLVTARLLQAEGYEVAMVDAAPDPRAGRPWAAYGASRGGGNARMFTYTEM
                     DDYHAKSTDESACMTVFDRPPSESGWDVRGHEGEEDQQWVQDFRSVPPWLARAYNGDI
                     LGLNRRGGELWQTWMHTRPHLFDDVELRHDILRLYQDGPHLEAARHRQNAVGATVASY
                     GAAEVRERFPALAHAAPQAFAGGIVVEGFTVNVHDLMGRLLDDLEAGGARMRFDLRVE
                     EIMRDGTSAVTGVLTADGPLVYDHYVVSPGAGNEALRRQIPSLRQVHGVLGCWATVPN
                     VTPALGHSLKVARRGHVAEDANITVGRDDSGESVLMIGSGYGWTGGDPRNIDERKIED
                     IHAAVADTVETLFPDAYEKIGGRDGLRRTQRHCVRPWTASNLGIFEASAAAGGAFVVT
                     AGHNTGGFAQAPVIAEAVSHALRGVGHPMHTLYHPLRTSRVLHAMAGLGGTTH"
     misc_feature    complement(<165167..165388)
                     /locus_tag="Sfla_0135"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(164102..165382)
                     /locus_tag="Sfla_0135"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    complement(164084..>164923)
                     /locus_tag="Sfla_0135"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(165847..167196)
                     /locus_tag="Sfla_0136"
                     /db_xref="GeneID:11369541"
     CDS             complement(165847..167196)
                     /locus_tag="Sfla_0136"
                     /inference="protein motif:TFAM:TIGR01048"
                     /note="KEGG: sth:STH1810 diaminopimelate decarboxylase;
                     TIGRFAM: diaminopimelate decarboxylase;
                     PFAM: Orn/DAP/Arg decarboxylase 2"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="YP_004921121.1"
                     /db_xref="GI:357409385"
                     /db_xref="GO:0008836"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002986"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11369541"
                     /translation="MHTYGTQTVNSRGHLEIGGCDVLDLAKAYGTPVYVIDESAVRDR
                     CRSYLRAFRSKWPHVDVAYASKAFLVGEMVRLAAEEGLSLDVVSAGELRLALWAGASP
                     SKITFHGNYKTGEDIELAVCSRVRSLVIDCLDEIDLIDRQAREHGRVQDVDIRLNLGI
                     DIHTDPKYTTGDEASKFGLPVRRGDAASAVARVLTRDHLRLRGLHFHLGAQVLDTKYH
                     RQALNEVGEFVRTVTARTPWKPQSITVGGGMGVNYDGVSSPPPPSEWARDLLSVFGEQ
                     VAPYCAPDVVFGVEPGRSVIAEAGSTLYTVGPTKRSGDRRLVAVDGGLSDNPRPLMYQ
                     SVHNVVLASNPELRDTELHEATIFGRHCETDRLIDGVRLPDLPPGEVLAVQCTGAYTH
                     SMFNQHNRFDKPPVVFVRDGRSRLVVRRERFSDTILTEIRSAAADSSDRPGEKQCAF"
     misc_feature    complement(165904..167175)
                     /locus_tag="Sfla_0136"
                     /note="diaminopimelate decarboxylase; Region: lysA;
                     TIGR01048"
                     /db_xref="CDD:233248"
     misc_feature    complement(165970..167112)
                     /locus_tag="Sfla_0136"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Diaminopimelate Decarboxylase; Region:
                     PLPDE_III_DapDC; cd06828"
                     /db_xref="CDD:143501"
     misc_feature    complement(order(166003..166005,166015..166017,
                     166027..166029,166111..166113,166198..166200,
                     166210..166212,166318..166329,166453..166458,
                     166567..166569,166576..166578,166582..166584,
                     166732..166734,166873..166875,166942..166944,
                     166999..167001,167005..167007))
                     /locus_tag="Sfla_0136"
                     /note="active site"
                     /db_xref="CDD:143501"
     misc_feature    complement(order(166027..166029,166111..166113,
                     166318..166329,166453..166458,166567..166569,
                     166576..166578,166582..166584,166732..166734,
                     166873..166875,166942..166944,166999..167001,
                     167005..167007))
                     /locus_tag="Sfla_0136"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143501"
     misc_feature    complement(order(166003..166005,166015..166017,
                     166027..166029,166108..166113,166198..166200,
                     166210..166212,166318..166320,166567..166569,
                     166576..166578,166999..167001))
                     /locus_tag="Sfla_0136"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143501"
     misc_feature    complement(order(166111..166113,166999..167001))
                     /locus_tag="Sfla_0136"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143501"
     misc_feature    complement(order(165988..165990,165997..166008,
                     166012..166020,166102..166104,166105..166122,
                     166240..166242,166246..166248,166267..166269,
                     166273..166275,166663..166674,166795..166797,
                     166804..166806,166849..166851,166861..166869,
                     166924..166929,166933..166938,166981..166986))
                     /locus_tag="Sfla_0136"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143501"
     gene            complement(167335..168543)
                     /locus_tag="Sfla_0137"
                     /db_xref="GeneID:11369542"
     CDS             complement(167335..168543)
                     /locus_tag="Sfla_0137"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: amd:AMED_9054 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004921122.1"
                     /db_xref="GI:357409386"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11369542"
                     /translation="MHATSLRAGSDPKPKLFTTPWWWRWALGTCFARITEPMATLALI
                     SLGTFVSGYSYGAFLVSVYAFTGALTATTSGKLIDRAARPRRLVLIMTSSSFLLHVAL
                     AAFGTFRLSTVLITVTTALCAALPGGIPGLSRSVLVRYADPRLRNLAFSWDSIMTEAG
                     WILGPVVIAGLALTGLPWVEVAAMAVTFLGVQLFLGPLVGGDKGTPPDAATTAPGSLW
                     SYRTAWPGLVDSVSIGMAVTGVVSALPVLLPRAGASPAWSGILVSLLAATGIAGTLVY
                     GKTAGRIPLHITVQSLLTLIGVLTTVVALAFSDSALSVAVWVGLSGFFITPFNTQRSI
                     SLEASIPPALHTQGFSAQFALFGLGSAISAGMLALISGVTAALLAIAGFALLISAVTH
                     GAVRKEIFTA"
     misc_feature    complement(167371..168375)
                     /locus_tag="Sfla_0137"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(167452..168372)
                     /locus_tag="Sfla_0137"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(167464..167466,167473..167478,
                     167485..167490,167497..167502,167533..167535,
                     167542..167547,167557..167559,167566..167571,
                     167578..167580,167725..167727,167737..167739,
                     167746..167748,167758..167760,167770..167772,
                     167809..167811,167818..167823,167830..167835,
                     167842..167844,168061..168063,168079..168084,
                     168091..168096,168130..168132,168139..168144,
                     168151..168156,168163..168168,168319..168324,
                     168328..168333,168343..168345,168352..168357,
                     168364..168366))
                     /locus_tag="Sfla_0137"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(168923..170113)
                     /locus_tag="Sfla_0138"
                     /db_xref="GeneID:11369543"
     CDS             complement(168923..170113)
                     /locus_tag="Sfla_0138"
                     /inference="protein motif:PFAM:PF00067"
                     /note="PFAM: cytochrome P450;
                     KEGG: sgr:SGR_810  cytochrome P450"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004921123.1"
                     /db_xref="GI:357409387"
                     /db_xref="GO:0004497"
                     /db_xref="GO:0005506"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0020037"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002397"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="GeneID:11369543"
                     /translation="MTATEPAPPAQVPMHRLHFDVPGPPRPAELPGGAPAWLVSRYAD
                     VRQVLSDPRFGRALLYAPDAPALSDVPDLVNSPDLMFNQDGPDHLRLRRTLRRAFTPR
                     AVARWRPWIAAIVEDLLDRLEASPQPVDVVAEFTLPLPVAVISRLMGLDEPARDRMRY
                     WSEHAFSDGTHDSRQVADALAEFRAFGADLLTERRRAPGDDLISGLVAAADQEGGVPE
                     SRLVGLVCGLVVGGHDSTMTMLGNALLYLLGERPETWPRLGADEQAAGHLVDRIIHLV
                     PLGDDRGSARHAATDVEVGGVTIPAGAIVLADCGMANRDPEVFPPGTLHDLFAPLEAP
                     TLSFGAGPHYCLGAWLARTELQLALHRLAARFPGLRLAEPVDTVSWRAGTTSRSPQRL
                     SVSR"
     misc_feature    complement(168926..170113)
                     /locus_tag="Sfla_0138"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(170163..171218)
                     /locus_tag="Sfla_0139"
                     /db_xref="GeneID:11369544"
     CDS             complement(170163..171218)
                     /locus_tag="Sfla_0139"
                     /inference="protein motif:PFAM:PF00107"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein;
                     KEGG: sgr:SGR_811  oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_004921124.1"
                     /db_xref="GI:357409388"
                     /db_xref="GO:0008270"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="GeneID:11369544"
                     /translation="MKIAKWVVREHVEGVPDVDRIYQKVVEDVDVALAPDEMLLRTRY
                     VSVDPYLQGIALDTPLGGHMGADSIMEVVDAGPDAAHRVGDLVQGFGGWRTHVISTGA
                     AEPWQTGTFPMVFPEFRRLDPGWYDDALPLPTALSVMGGPGMTAWGTLTKYMTISPGA
                     TLVVSGASGAVGALVGQLASIEGARVVGTTSSPEKADHLTALGFDAVIVHRHGDEAGT
                     VRDALAQAAPDGVDRYFDNLGGTVTDAVFPLLNVGAQVAVCWQWATQVGNEHTGPRLL
                     PYLMFPRATVRGIFSPEWFTEENWRDLHDELGGRVRRGEVVCDHTLHHGFDSIPAAYA
                     SLYAGHAANRGKVLIEL"
     misc_feature    complement(170166..171218)
                     /locus_tag="Sfla_0139"
                     /note="Putative NADP-dependent oxidoreductases [General
                     function prediction only]; Region: COG2130"
                     /db_xref="CDD:225041"
     misc_feature    complement(170172..171203)
                     /locus_tag="Sfla_0139"
                     /note="Prostaglandin dehydrogenases; Region: PGDH;
                     cd05288"
                     /db_xref="CDD:176190"
     misc_feature    complement(order(170190..170192,170202..170204,
                     170208..170213,170346..170354,170424..170426,
                     170430..170444,170505..170510,170589..170591,
                     170634..170636,170646..170651,170706..170714,
                     170784..170786,170796..170798,171072..171074))
                     /locus_tag="Sfla_0139"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176190"
     misc_feature    complement(order(170343..170345,170424..170426,
                     171069..171071))
                     /locus_tag="Sfla_0139"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176190"
     misc_feature    complement(order(170340..170342,170349..170372,
                     170379..170384,170427..170429,170436..170447,
                     170460..170462,171048..171050,171060..171062))
                     /locus_tag="Sfla_0139"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176190"
     gene            complement(171215..172936)
                     /locus_tag="Sfla_0140"
                     /db_xref="GeneID:11369545"
     CDS             complement(171215..172936)
                     /locus_tag="Sfla_0140"
                     /inference="protein motif:PFAM:PF01593"
                     /note="PFAM: amine oxidase;
                     KEGG: sgr:SGR_812  FAD-dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="YP_004921125.1"
                     /db_xref="GI:357409389"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="GeneID:11369545"
                     /translation="MSRDTSRSRPGGAGARETMIIIGAGLGGLSTGCYAQMNGYRTRI
                     LEMHEMPGGCCTAWERGGFTLDACVSWLLGSGPGNEMHQIWLELGALQGKEIRHFDVF
                     NIVRGTDGRAVHFYSDPDRLEAHLIALSPADARLVRTFCRQLRSFRKALAVYPFLKPV
                     GLMGRRERWRMLASFLPYFNSVRTTISVLMSDFSARFEDPLLREAFNFILYEKHPAFP
                     VLPFHFQLASHANLSAGVPEGGSLGLAESIEARYRRLGGEVSYNTKVESVIVEDDRAV
                     GVRLSDGGELRADIVVSACDGYTTAMKFLDGAYLGEDYRRLYTETIHEPGMVFPGYFT
                     LFLGLSRPFPEGDPCTTYLLDDAMAAELTGIRHPSINVQFRSRHYPELSPHGTAVVYA
                     TYFCDIAPWRALDEGPEQVTRTRGGQELHTLPVRHGRGYYAAKRRAREALVDFLDRRH
                     PGLRDAVVVRDVSSPLTQVRYTGNHDGTVLGWQPFVESGETLEKLVKKHGPGLPGLRD
                     FYQSGVWATTGGLIRAAAAGRHVMQFVCRDDGRPFTASLDLTAPPPTHRVIPVPGRPA
                     APTERKS"
     misc_feature    complement(171311..172879)
                     /locus_tag="Sfla_0140"
                     /note="Phytoene dehydrogenase and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG1233"
                     /db_xref="CDD:224154"
     misc_feature    complement(171503..172879)
                     /locus_tag="Sfla_0140"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(172933..174615)
                     /locus_tag="Sfla_0141"
                     /db_xref="GeneID:11369546"
     CDS             complement(172933..174615)
                     /locus_tag="Sfla_0141"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: sgr:SGR_813  FAD-dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004921126.1"
                     /db_xref="GI:357409390"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:11369546"
                     /translation="MADDGRSDWTSRERAPGTPPRVIVIGAGVAGLSTGCYAQMSGAR
                     TRIFEKHVLPGGCCTAWSREGYLFDYCIEWLIGTAPGNDAHQVWSELGALDGKSVTNF
                     ELFNKVEDEHGRSVTFYNDPGRLETHLLELSPADAPHIRAFTRDLRRFIDIELYPFLT
                     APALRTVRERAGTLRTVLPAFRLFWRTAATPMHVFADRFEDPLLRKAFRNIFFQDPGG
                     FPLLPYLFNMAAAHHGNAGFPQGGSLGLARSVEERYRSLGGTVTYRARTERILVENDR
                     AVGIELRNGKRYFAEHVVSACDGHTTVYGLLGGRYTGPRIDKLYTDLLHRPGTLFPAV
                     VSAFVGLRGDLDPDEAHSTTHLLGPDDADHLPGALQDSLVVQARSRYSGGFAPPGHSV
                     LHCTYFSDYAHWKDLRTRNRKEYRRRKREVADFVRDFLERRTPGIADRIDVMEVATPA
                     TTHRYTGNLGGSILAWKAFSDADDVAARLVGKDRMRLPGLDGFSMAGQWIGMGGLIRA
                     ASTGRFAVQYLCRELGLEFRAWESKGAEPWHPGKLGHLPQLDRWSARGSEES"
     misc_feature    complement(173065..174558)
                     /locus_tag="Sfla_0141"
                     /note="Phytoene dehydrogenase and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG1233"
                     /db_xref="CDD:224154"
     misc_feature    complement(173230..174552)
                     /locus_tag="Sfla_0141"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(174605..184066)
                     /locus_tag="Sfla_0142"
                     /db_xref="GeneID:11369547"
     CDS             complement(174605..184066)
                     /locus_tag="Sfla_0142"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: sgr:SGR_814  NRPS-type-I PKS fusion protein;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase; Beta-ketoacyl
                     synthase ; Acyl transferase; KR domain protein;
                     phosphopantetheine-binding; condensation domain protein;
                     Thioesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921127.1"
                     /db_xref="GI:357409391"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369547"
                     /translation="MSDANNRASRAKVAIVGMGCRLPGGASDHRAFWRNLVAGKDCIT
                     PTPPDRYDVGTLGSRHRDKPGRLVGGRGGYIDGFDEFDPAFFGISPREADHMDPQQRK
                     LLEVAWEALEDGGQRPADLAGGNVAVYVGAFTLDYKILQFADLGLTSLAAHTATGTMM
                     TMVSNRISYCFDFRGPSLSVDTACSSSLVAVHLACQALNNGESDLALAGGTLLHMAPQ
                     YTVAETKGGFLSPEGRSRTFDAAADGYVRAEGVGLVALKRLDDAVRDGDRIHAVVLGS
                     GVNQDGRTNGITVPNADAQVDLILRVCAQAGITPGDLQYMEAHGTSTPVGDPIEANAL
                     ARALAVGRAPGARAYVGSVKTNIGHTESAAGIAGLIKTVLSLKNRTIPPHINLENLNP
                     AIDKAALPYEIPTRPTEWPDHEGPARAGVNSFGFGGTNAHVVLEEAPAPPPGSRTAPP
                     VARPWSILPLSARDPDALKEMAAGIRGELAGDDGPAVALDDLGHTLAHRRQHLPERLS
                     VVYSTRDSLDEGLAAHERGEPHPRVVHGRAREAADRRQAWVFTGMGPQWWGMGRQLLE
                     KEPVFRDAVAACDRAMREFADWSLMEEMTADESVSRMSETWLAQPANFAVQVALAALW
                     RSHGVRPDAVVGHSTGEIAAFHAAGVYSLRDAARIVVHRSRLQQTLAGTGTMLAVSLS
                     EEEAERRVRPYCDRVSVAAVNSPTAITLAGDEEALTLLAEELRAEQQFAKFLAVEVPY
                     HSVGMERIRDELLAALDPLEPHPAQVPLYLTGMEGTARGTELHAAYWWRNVRDRVRFR
                     SAVDRIAADGHHVFLEIGPHPVLGHAIRECLGTTGTSGLVLPSIRRQEDESERFAASL
                     GSLHTLGVPVDWKLLQPAGRPVTLPRHPFRRDRHWTEPRTVAQVRLGHRDHPLLGRRT
                     DATEPTWQARLDTEDLPYLADHRIQDTVVFPAAGYLEMAAQAVLRLTGGTTAVLADIE
                     LRKALFLPDGEDRTVEVSLSLENAAFTIASPAGDDGERAVHAGGVVRTAQRRRTTPPL
                     DAPTIRSRALRHLDGPDCYTALAALGYHYGPSFQAVEEVWIGPGEALSRIRPPRTIGD
                     DAAGHHLHPVLLDACFQTLLTPLVLEGPAPGTGIRLPLSLDEVALEPIGDQPLWAHAT
                     LLPGDGDTTLGNIALYADDGTPLGRVEGFRAADVEKAATAVARTTIDSWLTEPVWTDC
                     PPLPAHDTAAEPAAPGPGTVRNEPPGAAGLPHPGDGPAAAARDHGWLILADTGGVADA
                     FAALAAARGERCRLVRRGPAYTASADGSTYTVDPASDSGLRRLLADLDRDGGPFRGTV
                     LHLWNLDAPALAACDRDTLRDHTGAGAYSLVVLARLLAARGGGGRLHIVTRGAQPALP
                     GEGPEPLGAPAWGIGRVLRHQELIGHPGKLVDLDPRRQQGPEGDRADAEALLAEALSD
                     DEEEIALRHGGRRTSRLRPAEALTRPLPLRLRADGSYLVTGAFGALGRLLCRTLVRRG
                     ARRLVLVGRTPVPPRAAWAAVDPATAEGRAVHLLRELEALGARPVLATLDITEEDALA
                     DWLDAHRRSGAPPVRGVFHLAGQVRDTLVADLDRDTFDTVHDPKTVGAHLLHRHLRDE
                     PLDHFVLFASIASLLTTAGQTNYAAGNAFLDALAHHRRAQGLPGLSLDWGPWATGMIE
                     ELGLVDHYLHSRGMSSLSPDAGMAVLERVIGQDHAQLVVATVVDWPAFLAWYPSPPPL
                     VADLAAAASPPRDAVSGNGFLDSFRAADPQTRRALVAERFAALAATVLRTGADRIDPA
                     AGLGELGLDSLLAMELRARVHAELGVALPLVALLSGSPAGELATQLHDGLSAQASADG
                     PGGEAGAVELHTDERTYPLTQNQKALWFLKHLNPDGHAYNIGGAVQVDVALEPDLMFE
                     AVRRLIARHPALRTNFSLVDGQAVQRVSEDGPNDLALFDVQGEDWESIHATIVQEYRK
                     PYDLARDPLVRFRLFKRGPDRWIIMKAVHHIVSDAISTFTFIDELLAVYEALRRNQEP
                     RLPPVEARYLDFLNQQNAFLAGPEAAGMLDYWRSHLPAEVPLLDLPVDKPRPSVQTHN
                     GASEFFVLDAGLSARVHALARTHGVTPFMVLLSAYYLLLHRYSGQEHIVVGSPVTGRT
                     RQDFASVYGYFVNPLPLHADLSEDPTVAELLQQVRRTVLGGLDNQEYPFVLLVEQLGL
                     QHDPSRSAVFQAMFILLTHKVAAEQYGYRLEYIELPEEEGQFDVTLSAYEDEAEGRFH
                     CVLKYNTDLFLPETMRRMAAHYTRLLDRMTRAPGERPTSRLEMLGGRERAQLIEEWSR
                     PDLPLTGSDGGEPFTPVQTLIGRIAAAHPTAVAVSTPSRSGEAHRLTYAELDRRADDT
                     AARLRTLGVGEGSVVVLCLEKSPELIVVLLAVLRAGAAYLPLRPDHPADRLAHLVPAT
                     GADLVVVADDTVPERTGALTVPVLTLAALARTAPHPHGPVAATGPDSPAYVITTSGST
                     GRPKAVRVSHRNLASAYAAWRQVYRLDTDVRVHLQMAEPSFDVFTGDLVRALCSGGTL
                     VLADRDLLFDTTRLHRTMRQEQVDCAEFVPAVVRGLMDHCAREGLTLDFLRLLVVGSD
                     AWSVGEYRRLAGLCGPGTRLVNSYGLTEATIDSAWFEGPVDDLEPGAMVPIGRPLPDS
                     TLHVLDLHGEPVPPGVPGELWIGGPGVALGYAGDPEQTGERFVTRTLARDTGARPERL
                     YRTGDIARWDTRGRVHLLGRTDGQVKLRGHRIEIGEVEAHLAQWPPLARAVVTVRTDT
                     GGEAALCAYCVPEPGAALDVRALRRHLARSLPSYMIPSHYVELPALPLTANGKVDTAA
                     LPAPRAEAGDRPHEEPATLYEIGVARHWKTLLGCERVGLEDDFFELGGSSVKLIELLH
                     HLRTEFGVGVPVSRLYQGTTLHGMAATVEDVLHSTGTDELPCLTFNPGQHPALFCFPP
                     AGGHGLVYRGLATHLPDHTVIGFNYLPGDDKTARYADLIEAAQPEGACLLLGYSLGGN
                     LAFETAKELERRGRRVAHVVILDSRRILTAYEPDATGIAAFESELAEHLRRHTGSEAV
                     TQETLAHAAEYLAFCGRTPNTGTVTATVTVITDEDKAALYAAGERGTWHGSSTTATAA
                     LRGSGRHADMLDAKHLRRNAELVRSVLKGDAAHGG"
     misc_feature    complement(180854..184030)
                     /locus_tag="Sfla_0142"
                     /note="Polyketide synthase modules and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG3321"
                     /db_xref="CDD:225858"
     misc_feature    complement(182762..184030)
                     /locus_tag="Sfla_0142"
                     /note="polyketide synthases (PKSs) polymerize simple fatty
                     acids into a large variety of different products, called
                     polyketides, by successive decarboxylating Claisen
                     condensations. PKSs can be divided into 2 groups, modular
                     type I PKSs consisting of one or...; Region: PKS; cd00833"
                     /db_xref="CDD:238429"
     misc_feature    complement(order(182990..182992,183110..183112,
                     183515..183517))
                     /locus_tag="Sfla_0142"
                     /note="active site"
                     /db_xref="CDD:238429"
     misc_feature    complement(181535..182422)
                     /locus_tag="Sfla_0142"
                     /note="Acyl transferase domain in polyketide synthase
                     (PKS) enzymes; Region: PKS_AT; smart00827"
                     /db_xref="CDD:214838"
     misc_feature    complement(180515..181348)
                     /locus_tag="Sfla_0142"
                     /note="Polyketide synthase dehydratase; Region: PS-DH;
                     pfam14765"
                     /db_xref="CDD:258902"
     misc_feature    complement(178928..180130)
                     /locus_tag="Sfla_0142"
                     /note="beta-ketoacyl reductase (KR) domain of fatty acid
                     synthase (FAS), subgroup 2, complex (x); Region:
                     KR_2_FAS_SDR_x; cd08955"
                     /db_xref="CDD:187658"
     misc_feature    complement(179111..179656)
                     /locus_tag="Sfla_0142"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    complement(order(179084..179089,179168..179170,
                     179210..179215,179279..179284,179345..179353,
                     179429..179440,179552..179563,179621..179623,
                     179627..179632))
                     /locus_tag="Sfla_0142"
                     /note="putative NADP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187658"
     misc_feature    complement(order(179156..179158,179168..179170,
                     179207..179209,179279..179281))
                     /locus_tag="Sfla_0142"
                     /note="active site"
                     /db_xref="CDD:187658"
     misc_feature    complement(178565..178816)
                     /locus_tag="Sfla_0142"
                     /note="Phosphopantetheine attachment site; Region: PKS_PP;
                     smart00823"
                     /db_xref="CDD:214834"
     misc_feature    complement(177605..178504)
                     /locus_tag="Sfla_0142"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:250042"
     misc_feature    complement(175802..177823)
                     /locus_tag="Sfla_0142"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(177269..177544)
                     /locus_tag="Sfla_0142"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    complement(175580..177064)
                     /locus_tag="Sfla_0142"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(176615..176620,176624..176641,
                     176648..176650))
                     /locus_tag="Sfla_0142"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(175598..175600,175871..175873,
                     175880..175882,175916..175918,176126..176128,
                     176198..176215,176279..176284,176636..176641))
                     /locus_tag="Sfla_0142"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(175325..175513)
                     /locus_tag="Sfla_0142"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(174629..175258)
                     /locus_tag="Sfla_0142"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(184110..185051)
                     /locus_tag="Sfla_0143"
                     /db_xref="GeneID:11369548"
     CDS             complement(184110..185051)
                     /locus_tag="Sfla_0143"
                     /inference="protein motif:PFAM:PF04116"
                     /note="PFAM: fatty acid hydroxylase;
                     KEGG: sgr:SGR_815 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid hydroxylase"
                     /protein_id="YP_004921128.1"
                     /db_xref="GI:357409392"
                     /db_xref="GO:0005506"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="GeneID:11369548"
                     /translation="MDECEHATDGKEISVGYSVSRKGAADNSAARILRVAVYPALLLS
                     VVLVGVFAVRHQWDPARVSPLFLLGVIGYLVLLERLIPYDRNWHPEKKEWRHYGIYFL
                     LTMAGSGLAQWLVALAVGLISPADPICHLGIEIPGALLTGSLASYLVHRLGHRNPLLW
                     RLHGIHHVPEKVNVANNGVNHVLDIVLAQGLVQLALAIVGFSRPAVLVVGLFVAAQGY
                     FVHANIDVRIGPLNHVLASPEQHRLHHSTDLAEAGHYGSDLSCWDHLLGTFTWRPGRE
                     PAAVGLRDPAAFPGTGEILAALLHPWRRRPAPGPRPE"
     misc_feature    complement(184191..184859)
                     /locus_tag="Sfla_0143"
                     /note="Sterol desaturase [Lipid metabolism]; Region: ERG3;
                     COG3000"
                     /db_xref="CDD:225546"
     misc_feature    complement(184314..184649)
                     /locus_tag="Sfla_0143"
                     /note="Fatty acid hydroxylase superfamily; Region:
                     FA_hydroxylase; pfam04116"
                     /db_xref="CDD:252387"
     gene            185760..186581
                     /locus_tag="Sfla_0144"
                     /db_xref="GeneID:11369549"
     CDS             185760..186581
                     /locus_tag="Sfla_0144"
                     /inference="protein motif:PFAM:PF04672"
                     /note="PFAM: protein of unknown function DUF574;
                     KEGG: amd:AMED_9039 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921129.1"
                     /db_xref="GI:357409393"
                     /db_xref="InterPro:IPR006764"
                     /db_xref="GeneID:11369549"
                     /translation="MPDRPVPSCVDATKPSIARVYDAFLGGADNYEVDREVVSSVLRT
                     AREAADLAVENRRFLIRACRYLAEHAGMTQFLDCGSGLPTAENTHTVVQGVNPDSRVV
                     YVDNDPLVLAHSRALLDRDESTVIVSENIFEPETLLRNDVVRSRLDWNAPIALLHMGT
                     LHHYNDEHARPRQDIMRSYIDALPPGSYVAISHFLDPEDEYSTTARRMEEVFLHSMMG
                     SGTFSTAAEIRKLFNGLELIAPGLVRCVDWLPEGPGPERLNAAQRCIAGAVALKR"
     misc_feature    185778..186578
                     /locus_tag="Sfla_0144"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            186632..188332
                     /locus_tag="Sfla_0145"
                     /db_xref="GeneID:11369550"
     CDS             186632..188332
                     /locus_tag="Sfla_0145"
                     /inference="similar to AA sequence:KEGG:Bcav_1111"
                     /note="KEGG: bcv:Bcav_1111 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921130.1"
                     /db_xref="GI:357409394"
                     /db_xref="GeneID:11369550"
                     /translation="MSRRRAPKGQGEGARRLWLLPDPGEDEPFIDVGKDGRGTLHVSV
                     AREGRHDDFRFVVTAHHIAVAERSALRRWAVFAVLFGELAVFHADAAPARPPATCQQV
                     IDTILGGTDSEVEHYLTRMNKRFLGGLRDSLALLSKTELTRSPDREAFEKRLWFGVEP
                     LIMSKAERARRAQETHRAAADREIAVRKIFEPYNDALLMAERDGVVQHVVELFGSNPV
                     ISEFQVGAPAHHDRYLTFGSGGEIMVRDGAVKAIFFHVQPTEAAQHGFTGLSTLIPGL
                     RQEASRSQVEDALGKPVVGRTGPSTTHSVGGGFVKVFYDTWAKKDAPNHLKLIQLTAE
                     DTYARTDPSDERCPCCAGMLVRTASASGGVDVGSTITALRHGVAAGRLRQAHRWVALQ
                     DMLSLHASGLMEHVAAHLECTICRRHMAFALHRDADPTFEYVSLNDIRRRTPEPVPPV
                     EQWGDADRIAREAQRPEQVATDGSSWILFAVGEQLFMNARCWYSAVDGSRLIRLEAAE
                     VRQYERDGEAYLSRLQKTINRTWTSEEDPWRSRDLTRGGMSNEEAIEASLATPQEEQA
                     "
     gene            complement(188449..188787)
                     /locus_tag="Sfla_0146"
                     /db_xref="GeneID:11369551"
     CDS             complement(188449..188787)
                     /locus_tag="Sfla_0146"
                     /inference="similar to AA sequence:KEGG:Bcenmc03_6573"
                     /note="KEGG: bcm:Bcenmc03_6573 inner-membrane
                     translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004921131.1"
                     /db_xref="GI:357409395"
                     /db_xref="GeneID:11369551"
                     /translation="MPERAGKQPSARESAVTAGCVLLLVLVADVAAALLVVILLAARG
                     LDRMDAGSGVTATGVPPLDWTPGVGFGALALAVGVTALVLLRIGHRVVGAVQLTLCGL
                     LTLHTLGSWP"
     gene            complement(189631..190527)
                     /locus_tag="Sfla_0147"
                     /db_xref="GeneID:11369552"
     CDS             complement(189631..190527)
                     /locus_tag="Sfla_0147"
                     /inference="protein motif:PFAM:PF00491"
                     /note="PFAM: Arginase/agmatinase/formiminoglutamase;
                     KEGG: svi:Svir_33400 agmatinase"
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="YP_004921132.1"
                     /db_xref="GI:357409396"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0046872"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="GeneID:11369552"
                     /translation="MERIPSPARSCARTLTFMRLPLDLDPTARDLVVLGVPYDESGWF
                     PGNRLGPGAVRSASAVAHVPGADRGPGTFDLVDCVDGGDLDLTPWISGAAPEVPYKRL
                     SHLLAGNAAVLLLGGSRSLTLAALRAVAEIHGPVALLHLAADPAGAHPQGDFLYQAID
                     ECLVDPAAVVRIGLRGAGYSGHAQGGLMLDVGRFGRLGVRGAADVARHRIARRPVYVS
                     VAVDVADPAFAPGTGIRVPGGLTSRELLGFLRCVGDLCPVGFEVTGMSPPQDRSGITT
                     ALASEIGGELIHQYARAQRILM"
     misc_feature    complement(189667..190482)
                     /locus_tag="Sfla_0147"
                     /note="Arginase-like and histone-like hydrolases; Region:
                     Arginase_HDAC; cl17011"
                     /db_xref="CDD:266496"
     misc_feature    complement(order(189736..189738,189862..189864,
                     189868..189870,190102..190104,190171..190173))
                     /locus_tag="Sfla_0147"
                     /note="active site"
                     /db_xref="CDD:212513"
     misc_feature    complement(order(189862..189864,190102..190104))
                     /locus_tag="Sfla_0147"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212513"
     gene            190837..191901
                     /locus_tag="Sfla_0148"
                     /db_xref="GeneID:11369553"
     CDS             190837..191901
                     /locus_tag="Sfla_0148"
                     /inference="protein motif:SMART:SM00849"
                     /note="SMART: beta-lactamase domain protein;
                     KEGG: svi:Svir_33300 predicted Zn-dependent hydrolase of
                     beta-lactamase fold protein"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="YP_004921133.1"
                     /db_xref="GI:357409397"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:11369553"
                     /translation="MMPEGNVSSTPSNRNRGETMSDRRTTLVGSVTGPSAAVTGAVPS
                     APPPAGRRRGPFSVGVRLRWLGVSGWEIVIHRGRHRRSILFDPYLSRMPFTDAQGVTE
                     HGIPLRLDPEAVEAVASRHLTGAPELILVSHGHFDHVADVPQLLARAEWQQSRVRVLC
                     DTTVSNLLAAMGTPRRRLADAVVVGGGEHLQFDGYTVEVFRSLHSRRPDYGYFAPGHR
                     LVPPPPPSVLGELVEGNTLAYQVSVEGGPSILLMGASNFAEREITGIRPDVAAVPMTT
                     TAAVHRYPGRLLSAVGNPRMLIPCHHDDMVTPLTGPAGPLRASVSEPSVRDLESAAGP
                     GSRVVAPRHLEAMDLVAALT"
     misc_feature    191011..191880
                     /locus_tag="Sfla_0148"
                     /note="Predicted Zn-dependent hydrolases of the
                     beta-lactamase fold [General function prediction only];
                     Region: COG2220"
                     /db_xref="CDD:225130"
     gene            complement(191894..193066)
                     /locus_tag="Sfla_0149"
                     /db_xref="GeneID:11369554"
     CDS             complement(191894..193066)
                     /locus_tag="Sfla_0149"
                     /inference="protein motif:PFAM:PF03576"
                     /note="PFAM: peptidase S58 DmpA;
                     KEGG: sgr:SGR_4282 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S58 DmpA"
                     /protein_id="YP_004921134.1"
                     /db_xref="GI:357409398"
                     /db_xref="InterPro:IPR005321"
                     /db_xref="GeneID:11369554"
                     /translation="MSGMRTPGPAPRVGLRNALTDVAGIRVGHATRTGDGWLTGVTAV
                     LAPEDGMVAAVDVRGGGPGTRETDALDPRNLVSRIDAVVLTGGSAFGLDAASGVAAWL
                     EERGRGFRVGAGPAQVVPVVPAAALFDLGRGGVWTARPGAELGREAVDRAAAGDEGAA
                     VPQGCVGAGTGAVAGGMKGGLGTASIVLPSGATVAALAAVNASGSLVDPVTGALHGAW
                     TEVGDEFRACGLHAPVPDTAVHTRAAERLAAARTESRRRQADEVRQLNTTLVVVATDA
                     ALTRPQAQKLAGTAHDGLARTIRPVHLLTDGDTVFALSTGRLPLAGADGDGDRTGWGA
                     HTEVTAANEILAAGADVVSRAVVHAALAARTTDTPGGVFPSYLDLYGTPGDGTSLR"
     misc_feature    complement(191990..193012)
                     /locus_tag="Sfla_0149"
                     /note="nylC-like family; composed of proteins with
                     similarity to Flavobacterium endo-type
                     6-aminohexanoate-oligomer hydrolase (EIII), the product of
                     the nylon oligomer degradation gene, nylC. EIII is an
                     amide hydrolase that catalyzes the degradation of...;
                     Region: nylC_like; cd02252"
                     /db_xref="CDD:239070"
     misc_feature    complement(order(192146..192151,192266..192268,
                     192464..192466,192470..192472,192683..192691))
                     /locus_tag="Sfla_0149"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239070"
     misc_feature    complement(192266..192271)
                     /locus_tag="Sfla_0149"
                     /note="cleavage site"
                     /db_xref="CDD:239070"
     gene            193214..193900
                     /locus_tag="Sfla_0150"
                     /db_xref="GeneID:11369555"
     CDS             193214..193900
                     /locus_tag="Sfla_0150"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: fre:Franean1_0325 NUDIX hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_004921135.1"
                     /db_xref="GI:357409399"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="GeneID:11369555"
                     /translation="MTDDGTNAPDDGLPPWLTGLVRRTEGEIPPELARYAGPAPAGAR
                     GSAVLVLFGTGARGPDLLFLRRSGSLRNYPDQVCFPGGSSAPADADHIRTALRETWEE
                     TGLDPSEVRIAGTVFPLHLGHSGFSVVPVLGWWGSGSEIAGDGEEIVSVHRVPLTELS
                     DPAARLLVRLPDGHLSPAFLVRNVFVWGLTAALTAWLLRLGGWERPWDTDRIEDLPDV
                     RRRYGGGPPP"
     misc_feature    193349..193804
                     /locus_tag="Sfla_0150"
                     /note="Coenzyme A pyrophosphatase (CoAse), a member of the
                     Nudix hydrolase superfamily, functions to catalyze the
                     elimination of oxidized inactive CoA, which can inhibit
                     CoA-utilizing enzymes. The need of CoAses mainly arises
                     under conditions of oxidative...; Region: CoAse; cd03426"
                     /db_xref="CDD:239518"
     misc_feature    order(193409..193411,193439..193441,193460..193462,
                     193502..193507,193589..193591)
                     /locus_tag="Sfla_0150"
                     /note="putative active site [active]"
                     /db_xref="CDD:239518"
     misc_feature    order(193409..193411,193439..193441,193460..193462,
                     193502..193504,193589..193591)
                     /locus_tag="Sfla_0150"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239518"
     misc_feature    193457..193528
                     /locus_tag="Sfla_0150"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239518"
     misc_feature    193505..193507
                     /locus_tag="Sfla_0150"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239518"
     gene            complement(193876..194754)
                     /locus_tag="Sfla_0151"
                     /db_xref="GeneID:11369556"
     CDS             complement(193876..194754)
                     /locus_tag="Sfla_0151"
                     /inference="protein motif:PFAM:PF00378"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: bts:Btus_1239 enoyl-CoA hydratase/isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004921136.1"
                     /db_xref="GI:357409400"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:11369556"
                     /translation="MTAEGPEPVYETILLRRADGIAWITLNRPERLNATTEQMHHELL
                     DAFARVADDGSSRVLVLTGAGDRAFCIGSDLGFLTEVLDGEEPDSDLFAAYLERLNGV
                     VFALERMPVPTIAMVQAKARASGFEMVVACDFVLIAEEARIGDVHTPYGHMPGAGATH
                     RTVRKMGLQPAMELLMTGRWMSAAEAVEKKLALRAVPRDRLREETTVFARTLVDIPGD
                     SLRHLKAAVMGGLGRTVEEAVATETSEYLALLRSSSGPVDGFRAGQRERALRRAGPAS
                     GEVTATGPAQGGGPPP"
     misc_feature    complement(193939..194727)
                     /locus_tag="Sfla_0151"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    complement(194119..194718)
                     /locus_tag="Sfla_0151"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(194305..194307,194314..194319,
                     194383..194391,194395..194397,194530..194544,
                     194554..194556,194653..194655,194659..194661))
                     /locus_tag="Sfla_0151"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(194383..194385,194536..194538))
                     /locus_tag="Sfla_0151"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(194119..194124,194131..194133,
                     194176..194178,194185..194187,194218..194220,
                     194227..194232,194236..194241,194245..194250,
                     194263..194268,194272..194280,194284..194286,
                     194302..194313,194347..194358,194419..194421,
                     194443..194445))
                     /locus_tag="Sfla_0151"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(194751..195530)
                     /locus_tag="Sfla_0152"
                     /db_xref="GeneID:11369557"
     CDS             complement(194751..195530)
                     /locus_tag="Sfla_0152"
                     /inference="protein motif:PFAM:PF05721"
                     /note="PFAM: Phytanoyl-CoA dioxygenase;
                     KEGG: ttr:Tter_2355 phytanoyl-CoA dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="YP_004921137.1"
                     /db_xref="GI:357409401"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="GeneID:11369557"
                     /translation="MTASPSSSGAVEPATTTDPAADEREVFRRDGVVRWDHVLTPGQV
                     ADLRVSVERAFFDDGRPAEGVRDLSERRGRPLDLALLQKVNLWRSDEACEAQVRRPDL
                     YRRVEALLGGPVRLFRDHSFYKPAGKGERSRLVLHQDNRYWHLSPPEAVTVWMALDDA
                     TPENGCVQYVLGSHRWGRVEHTRPEEGAVLVEARSEREPVEYPVPAGSALVHHANTLH
                     GSGPNLTDGPRRAYALVFVRADVSARGEAMTGVPLAADLAR"
     misc_feature    complement(194838..195452)
                     /locus_tag="Sfla_0152"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     pfam05721"
                     /db_xref="CDD:253349"
     gene            195969..197417
                     /locus_tag="Sfla_0153"
                     /db_xref="GeneID:11369558"
     CDS             195969..197417
                     /locus_tag="Sfla_0153"
                     /inference="protein motif:PFAM:PF04055"
                     /note="KEGG: dal:Dalk_1130 radical SAM domain protein;
                     PFAM: Radical SAM domain protein; cobalamin B12-binding
                     domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="YP_004921138.1"
                     /db_xref="GI:357409402"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0031419"
                     /db_xref="GO:0046872"
                     /db_xref="GO:0051536"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:11369558"
                     /translation="MQVLLVNARRSSYSGESISAPQLGLLSLAATLREGTFHDTKGTD
                     VRFIDDQLFVLQRPLATPNEFLRGHHPDIVGIQVLTSSLKNGIKLGAESRRHHPNALV
                     VYGGVGATPLARKLVEDGSADVVVKGEGEVTFSHLVHEYGNNGRKNLRKVRGIVFRDD
                     DGTVVETPAAPQVMRLDKLPKPARDLADMQLYNQISRGRSGNLVTSRGCSYACAYCYS
                     KHQWGVGQRRHSADRVIEEIRELVEVHGFDRIRIEDDDFVEDVPRMQELCRSIEKSGL
                     QGKFEWEAKARPDLIDDDMARMLRDSGCFRLLVGVETLDWSLLKRLGRPVKVDVTERA
                     LSSLSKAGIGVQATLILGIPGETDEAMRSTITWLQSRLGDNRHDIVSPCFFVPFHHEV
                     EKDMAKRVDFTLETDDSDCFTGHIPVTSSDAASIDELWKLYDDMTPTRRDGKYKRIAY
                     LADLSTVQTRLGLLDGGAPQTKEPAALVPEVQ"
     misc_feature    196029..196448
                     /locus_tag="Sfla_0153"
                     /note="B12 binding domain_like associated with radical SAM
                     domain. This domain shows similarity with B12
                     (adenosylcobamide) binding domains found in several
                     enzymes, such as glutamate mutase, methionine synthase and
                     methylmalonyl-CoA mutase, but it lacks the...; Region:
                     radical_SAM_B12_BD; cd02068"
                     /db_xref="CDD:239019"
     misc_feature    196575..197141
                     /locus_tag="Sfla_0153"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    196575..197072
                     /locus_tag="Sfla_0153"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    order(196593..196595,196599..196601,196605..196607,
                     196611..196619,196782..196790,196896..196898,
                     197016..197018,197127..197132)
                     /locus_tag="Sfla_0153"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            197414..198817
                     /locus_tag="Sfla_0154"
                     /db_xref="GeneID:11369559"
     CDS             197414..198817
                     /locus_tag="Sfla_0154"
                     /inference="similar to AA sequence:KEGG:SCO7114"
                     /note="KEGG: sco:SCO7114 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921139.1"
                     /db_xref="GI:357409403"
                     /db_xref="GeneID:11369559"
                     /translation="MSAPTAALGTEVLDVPAYDGARAVMSHRPDVVRDGEGRPLARLG
                     STGRLTQFRMAEEAGRAARRLRGIDDADWFGLLRRAADRVTTKLDNGDLDVWLRALSA
                     VSGLPRRRAARGLRTAAQDLARMEEILAAQAPDGTVSAYRTGGSGLGWSWRPAGRSVL
                     VRQPGNFPTINIEWLQALATRRPVLLSTAAADPFTPVVLTEELYAAGLPEHGVSVVHG
                     DAPALRRLADQVLWPGEDVPADLPAGKVKTYHFGRSRAVIGDRLPDDAWPRLAREAFA
                     GCGRLCVNMSSLVVLGDPREAAEALAHEFAARPVLPLDDPRAAVPAFPDRAARDSLAL
                     RIEREVAAGAVDVTAAATGVPLRVELDGKAFLRPTVLLVDPGSPLFGTELPFPFTAVA
                     HVPRSKAVAACAGSLIVSVVGEADGLVRALAEEPGVDKVFAGDQFDRGYHPCDPHEGH
                     LADFLFKKKAVIPGALA"
     misc_feature    197501..>198571
                     /locus_tag="Sfla_0154"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     misc_feature    order(197897..197911,197936..197938,197972..197974,
                     197978..197983,198119..198124,198161..198169,
                     198257..198259,198563..198565,198569..198571)
                     /locus_tag="Sfla_0154"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143395"
     misc_feature    order(197909..197911,198161..198163,198248..198250,
                     198257..198259)
                     /locus_tag="Sfla_0154"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143395"
     gene            198853..199962
                     /locus_tag="Sfla_0155"
                     /db_xref="GeneID:11369560"
     CDS             198853..199962
                     /locus_tag="Sfla_0155"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: hje:HacjB3_18593 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="YP_004921140.1"
                     /db_xref="GI:357409404"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="GeneID:11369560"
                     /translation="MRCPSESRLRPITDEDVRRLVRLHFDPQHGTPYWLERDRRQGTD
                     ALGKVHGLADAVALIGLLDGSDQMHFEEAARRTPLENFVPRSVLAEGGTLWAAQTGGT
                     TGPAKHGTWGSRYWDDILAFSDEFLDLHGVPRGKNWLFVGPMGPHTTGRLVVAFAERR
                     GGMCFSIDLDPRIVKIFGEEGMTAAYDRYVDHIWAQIAEVARSQDIGVLFCTSRLLEM
                     LPERLGTEALAGVEAIVHAGTTLDPETHRQLREDFFPGVPVVGMYGTSTTGISWQKPF
                     EAEDEHRVVYVPCQPHVSLDVVDGQGDDVPFGEEGRVRVWRLTDDALLPGFWERDRAR
                     RVRPYGVAAERYPWPWVGDPYSPEFTEGRRVEGVY"
     misc_feature    199147..>199797
                     /locus_tag="Sfla_0155"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(199147..199149,199276..199281,199486..199488,
                     199492..199497,199504..199506,199561..199566,
                     199633..199650)
                     /locus_tag="Sfla_0155"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(199147..199149,199561..199566,199633..199650)
                     /locus_tag="Sfla_0155"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(199147..199164,199168..199173)
                     /locus_tag="Sfla_0155"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(199276..199278,199492..199497,199504..199506,
                     199561..199563)
                     /locus_tag="Sfla_0155"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            199964..201343
                     /locus_tag="Sfla_0156"
                     /db_xref="GeneID:11369561"
     CDS             199964..201343
                     /locus_tag="Sfla_0156"
                     /inference="protein motif:PFAM:PF00733"
                     /note="PFAM: asparagine synthase;
                     KEGG: svi:Svir_33380 asparagine synthase
                     (glutamine-hydrolyzing)"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="YP_004921141.1"
                     /db_xref="GI:357409405"
                     /db_xref="GO:0004066"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="GeneID:11369561"
                     /translation="MAGFILSSGPDGSIDVGLLGEGRAMDVLVRRDGTDVLVVQGDRL
                     TGEDPPQHASLADLAAWTERAHSRYCAVLVREGRATLWSDVGATCPLHWARAGRTLLV
                     GTSAGALLPRLGRPVVLGDAERSLLPGGRFAGVTPVPANSAVTLVVDAYGEDPVSVHR
                     VAHLPDLATVTDADQAVRTVRTVLGASVARLAAGADEIAVSLSGGVDSSTVAALAVLE
                     AGSSAVRTYTVGTPYGDEFAQAAWLADRLGTKHEEVHFGPEQLAGMLPGMIRALETWD
                     LLTLQIAAPACFLQGHIATDRSQVLLSGYGADLLFAGLGGTGGEDAVEGAVVAQTRAT
                     GRSNEFHPAFADARHTAVRHPYWTREVMAAALDIRGRLKVRDGEAKWVLRSAAADVLP
                     AEVAWRPKRGIHEGTAMSHMFAAALGSDDPSVQAGRLYEIATEVFRSGGPGTGPGEAG
                     QDRRLGGMG"
     misc_feature    200504..201181
                     /locus_tag="Sfla_0156"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    order(200564..200572,200648..200650,200828..200830,
                     200870..200878)
                     /locus_tag="Sfla_0156"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    order(200564..200572,200648..200650,200828..200830,
                     200870..200878)
                     /locus_tag="Sfla_0156"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            201340..202743
                     /locus_tag="Sfla_0157"
                     /db_xref="GeneID:11369562"
     CDS             201340..202743
                     /locus_tag="Sfla_0157"
                     /inference="protein motif:PFAM:PF02310"
                     /note="KEGG: gsu:GSU0204 radical SAM domain-containing
                     protein;
                     PFAM: cobalamin B12-binding domain protein; Radical SAM
                     domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin B12-binding domain-containing protein"
                     /protein_id="YP_004921142.1"
                     /db_xref="GI:357409406"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0031419"
                     /db_xref="GO:0046872"
                     /db_xref="GO:0051536"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:11369562"
                     /translation="MRVLLIWPRNERALLSDRLSCCEPLPLEYLGGALRGHHDVTIHD
                     LRLDAPLADYAATHEPPDLVGVAIPYTTSVRVSREVSREARRLWPDVPIVLGGHHPTV
                     SAEWLDGFAADWVVAGEGGAPLNRLAADLEAGRTPQTGVGLAPYDSRTGLERDRRPRP
                     AALNDLPMPDRSLLAHHRQDYFHSIYRPVSLIRFTAGCPYTCKFCSLWRMTDRRYLVK
                     DIDRVLAEIDDIEGQNLYVVDDEAFIQPARMLELADAIDKAGFRKRFHMYIRTDTALR
                     RPDVIARWAEIGLDSVLVGAESMTDDELSGYRKGTDADQTRRALDLFHTNQVKVRANF
                     IVQPNWVGEDFARLGRTIEELQVDMPSFSVLTPLPGTDLYDESRDQHISDDPELFDCY
                     HSLFPTKLPLEDFYHRLADLLAGASARPAPGVASGQDPSVFYYSDNSAFDEMLSGIRL
                     AAGPGRDREPERVPSTG"
     misc_feature    201373..201723
                     /locus_tag="Sfla_0157"
                     /note="B12 binding domain; Region: B12-binding; pfam02310"
                     /db_xref="CDD:251215"
     misc_feature    order(201532..201540,201547..201555,201631..201633,
                     201706..201708,201715..201717,201763..201765)
                     /locus_tag="Sfla_0157"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     misc_feature    201913..202509
                     /locus_tag="Sfla_0157"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(201931..201933,201937..201939,201943..201945,
                     201949..201957,202051..202053,202057..202062,
                     202147..202155,202222..202224,202342..202344,
                     202429..202434)
                     /locus_tag="Sfla_0157"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            202831..204873
                     /locus_tag="Sfla_0158"
                     /db_xref="GeneID:11369563"
     CDS             202831..204873
                     /locus_tag="Sfla_0158"
                     /inference="protein motif:PFAM:PF02310"
                     /note="KEGG: saq:Sare_2941 radical SAM domain-containing
                     protein;
                     PFAM: cobalamin B12-binding domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin B12-binding domain-containing protein"
                     /protein_id="YP_004921143.1"
                     /db_xref="GI:357409407"
                     /db_xref="GO:0031419"
                     /db_xref="GO:0046872"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="GeneID:11369563"
                     /translation="MSTESSRRRKVYFIGLNAVPFLPLVAGLLRTYAEQDERIAASYD
                     FQEPLFLVAPVQEMADGITEPDVLALSCYVWNFRRQMKVAKILKERYPDMLVVAGGPH
                     VPDRVGDFFTQHPYVDVLAHGEGEVAFRELLSARLQDAPVYTGVPGVTVNERNAPVAG
                     PPAKRLPRRIETPSPYLNGVMDGAVKTCRERGLRFYALWETNRGCPYSCAFCDWGSAT
                     MSALRMFEEERVQHEIEWFARNDVEDLFICDANFGIMPRDLEIAHALAEARTEAGSPK
                     QIRVNFAKNSNDRVFDISKAWHDADLLMGTTLSMQSTDMDVLEAIDRKNIGLDNYRKL
                     QQRYAVENIHTYTELILGLPLETARTFREGIGSLLEAGNHEDIRVYEFGILPNAPINT
                     PEKIAGYGLRTVPKRLYVERPGTPDDEAETMDMVMETSAMPRDEWVESFAFVQAVQFL
                     HNGCYTRYLSVYLRQEHGIGYTAFYEGLQNHFTDRPTSFIGSLYLRMRSLYQDYIDIP
                     TLPLANLVASQPDLATHLAPYGRRRGWTIDNWGWLRVATEFDRFHDELVDYLRTLGLD
                     PDQDARLRDVLRFQRDVMLRPDYDAQHGKTAEYDHDWPGYFGGGPLRTQRVRVEYTDQ
                     QFGANGRFRPAPGDLKAFALAAIGPSYPVSRIGHYRHRIESAEVTPLAEPAFSEQL"
     misc_feature    202897..203280
                     /locus_tag="Sfla_0158"
                     /note="B12 binding domain_like associated with radical SAM
                     domain. This domain shows similarity with B12
                     (adenosylcobamide) binding domains found in several
                     enzymes, such as glutamate mutase, methionine synthase and
                     methylmalonyl-CoA mutase, but it lacks the...; Region:
                     radical_SAM_B12_BD; cd02068"
                     /db_xref="CDD:239019"
     misc_feature    203425..204015
                     /locus_tag="Sfla_0158"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    203425..203919
                     /locus_tag="Sfla_0158"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    order(203443..203445,203449..203451,203455..203457,
                     203461..203466,203473..203475,203572..203574,
                     203578..203583,203665..203673,203755..203757,
                     203878..203880,203971..203976)
                     /locus_tag="Sfla_0158"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            204870..206336
                     /locus_tag="Sfla_0159"
                     /db_xref="GeneID:11369645"
     CDS             204870..206336
                     /locus_tag="Sfla_0159"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: fal:FRAAL0176  membrane transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004921144.1"
                     /db_xref="GI:357409408"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11369645"
                     /translation="MTAGPGAAGSAAPPHRAALAVLAGACGLFALLQLGVATLLPQIQ
                     EAFGVSGSEAAWVVTGHLLVGCVATPVVSRFGDLYGRRAVMLCVLAVVAVASVVSALT
                     GSFTVLLVARLVQGVAGGLFPLCVGLLREGFPQRSLSGPSGLLSASFGTGGGVGIVLA
                     GMFGGGLPAVRWLFAAAALLAVVLLVAGASVLPETPRRPATRIDIPGLLLLGTVSTCL
                     LLALTRYGQEGLGSVTGAALLAAAAAGCALLLRVERRSPEPVLDMRLMSRRPLLCLNL
                     VSLLTGLVMFQIGVLAPALVAAPRDTGYGLGAGGAVLTLVMLPMQLGALSGGLLSGWL
                     RESGRLTARAVMGTSTALFAAGAVVFAVLPSGAGGLALGTALNGLATGLLGGAMAELL
                     VQASPTGATAVTVGLNGVLRNLGGAFGVQVSSMVLAVAGGASSHPSATAYHALFTGSA
                     VLALVAVGAAVAFPRSPAPRQDVPVPPGHTSRPIRPTT"
     misc_feature    204924..>205358
                     /locus_tag="Sfla_0159"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    204930..206126
                     /locus_tag="Sfla_0159"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            206446..207828
                     /locus_tag="Sfla_0160"
                     /db_xref="GeneID:11369646"
     CDS             206446..207828
                     /locus_tag="Sfla_0160"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: svi:Svir_33320 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004921145.1"
                     /db_xref="GI:357409409"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:11369646"
                     /translation="MFDLRRSDVVLLQAVVDHGSLHAVERDGWMTQSSASRRLVKLER
                     RLRTALVSRGATGTEPTEAGHALLHVGRRLLASIDFAIATTHHGAGAASRLPVVEFAV
                     GSEWAYGLDGHLAGRFPDVVFDIVPDDSHRIWQRFERYAADAALGWETARRPMARRGD
                     VLIRTIAEEPQQIALPSGHPLAEQGILDLRGLTGADWVAVVGGDSGDDQGWALSRLTP
                     VPSVSFTVRSQGAALDLVRRGYGIALVSPSSLGGSPARGVVLRPLRQKFVRRLRLAVD
                     PLAIPEPLAEDLCASLRRRYVLRTTAHGSVPAVTQQDPDRGTPADPADAGCAVPPPVL
                     LSELHWSSPGRCGGFEPEHLHLLRVIGRTGSLNQAASALLVTQPALTRRIRRLEASCG
                     LPLVHSTARGTSLSATARRLLACTGPAEHRLDALANHLRQSGPAAGMPPAEGAAGPVP
                     SPVRPRKAPR"
     misc_feature    206464..207330
                     /locus_tag="Sfla_0160"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    206467..206640
                     /locus_tag="Sfla_0160"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    206794..207255
                     /locus_tag="Sfla_0160"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(206800..206802,206806..206826,207112..207129,
                     207145..207150,207154..207159)
                     /locus_tag="Sfla_0160"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     misc_feature    207490..>207756
                     /locus_tag="Sfla_0160"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    207499..207675
                     /locus_tag="Sfla_0160"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     gene            complement(207803..208591)
                     /locus_tag="Sfla_0161"
                     /db_xref="GeneID:11369647"
     CDS             complement(207803..208591)
                     /locus_tag="Sfla_0161"
                     /inference="protein motif:TFAM:TIGR01509"
                     /note="KEGG: tbi:Tbis_0784 HAD-superfamily hydrolase;
                     TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
                     3;
                     PFAM: Haloacid dehalogenase domain protein hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_004921146.1"
                     /db_xref="GI:357409410"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="GeneID:11369647"
                     /translation="MGRCGLRPPGGTGTLERYPRGPAGPSFAGEGESVAEISGIVVDW
                     GGVVTRSFAEGIAVWAADEGVDAAEFHAALGRLLGPAAVPGPVARQFHLVERGELPVS
                     EFEGTLAALVRRSDGSHPVTEGLVERMFAPFTDEPAMVGLLRALRDAGLKVALLSNSW
                     GHTYDRRGWEGLFDTVVISCEVGLRKPEPEIFRHTARLLDRRLEECVMVDDLGRNVRA
                     ARELGMAGVHHRTARETARALIPLLPPAGRQAVLDHLSAAPSGA"
     misc_feature    complement(207905..208483)
                     /locus_tag="Sfla_0161"
                     /note="Haloacid dehalogenase-like hydrolase; Region:
                     HAD_2; pfam13419"
                     /db_xref="CDD:257744"
     misc_feature    complement(207923..208477)
                     /locus_tag="Sfla_0161"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    complement(207911..>208168)
                     /locus_tag="Sfla_0161"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(208121..208123)
                     /locus_tag="Sfla_0161"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            208724..209515
                     /locus_tag="Sfla_0162"
                     /db_xref="GeneID:11369648"
     CDS             208724..209515
                     /locus_tag="Sfla_0162"
                     /inference="protein motif:PFAM:PF05721"
                     /note="PFAM: Phytanoyl-CoA dioxygenase;
                     KEGG: fre:Franean1_6323 phytanoyl-CoA dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="YP_004921147.1"
                     /db_xref="GI:357409411"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="GeneID:11369648"
                     /translation="MRLGRPVEDIVRELDENGFAPLDDLVPESVLEVMRRGCDDLIGR
                     TRQMRHSSQGWQLEAEGDGGGWAARATGREGIPGKVRVVGYAHEHSPEIAKVPGLLGL
                     NENLVEPLHGLRGDFYNSYLWAKPSEVGSEKPWHQDALFLKEEFYEAYEDVFTIWIAV
                     DDAREDNGCLRFLPGSHRGSVLQEPRGINREDLFASPHEPSLDIETLWPELTPVTLPR
                     RPGSAVIFSAFTAHTSSANVTEDQRRAVSYVYSLPRRPGTTGAGR"
     misc_feature    208763..209458
                     /locus_tag="Sfla_0162"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     pfam05721"
                     /db_xref="CDD:253349"
     gene            209512..210528
                     /locus_tag="Sfla_0163"
                     /db_xref="GeneID:11369649"
     CDS             209512..210528
                     /locus_tag="Sfla_0163"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: sro:Sros_3946 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_004921148.1"
                     /db_xref="GI:357409412"
                     /db_xref="GO:0008080"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11369649"
                     /translation="MTAAAPGESLGTASRVHRTPELRPLDPAVHTDIVWELARARDLA
                     ALGHEETTHRWIAGRLTAPGVDPARDARLCLGSGGEVTGAAWAGRTSGVAGWVVELVL
                     GPRATAADGRGLLDFAVARCREGLGGPDGSERASLSCFTSEGEHTTRAALRDHGFGSP
                     RGYDRMSVALDGTPVPVPAVPGAVVRPLREEADLRAFHRAKNQAYAAEEAGKEEDSFD
                     AWSRWYRSDPGVAPEQCALLELDGDVVGFVNVTDRMLESRGVAYVRQLGIDPSVRGRG
                     LGAVLLGWALDEARRRGRTGMVLTVDRENVRARALYRRLGWRVESRWDDVRRTVTLPR
                     GGHD"
     misc_feature    210064..210483
                     /locus_tag="Sfla_0163"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_8; pfam13523"
                     /db_xref="CDD:257843"
     misc_feature    210214..210411
                     /locus_tag="Sfla_0163"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(210307..210315,210343..210348)
                     /locus_tag="Sfla_0163"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(210557..211348)
                     /locus_tag="Sfla_0164"
                     /db_xref="GeneID:11369650"
     CDS             complement(210557..211348)
                     /locus_tag="Sfla_0164"
                     /inference="protein motif:PFAM:PF00378"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: dze:Dd1591_0212 enoyl-CoA hydratase/isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004921149.1"
                     /db_xref="GI:357409413"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:11369650"
                     /translation="MSVPIQPSQKNQKSVGCSHVGDGVVLVEFSGAHEQNPFSRARMQ
                     ELTALMHDLDQDASVRSVVLHGGSGRSFGVGGDFNEVSAFTGGDEVSDWIDDITDLYT
                     AIAGISKPVVAAIDGYAIGIGLQIALCCDYRVAADTARLVMPELRVGIACNFGGFMLR
                     YTVGTSVMQRMLFTCEEWPADRALEDGLLHEVRPSEDVLDRALELARTIAGYTPAAVQ
                     GTRPRVNAPFVEGLERVRTEAKESHRRAFSAGEAQARMRRIIGKD"
     misc_feature    complement(210575..211294)
                     /locus_tag="Sfla_0164"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    complement(210722..211294)
                     /locus_tag="Sfla_0164"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(210905..210907,210914..210919,
                     210983..210991,210995..210997,211115..211129,
                     211139..211141,211238..211240,211244..211246))
                     /locus_tag="Sfla_0164"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(210983..210985,211121..211123))
                     /locus_tag="Sfla_0164"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(210722..210727,210734..210736,
                     210779..210781,210788..210790,210821..210823,
                     210830..210835,210839..210844,210848..210853,
                     210866..210871,210875..210880,210884..210886,
                     210902..210913,210947..210958,211019..211021,
                     211043..211045))
                     /locus_tag="Sfla_0164"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            211550..212611
                     /locus_tag="Sfla_0165"
                     /db_xref="GeneID:11369651"
     CDS             211550..212611
                     /locus_tag="Sfla_0165"
                     /inference="similar to AA sequence:KEGG:SCAB_6791"
                     /note="KEGG: scb:SCAB_6791 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921150.1"
                     /db_xref="GI:357409414"
                     /db_xref="GeneID:11369651"
                     /translation="MREKDRQVPLTIVLGTGRCGSTMLSDLVNEHPGALSLSEFFACL
                     DPGVFPVGTLDGPAFWKLLGTPRLKPNVLMTHGVTVPEYRYPIGSGRYAAGEVPAISL
                     MTLPPLTGDPDGLYDRIRAEVISWPPAPVSHQYLRLFSWWAFSSGRDVVVERSGASLR
                     FLPELLTQFPAARFVHMYRDGPDSAMSMSRHPLFRLGVMIGDMRAELGVDPYRNPDPR
                     HTELLPARLRPFAPYSLDAAALAGTDIPLVRFGDMWSRATGALRHLAGLPAERLLHLS
                     YDAVMTDPEPQLTTFGHFAGLAEPEVWAARVAGKVDRKRAGAASRLSAGQAEELRLAC
                     VPGTRRLTGLLDGTAAAAR"
     gene            212780..213229
                     /locus_tag="Sfla_0166"
                     /db_xref="GeneID:11369652"
     CDS             212780..213229
                     /locus_tag="Sfla_0166"
                     /inference="protein motif:PFAM:PF00582"
                     /note="PFAM: UspA domain-containing protein;
                     KEGG: amd:AMED_1572 universal stress protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_004921151.1"
                     /db_xref="GI:357409415"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="GeneID:11369652"
                     /translation="MASYRTVLVGTDGSESSFAAVASAARLAVACRAELVIVCAYSPM
                     RGPDLDVAKDQLGAEAYQVVGSAPAEDTLRVARDRARDEGLEDARSVAVEDRPVAALE
                     RIAQEYAADLIVVGNRGLRSLAGRLLGSVPADIARKAGLDVLIVHTT"
     misc_feature    212795..213217
                     /locus_tag="Sfla_0166"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(212807..212815,212897..212899,213122..213127,
                     213131..213136,213164..213175)
                     /locus_tag="Sfla_0166"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            213226..214392
                     /locus_tag="Sfla_0167"
                     /db_xref="GeneID:11369653"
     CDS             213226..214392
                     /locus_tag="Sfla_0167"
                     /inference="protein motif:PRIAM:4.6.1.1"
                     /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
                     KEGG: amd:AMED_1571 adenylate cyclase;
                     SMART: adenylyl cyclase class-3/4/guanylyl cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate cyclase"
                     /protein_id="YP_004921152.1"
                     /db_xref="GI:357409416"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="GeneID:11369653"
                     /translation="MSVPGSGREAMAGPAGSDELHQTIEEMLLDGRRLWTRRDIAERS
                     GVAPERSAQIWRALGFPVADDDARVFTDADVDALRSGERLVEAGLITEESATGMARAL
                     GHHLSRLAEWQMQTLWTWLSHDSGEGDSGAGAALTEHAAQLLPEMESLQRHVWRRHLA
                     AHAGRMLAADGADILTRSARESAADTVEGAQDRGVGATSPVGCETGPPHGGAEIRHLA
                     VGFTDMVAYTRMTRGLDSAELARVLDRFESVVGDVVAEGRGRVVKTIGDEVFFVCESA
                     SAAAGIALEVTARAESDRDVPHLRTGLAHGAVLSRFGDVYGAAVNIAARLTAVARPDT
                     VLVDTAFAGELAGTTSYTLKVLRPVSVRGYSRLRPVLLRSARSGEPSAPRRSRR"
     misc_feature    213853..214323
                     /locus_tag="Sfla_0167"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    213871..214335
                     /locus_tag="Sfla_0167"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    order(213886..213888,213892..213909,214012..214014,
                     214018..214026,214033..214035,214165..214173,
                     214183..214188,214195..214200,214309..214311)
                     /locus_tag="Sfla_0167"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    order(213892..213894,214024..214026)
                     /locus_tag="Sfla_0167"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    order(213907..213909,213943..213945,213952..213957,
                     213964..213966,213976..213978,214012..214017,
                     214150..214152,214168..214179,214186..214188,
                     214309..214311)
                     /locus_tag="Sfla_0167"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     gene            complement(214639..215034)
                     /locus_tag="Sfla_0168"
                     /db_xref="GeneID:11369654"
     CDS             complement(214639..215034)
                     /locus_tag="Sfla_0168"
                     /inference="protein motif:PFAM:PF03259"
                     /note="PFAM: Roadblock/LC7 family protein;
                     KEGG: scb:SCAB_30321 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Roadblock/LC7 family protein"
                     /protein_id="YP_004921153.1"
                     /db_xref="GI:357409417"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="GeneID:11369654"
                     /translation="MSGTSHPGPLVEIMTALRERVMGVHDLVLSTGDGLLVAADAATV
                     HPESIAALSAATLSLGQRLAHEAEGGTLRDVTTRCAGRHVLIQAVGDRALLTVLGDEG
                     LDLALLHLHMPATVDQLVRILDKDAPSAS"
     misc_feature    complement(214678..215010)
                     /locus_tag="Sfla_0168"
                     /note="Roadblock/LC7 domain; Region: Robl_LC7; cl00886"
                     /db_xref="CDD:260680"
     gene            complement(215074..215295)
                     /locus_tag="Sfla_0169"
                     /db_xref="GeneID:11369655"
     CDS             complement(215074..215295)
                     /locus_tag="Sfla_0169"
                     /inference="similar to AA sequence:KEGG:MAV_5298"
                     /note="KEGG: mav:MAV_5298 virulence factor MviN family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921154.1"
                     /db_xref="GI:357409418"
                     /db_xref="GeneID:11369655"
                     /translation="MNARRRTRAKARNLLLARRLRSHRRNRPPPPLPVRRPGSPSTLP
                     RLPDGLDAHRPDIGLLRRVYTRLIDSPEP"
     gene            complement(215292..216107)
                     /locus_tag="Sfla_0170"
                     /db_xref="GeneID:11369656"
     CDS             complement(215292..216107)
                     /locus_tag="Sfla_0170"
                     /inference="similar to AA sequence:KEGG:SCAB_30341"
                     /note="KEGG: scb:SCAB_30341 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921155.1"
                     /db_xref="GI:357409419"
                     /db_xref="GeneID:11369656"
                     /translation="MTTRAEGPRNVSAVLHTLYEQERDATVLVAGAPGGRIHVRQGLV
                     VSIDTPGAPGAESILLRSGRVADTEWTAVRAACRDEEGRLADELSARGLLTATEFEVL
                     CVAAVFDAAFVLALAAPQGWEVTGPVPVPVSGPGLTPRRIAAETTRRLAALNGQWMPA
                     SALAVLRVQPAEPVPSLLPSRYVTLLRAANDRRTPRDLAFALGRGTYAVMLDLARLHT
                     LGLLQETAPVTDARPSTAPRVPASGTRSPEPAPVVTLPRRTPGAHQLGGADRS"
     gene            complement(216104..216466)
                     /locus_tag="Sfla_0171"
                     /db_xref="GeneID:11369657"
     CDS             complement(216104..216466)
                     /locus_tag="Sfla_0171"
                     /inference="similar to AA sequence:KEGG:SCAB_30351"
                     /note="KEGG: scb:SCAB_30351 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921156.1"
                     /db_xref="GI:357409420"
                     /db_xref="GeneID:11369657"
                     /translation="MGRVSSVEDSLGHLLQVPGVTGVSLVDAVSGLSYGAAGPQNLGV
                     DECGRLAVLIDERLHSAGAEGELETVVVTGARHQLVLRVLPGFGDPLLLAVALERERA
                     NLALVLRHLDVFPAREAA"
     gene            216614..216979
                     /locus_tag="Sfla_0172"
                     /db_xref="GeneID:11369658"
     CDS             216614..216979
                     /locus_tag="Sfla_0172"
                     /inference="similar to AA sequence:KEGG:SCAB_30361"
                     /note="KEGG: scb:SCAB_30361 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921157.1"
                     /db_xref="GI:357409421"
                     /db_xref="GeneID:11369658"
                     /translation="MTVETALKEAMAIDGALGVALVDYESGMSLGTLGGEAGLDLEVA
                     AAGNTEVVRAKIRTLATLGMEDTIEDILITLGRQYHLVRPLASSSGSLFLYLALDRGR
                     SNLALARHSLKRIESSLDI"
     gene            complement(217109..220117)
                     /locus_tag="Sfla_0173"
                     /db_xref="GeneID:11369659"
     CDS             complement(217109..220117)
                     /locus_tag="Sfla_0173"
                     /inference="protein motif:PFAM:PF06439"
                     /note="KEGG: sco:SCO0505 large, multifunctional
                     hypothetical protein;
                     PFAM: protein of unknown function DUF1080; Carbohydrate
                     binding family 6;
                     SMART: PA14 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921158.1"
                     /db_xref="GI:357409422"
                     /db_xref="GO:0030246"
                     /db_xref="InterPro:IPR005084"
                     /db_xref="InterPro:IPR010496"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="GeneID:11369659"
                     /translation="MHPRLFPRARRHLATLLVGGFLAGGVWAGPTATAAPGDIPPQEP
                     GVTLRVFDTQVPLSGLCTLKPGQTPNHDKLMPTVDWSTVDDFGGYADNFVAEVSGYLV
                     VPADGTYDFRLTSDDGSRLTIDDQQVIDHDGLHGAEPKDGSASLTAGSHPFRVDYFER
                     GGDQRLTLAWKPPGAGDFGTIPNEALTTDAGVVRVTAPGRKECESGADTPGDGLPLTA
                     VRPDLDLTDLRPEGFEPQVTGMDWLPDGRLALSTWGGSETTTGEVYLLGNVTGDTSRD
                     KVTVEKIAEGLREPMGIKYVDGSLYVSQKHELTQLVDKDADFVTDEYRTVATWPYGGN
                     FHEFAFGLLYRDGYFYVNLSVAIDYGGATTTPQPAQGRGTTYKVSKKTGRIQAVAGGL
                     RTPNGIGWGPEGSLFTTDNQGGWLPASKLVQIKQDRFFNHYTQPSGAFDDRTPTQPVL
                     WLPQNEIANSPSTPLYLDKGRFAGQMLFGDVTYGGLQRAYLEKVKGQYQGAVFRYTQG
                     LEAGVNRITMGPDGSIYTGGLGADGNWGQEGKLKFGLQKLTPNGGNTFDIKEMRAVPG
                     GFDLEYTQPLSEATAEELASHYRAEQWRYTPTSDYGGPKIGEERLAVRSATLSGDSRT
                     VRLRLDGLKPDRVVHVRSPRPFASTSGESLWSTEAWYTLNALPGKQPPPATLYEAEEA
                     RLTGTAGVHTDHPGYSGSGFVDRYNTENRTGTTFDVTVPKAGDYDVNLRYSNGPNPFQ
                     GTKSLSLHVNGKKLRQTRLPSTGTWDTWSTQTERVRLKAGSNTLSYRYDTGDTGHVNL
                     DLITVHRHGASVSLFDGTTASQGQWQHTDGRRVAWPLTAERSMEVCCGDIRTKDAYQD
                     FRLRMEFRVPLLPDDVTGQDRGNSGVYLQDRYELQILDSFGDTTPDTNEAGAIYQKKA
                     PDINAATAPETWQTYDVTFRAARFDDSGRKTADARVTVVWNGRTVHDDIAIDGPTGAG
                     APESPSAGAIRLQDHGNAVRFRNIRIEPLS"
     misc_feature    complement(219569..219988)
                     /locus_tag="Sfla_0173"
                     /note="domain in bacterial beta-glucosidases other
                     glycosidases, glycosyltransferases, proteases, amidases,
                     yeast adhesins, and bacterial toxins; Region: PA14;
                     smart00758"
                     /db_xref="CDD:214807"
     misc_feature    complement(<218885..219307)
                     /locus_tag="Sfla_0173"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     misc_feature    complement(217709..218095)
                     /locus_tag="Sfla_0173"
                     /note="Carbohydrate Binding Module 6 (CBM6) domains; many
                     are found in association with discoidin domain(s); Region:
                     CBM6_discoidin-like; cd04083"
                     /db_xref="CDD:193488"
     misc_feature    complement(order(217721..217723,218078..218080,
                     218084..218086))
                     /locus_tag="Sfla_0173"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:193488"
     misc_feature    complement(217121..217690)
                     /locus_tag="Sfla_0173"
                     /note="Domain of Unknown Function (DUF1080); Region:
                     DUF1080; pfam06439"
                     /db_xref="CDD:253732"
     gene            220476..221507
                     /locus_tag="Sfla_0174"
                     /db_xref="GeneID:11369660"
     CDS             220476..221507
                     /locus_tag="Sfla_0174"
                     /inference="protein motif:PFAM:PF00296"
                     /note="PFAM: Luciferase-like, subgroup;
                     KEGG: sma:SAV_1156 monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase-like protein"
                     /protein_id="YP_004921159.1"
                     /db_xref="GI:357409423"
                     /db_xref="InterPro:IPR016048"
                     /db_xref="GeneID:11369660"
                     /translation="MPHTSRPLRKLGFLTIGLYDEDDPGRGHESTLRLIELGERLGFD
                     SAWVRHRHLQYGISSPVAVLAAATQRTRRIELGTAVTPLGWENPLRLAEDFATVDVLS
                     GGRLNPGISVGPPMFYDRVKDALYPQTAEAEDFGYGRVERLLDLVRGEPATASGGTEG
                     FEVFSDRVQPHSPGLHRRMWYGGASLRSARWAGEHGMNLLTSSVVKAEGPGDEPADFA
                     AVQLAQIRAFRAAHPDGEAARVSQGLVVIPTDSASPEQRARYERYAEERLPRTAVPQG
                     PGRMMFAPDLVGTSEVIAERLRAHAAFREVDEVAFALPFTFEHQDYEQILTDIATRLA
                     PALGWRSGT"
     misc_feature    220500..221489
                     /locus_tag="Sfla_0174"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            221610..222356
                     /locus_tag="Sfla_0175"
                     /db_xref="GeneID:11369661"
     CDS             221610..222356
                     /locus_tag="Sfla_0175"
                     /inference="protein motif:PFAM:PF00092"
                     /note="KEGG: scb:SCAB_68641 hypothetical protein;
                     PFAM: von Willebrand factor type A;
                     SMART: von Willebrand factor type A"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="YP_004921160.1"
                     /db_xref="GI:357409424"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="GeneID:11369661"
                     /translation="MIVSNGSERAPAISLTKVMERAPDLVDLYKAAGSSVRAHGLEGV
                     RAAVYLVLDRSGSMRPYYRDGTMQHLAEQVLSLSAHLDDDGVVPVVFFSTDVDGCTDL
                     TLGRHRGLMDKLHANLGHMGRTNYHWAMDEVIDHYLASGSEAPALVVFQTDGGPTSRL
                     AAERYLCKAARLPLFWQFIGFGDPEDNEFAFLHKLDTLAVPARRTVDNAGFFHAGRTP
                     RTTDDNRLYDRLLHEFPQWLDAARAARILE"
     misc_feature    221745..222218
                     /locus_tag="Sfla_0175"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    order(221766..221768,221979..221981,222066..222068)
                     /locus_tag="Sfla_0175"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     misc_feature    <222105..>222350
                     /locus_tag="Sfla_0175"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            complement(222488..223504)
                     /locus_tag="Sfla_0176"
                     /db_xref="GeneID:11369662"
     CDS             complement(222488..223504)
                     /locus_tag="Sfla_0176"
                     /inference="protein motif:PFAM:PF00532"
                     /note="KEGG: sco:SCO6349 transcriptional regulator;
                     PFAM: periplasmic binding protein/LacI transcriptional
                     regulator; regulatory protein LacI;
                     SMART: regulatory protein LacI"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_004921161.1"
                     /db_xref="GI:357409425"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:11369662"
                     /translation="MNEDVARPRQPSMADVARVAGVSAQTVSRALRGSAHVNPDTGRR
                     VLAAVEQVGYRFNSAARALSSGRSLTVGLVLLASGGYYSRSAVTAGVESAADDAGYAV
                     SIATIASLDARRMERALARLADQGVDGLVIAVPLISVTRKMEDITRDIPTVTLDGSRT
                     AGARVIGIDQREAGRIATQHLLDLGHRQIWHLSGPDEWLEARQRREGWQECLALAGIE
                     APPALEGDWSPGSGYRQGQIIAMIPEVTAVFVACDEMAFGLIRALRERGRAVPEDVSV
                     VSVDDIALASYCTPPLTAVRQDFFGHGAAAVRLLLQDDATVEPSAVEATLSVRASTAP
                     PRPR"
     misc_feature    complement(222497..223474)
                     /locus_tag="Sfla_0176"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(223310..223465)
                     /locus_tag="Sfla_0176"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(223313..223318,223322..223327,
                     223334..223336,223343..223345,223382..223384,
                     223391..223396,223409..223411,223418..223423,
                     223427..223441,223463..223465))
                     /locus_tag="Sfla_0176"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(223316..223345)
                     /locus_tag="Sfla_0176"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(222512..223297)
                     /locus_tag="Sfla_0176"
                     /note="Ligand-binding domain of DNA transcription
                     repressor LacI specific for lactose, a member of the
                     LacI-GalR family of bacterial transcription regulators;
                     Region: PBP1_LacI; cd01574"
                     /db_xref="CDD:107259"
     misc_feature    complement(order(222665..222667,222749..222751,
                     222893..222895,222905..222907,223001..223003,
                     223037..223039,223106..223108,223244..223246,
                     223253..223258,223274..223276))
                     /locus_tag="Sfla_0176"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107259"
     misc_feature    complement(order(222722..222724,222734..222736,
                     222743..222745,222815..222817,223130..223132,
                     223187..223189,223193..223195,223202..223204,
                     223229..223231,223238..223240,223250..223252,
                     223259..223261,223271..223273))
                     /locus_tag="Sfla_0176"
                     /note="dimerization interface (open form) [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107259"
     misc_feature    complement(order(222722..222724,222743..222745,
                     223127..223129,223229..223231,223247..223249,
                     223265..223267))
                     /locus_tag="Sfla_0176"
                     /note="dimerization interface (closed form) [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107259"
     gene            223554..225440
                     /locus_tag="Sfla_0177"
                     /db_xref="GeneID:11369663"
     CDS             223554..225440
                     /locus_tag="Sfla_0177"
                     /inference="protein motif:PFAM:PF01301"
                     /note="PFAM: glycoside hydrolase 35;
                     KEGG: sco:SCO6347 beta-galactosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase 35"
                     /protein_id="YP_004921162.1"
                     /db_xref="GI:357409426"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001944"
                     /db_xref="InterPro:IPR019801"
                     /db_xref="GeneID:11369663"
                     /translation="MSSITYPPAVTDSSTTQPSEPPSTTATACGAALSWRDGRLYRGG
                     VPHRILSGSLHYFRVHPDLWQDRIRRIADLGLNTVDTYVPWNFHQLHEDRSPRFDGWR
                     DLERFIRTVGEEGLDVVVRPGPYICAEWSNGGLPSWLTAKDLAIRSSDPAFTTAVARW
                     FDHLIPRLATLQASRGGPVVAVQVENEFGSYGDDHAYVRWCRDALVERGIGELLFTAD
                     GPTELMLDGGTLPGTLTAATLGSKPEAARRLLVSRRPEEPFLVAEFWNGWFDHWGERH
                     HVRGVESAVHTLRGIIADHGSVSIYMAHGGTNFGLWAGANESDGRLEPVVTSYDSDAP
                     IAEDGRLTPKFFAMREALGVREPVRSAARMPTLPPAHVPLVHRAGLLAALRAASTGAT
                     TTPRPASFEQLGLDAGMVLHTAHPRIPAGEHRLLFTDVRDRARVFADGILLGVVDARS
                     PELPVTGTGRLVRLEVLVENLGRINYGPGVGRHKGLLGPVLVDRRMVQGWQSAPLALQ
                     EWSSAELSDTIAAGFAASSAETAPATESTGFAVAELHVGTPADTFLALPGSGHGLVWV
                     NGFLLGRHWDIGPQVTLYCPAPLLRAGSNTVTVLELERLGKTLELRDRAELGPPEEYV
                     EEFD"
     misc_feature    223668..224612
                     /locus_tag="Sfla_0177"
                     /note="Glycosyl hydrolases family 35; Region:
                     Glyco_hydro_35; pfam01301"
                     /db_xref="CDD:250519"
     misc_feature    <225207..225353
                     /locus_tag="Sfla_0177"
                     /note="Beta-galactosidase jelly roll domain; Region:
                     BetaGal_dom4_5; pfam13364"
                     /db_xref="CDD:257692"
     gene            225558..226199
                     /locus_tag="Sfla_0178"
                     /db_xref="GeneID:11369664"
     CDS             225558..226199
                     /locus_tag="Sfla_0178"
                     /inference="similar to AA sequence:KEGG:FRAAL3331"
                     /note="KEGG: fal:FRAAL3331 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921163.1"
                     /db_xref="GI:357409427"
                     /db_xref="GeneID:11369664"
                     /translation="MIRMSDPTEREDNAVAAVPTSPQEWRDFLERYGERYLKSCADDD
                     ELVDLLDEDQLDAFDRGERVSVWLGEAPAREEALVASEERLGVRFPPSLRGFFLASDG
                     WAHLDAWVEGVHPCGRVSWMRDGDAGMRVTEIYESIPGNEDDVQLFRRSVEVARGEDF
                     WLLDPTDVGPDGEWAAYEFAPKYGNPTKFPSFAALFHSGYDEDEGEEEGEDLA"
     misc_feature    225771..226145
                     /locus_tag="Sfla_0178"
                     /note="SMI1 / KNR4 family (SUKH-1); Region: SMI1_KNR4;
                     pfam09346"
                     /db_xref="CDD:255303"
     gene            complement(226349..227389)
                     /locus_tag="Sfla_0179"
                     /db_xref="GeneID:11369665"
     CDS             complement(226349..227389)
                     /locus_tag="Sfla_0179"
                     /inference="similar to AA sequence:KEGG:Sked_06050"
                     /note="KEGG: ske:Sked_06050 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921164.1"
                     /db_xref="GI:357409428"
                     /db_xref="GeneID:11369665"
                     /translation="MTGRTPFGRRRRGRHDQDTDRRPVGEGAEPPKPVLRRPRTGLAS
                     VALATVAALFATSCSAAGEEAPATSPSVAPLVPSEGALLGHYYGDGTVEETAARIGTT
                     PGIHLTYYGWDDDWSASEATRDDLSGNRIPLVNWEPFDVDFDDIIDGSLDATIEKQAD
                     GAKELEKPFFLDFAAEMNEEEGWGGHDPERYIAAYRHIHDVFDDRGASNVVWVWAPNV
                     TDSVDAPAAMSYYPGDRYVDWTGVDGYNWGTSEPDFAWQSFTDLFRDIYAELAVKGKP
                     IIIGETGSDETGGSKAEWIRGIVPGLKEEFRLIKALVWFDVDKERHWQINSSPAALAA
                     YRRMASDPYLAP"
     misc_feature    complement(226412..>226945)
                     /locus_tag="Sfla_0179"
                     /note="Beta-mannanase [Carbohydrate transport and
                     metabolism]; Region: ManB; COG4124"
                     /db_xref="CDD:226609"
     gene            227714..228646
                     /locus_tag="Sfla_0180"
                     /db_xref="GeneID:11369666"
     CDS             227714..228646
                     /locus_tag="Sfla_0180"
                     /inference="similar to AA sequence:KEGG:SAV_5928"
                     /note="KEGG: sma:SAV_5928 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921165.1"
                     /db_xref="GI:357409429"
                     /db_xref="GeneID:11369666"
                     /translation="MQRIDVTRDDGTWAGLSLDVRDRHQPDLCVHTAGPRLLVSQLSR
                     PVLLAVVEEPLQGVHFRRADGYRSFVPPLRADTARALSGSPERWAHRFARYLSDSPGS
                     PLHEGRWLLTCESPILHGRHPTTSHAEHWSSMLVEGDPDGYIDWYLHSHSWEVLPLRP
                     MPGPGDSRVKAYRKQAREGTLPPVLLWWVSGLDCHLILDGHARLAAAIAESVEPPLLQ
                     VHRTAARDDLAAGIEDAVGAYESALARFAGLRAFHGPTVPDGAATTGPQFARQLRDLH
                     TARQPTWSWPLPGGEDQWWRIAHEVTVGNAWPPA"
     gene            228855..231446
                     /locus_tag="Sfla_0181"
                     /db_xref="GeneID:11369667"
     CDS             228855..231446
                     /locus_tag="Sfla_0181"
                     /inference="protein motif:PFAM:PF00759"
                     /note="KEGG: mau:Micau_2188 glycoside hydrolase 9;
                     PFAM: glycoside hydrolase 9; Carbohydrate-binding CenC
                     domain protein; cellulose-binding family II;
                     SMART: cellulose-binding family II"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase 9"
                     /protein_id="YP_004921166.1"
                     /db_xref="GI:357409430"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0030246"
                     /db_xref="InterPro:IPR001701"
                     /db_xref="InterPro:IPR001919"
                     /db_xref="InterPro:IPR003305"
                     /db_xref="InterPro:IPR018221"
                     /db_xref="GeneID:11369667"
                     /translation="MSAAALLFAAALAVPGTAGAQEAEPGPEQISNGDFAAGTAPWWW
                     TANAPSAVSDGRLCAQVPAGTANAWDVIVGQNDVPIVAGESYELSYSASATVPLTVQT
                     RVQEAAEPYTTVLATADPVGAEATQVTRTFTASVDLPAASVQLQIGGGERATTFCLDD
                     VSLRGGAEPPVYVPDTGSPVRVNQVGYLPHGPKSGTVVTDADDPLTWAVKTSAGTTAA
                     TGRTVPQGEDPSSRQRVHTFDFGDLTTAGDGYTVEVDGETSEPFSIRGNLYDGLRSDA
                     LAYFYHNRSGTPIEADLVGEKYARPAGHVGVAPNKGDTDVPCQPGVCDYRLDVSGGWY
                     DAGDHGKYVVNGGISVAQLMSTYERTLTAPNAESAELGDGKLRVPERDNGVPDILDEA
                     RWEMDFLIKMQVPAGEPLAGMAHHKMHDAQWTGLPMKPHLDPQQRELHPPSTAATLNL
                     AASAAQCARLYAPFDAAFASRCLRAAETAWAAAKQHPDVLADPNDGTGGGAYSDNDVS
                     DEFYWAAAELFTTTGKDTYRQAVLSSPLHGDTDAAFPAGGGISWGYTAGLGVLTLATV
                     PNGLTQAQLGEVRAVVTTGADRYAAQSRAQAYGLPYAPEDENYVWGSNSQVLNNMIVL
                     ATAHDLTGEAAYQDAVLSGADYLLGRNPLNQSYVTGYGERDSHNQHHRFWAHQNDSAL
                     PNPAPGSIAGGPNLTAIASGDPVAAQKLSGCAPAMCYIDDIGSWATNEITVNWNAPLA
                     FIASYLDDAGEGGRAAPARTCRVSYASHPWNSGSTVTVRVENTGSEPVSPWSLTWLLP
                     GDQRIGHTWSAELDQHGRTVSARPLSWNRTLAPGAAVDFGFNTSAASTVPDPESFKLN
                     GRACASG"
     misc_feature    228936..229298
                     /locus_tag="Sfla_0181"
                     /note="Carbohydrate binding domain; Region: CBM_4_9;
                     pfam02018"
                     /db_xref="CDD:251041"
     misc_feature    229392..229646
                     /locus_tag="Sfla_0181"
                     /note="N-terminal Early set domain associated with the
                     catalytic domain of cellulase; Region: E_set_Cellulase_N;
                     cd02850"
                     /db_xref="CDD:199881"
     misc_feature    229659..231086
                     /locus_tag="Sfla_0181"
                     /note="Glycosyl hydrolase family 9; Region: Glyco_hydro_9;
                     pfam00759"
                     /db_xref="CDD:250113"
     misc_feature    231135..231434
                     /locus_tag="Sfla_0181"
                     /note="Cellulose binding domain; Region: CBM_2; pfam00553"
                     /db_xref="CDD:249953"
     gene            complement(231574..232053)
                     /locus_tag="Sfla_0182"
                     /db_xref="GeneID:11369668"
     CDS             complement(231574..232053)
                     /locus_tag="Sfla_0182"
                     /inference="protein motif:PFAM:PF11706"
                     /note="PFAM: Zinc finger, CGNR; protein of unknown
                     function DUF1470;
                     KEGG: sco:SCO0460 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc finger, CGNR"
                     /protein_id="YP_004921167.1"
                     /db_xref="GI:357409431"
                     /db_xref="InterPro:IPR010852"
                     /db_xref="InterPro:IPR021005"
                     /db_xref="GeneID:11369668"
                     /translation="MDVLLDLLNSRPLVDGEERDALGDPAEGRRWAREHGGEGSPAEL
                     ELLRETRDVLRDVVLGRRSPVAFGPLLEGVHRTPEMTSDGLRWLLRTAPHARLAAEVV
                     LAWADTEEQLPGRLRPCANDGCRLFLLDRSRANRARWCSMAVCGNREKARRHYERTR"
     misc_feature    complement(231736..232050)
                     /locus_tag="Sfla_0182"
                     /note="Protein of unknown function (DUF1470); Region:
                     DUF1470; pfam07336"
                     /db_xref="CDD:254162"
     misc_feature    complement(231583..231711)
                     /locus_tag="Sfla_0182"
                     /note="CGNR zinc finger; Region: zf-CGNR; pfam11706"
                     /db_xref="CDD:256560"
     gene            232158..233036
                     /locus_tag="Sfla_0183"
                     /db_xref="GeneID:11369669"
     CDS             232158..233036
                     /locus_tag="Sfla_0183"
                     /inference="protein motif:PFAM:PF00561"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: msm:MSMEG_0117 hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_004921168.1"
                     /db_xref="GI:357409432"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="GeneID:11369669"
                     /translation="MSAVHHRTTVVDGHRIHYREAGHADAPAIVLLHGFPTSSFMFRE
                     LIPLLADDYHVIAPDHLGFGHSDAPRAAEFDYTFDALADITSGLLDQLGLERYALYVQ
                     DYGAPIGWRLALTHPERISALVTQNGNGYEDGFVESFWTDVWAYGAAPGPDTEPAVRT
                     ALGIDAIRWQYVHGVPDPSLVSPDTWEHDFALVSREGNDEVQLALFRDYRNNRPLYPL
                     LHEFLRTSEVPVLAVWGRNDEIFGPAGARAFARDAKDAEVHLIDGGHFLLESHLDVVA
                     GYLRGFLGRVLGHAGS"
     misc_feature    232185..>232529
                     /locus_tag="Sfla_0183"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    232242..232985
                     /locus_tag="Sfla_0183"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(233061..233591)
                     /locus_tag="Sfla_0184"
                     /db_xref="GeneID:11369670"
     CDS             complement(233061..233591)
                     /locus_tag="Sfla_0184"
                     /inference="similar to AA sequence:KEGG:Franean1_6883"
                     /note="KEGG: fre:Franean1_6883 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921169.1"
                     /db_xref="GI:357409433"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="GeneID:11369670"
                     /translation="MLAVVVPVAVAVGIYLVGTHHTPDYLNGLFGRYGTDAVDLKARL
                     GTALLGLALAQLGLALWMYGRLPGARPAPRPVRPGHRVLGFLAFLLSLPIAYHCLTTY
                     GIETTSARVAIHSFAGCALYGAFVAKVIVVRSRRLPGRLLPVVGGLLVLGVALLWYTA
                     ALWALDGDSVPGFPSG"
     gene            complement(233657..234148)
                     /locus_tag="Sfla_0185"
                     /db_xref="GeneID:11369671"
     CDS             complement(233657..234148)
                     /locus_tag="Sfla_0185"
                     /inference="similar to AA sequence:KEGG:SCO7673"
                     /note="KEGG: sco:SCO7673 lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004921170.1"
                     /db_xref="GI:357409434"
                     /db_xref="InterPro:IPR005297"
                     /db_xref="InterPro:IPR014558"
                     /db_xref="GeneID:11369671"
                     /translation="MKRTATAVTCAATLLLAGALTGCSENTSGEGNGPTSSSASPSAP
                     ATVDTKSAGGLGDILVDDKGNTLYLFLADKKNKSNCNGACAKAWPPLLTKGAAEVGKG
                     VDKKLLDTTKRSDGDEQVTYNGHPLYYYAGDTEPGQTNGQNLDQFGAEWYVLDTKGKQ
                     VES"
     misc_feature    complement(233876..233983)
                     /locus_tag="Sfla_0185"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     misc_feature    complement(233684..233821)
                     /locus_tag="Sfla_0185"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     gene            complement(234393..235022)
                     /locus_tag="Sfla_0186"
                     /db_xref="GeneID:11369672"
     CDS             complement(234393..235022)
                     /locus_tag="Sfla_0186"
                     /inference="similar to AA sequence:KEGG:Micau_6074"
                     /note="KEGG: mau:Micau_6074 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921171.1"
                     /db_xref="GI:357409435"
                     /db_xref="GeneID:11369672"
                     /translation="MVTDRQGHSRTDATVRCGAATLVLLLAGCAGGGAGGASDAKPSG
                     GVPSTTTAVAPETALSSAQLATPAPGEAGHAEVLEVYRLMAAEYEKAYRAASAEGTDL
                     ERYMAPAAAGEVEKDLARLAGQGAAMRGALGHDPEVTALAAAAQPPTATVRDCVDASG
                     WQTLDTTTGWRIPRPDDQPSRYVATARMEHRPGERWKATAYTVDEKRSC"
     gene            235260..236531
                     /locus_tag="Sfla_0187"
                     /db_xref="GeneID:11369673"
     CDS             235260..236531
                     /locus_tag="Sfla_0187"
                     /inference="similar to AA sequence:KEGG:SAV_2397"
                     /note="KEGG: sma:SAV_2397 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921172.1"
                     /db_xref="GI:357409436"
                     /db_xref="GeneID:11369673"
                     /translation="MFNIQCIVHIHERMAPHMPDTSAFHRKRRRPALLVSAAAATAAL
                     VAGLLSLPAAPRAEAAPAVFAHPGVTVSKGQLDFTRGKVDAGAQPWKGAFDQMMASRY
                     ADPNRTAKPRATVECGSYSNPNYGCTDEREDAIAAYTNALAWYLTRDDRYAKKSIELM
                     DAWSAVIKSHTNSNAPLQTGWAGSSWPKAAEIIKHTYTGTWAGSGRFATMLRDVYLPK
                     VINGSHSNGNWELSMTEAAVGISVFLEDKASYDKAMATFRTRTAAYVYLASDGALPRT
                     VPSQNLDTTAKIVGYWQGQSTFVTGLTQETCRDLTHTGYGISAIAHIAETSRIQGQDL
                     YGTDVGERLRQALGFQSRYQLGETVPSWLCGGSLNLGLGPVTEVGYNALHHRLGIPMT
                     NTQRLTEQNRPAGSNNLFVAWETLTHGDNPN"
     misc_feature    235560..236330
                     /locus_tag="Sfla_0187"
                     /note="Alginate Lyase A1-III; enzymatically depolymerizes
                     alginate, a complex copolymer of beta-D-mannuronate and
                     alpha-L-guluronate, by cleaving the beta-(1,4) glycosidic
                     bond; Region: AlgLyase; cl00179"
                     /db_xref="CDD:260237"
     gene            236653..237249
                     /locus_tag="Sfla_0188"
                     /db_xref="GeneID:11369674"
     CDS             236653..237249
                     /locus_tag="Sfla_0188"
                     /inference="protein motif:TFAM:TIGR02258"
                     /note="KEGG: sgr:SGR_6923 hypothetical protein;
                     TIGRFAM: 2'-5' RNA ligase;
                     PFAM: Phosphoesterase HXTX"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="YP_004921173.1"
                     /db_xref="GI:357409437"
                     /db_xref="GO:0008664"
                     /db_xref="InterPro:IPR004175"
                     /db_xref="InterPro:IPR014051"
                     /db_xref="GeneID:11369674"
                     /translation="MNEETPPATVRVFVALAPPDRAKDELARELRPAYDTHPHVRWNR
                     IEDWHITLAFLGEIPTATVPLLRPPLARLASAHRPPRLALRGSGTFDDRVLWTGVDGD
                     LDELHLLAADVRTAVKGCGVAFEDRPLRPHLTLARARRGDRSSMAEIAEGVAGFDGRR
                     WPAERLHLVGSNFGRSAGPIHYRDIEAWALGGGSGPGV"
     misc_feature    236680..237222
                     /locus_tag="Sfla_0188"
                     /note="2'-5' RNA ligase; Region: 2_5_ligase; TIGR02258"
                     /db_xref="CDD:233802"
     misc_feature    236698..236940
                     /locus_tag="Sfla_0188"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     misc_feature    236962..237195
                     /locus_tag="Sfla_0188"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     gene            237306..239357
                     /locus_tag="Sfla_0189"
                     /db_xref="GeneID:11369675"
     CDS             237306..239357
                     /locus_tag="Sfla_0189"
                     /inference="similar to AA sequence:KEGG:MXAN_3401"
                     /note="KEGG: mxa:MXAN_3401 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921174.1"
                     /db_xref="GI:357409438"
                     /db_xref="GeneID:11369675"
                     /translation="MTVEAARRWGSHLDSVVVYEQGAVCRRLARGVVPPDGRVRVTGL
                     PRSLDPSSLRARVPEARGVRVSEARVEFEAEPLGTATDGLREEVARLRDEHAAAQGRR
                     DHQLSLIEEVRSLHPVPPPRPPEDAVRRTPVDAWLELAGFVDERLTRLHARLVELEDT
                     LRVTGHELGIAVDRLARASTDVPSAHVGTTVSALLTFDVRGPGKPDAEVELELEYGVP
                     GAVWAPAYRLTYRQGDSTGRLVLRASVAQRTGEDWTDVSLGLATADLRRATGLPKLRS
                     IRIGRSQPAPAPAGWREPPAGLSDLFNGYDTAPGRPAPAAQPVVPSAPPPVPPPPPAP
                     QAYGGPPAPLAAAGRTGAFPERFGGDVPAPAPAARARKAEPYRPAGMPSGAPVPAAPG
                     GAPSLPSAAPPAGPPQPSGAELDYAALVLCGPDERGDRRGRLFPGALPDPVAPEHRHR
                     AESVAGLPLPGHAVRPRESAGSFDHRFDTAARTDIPSDGTWHTVTIGETSVGTHTDYL
                     CTPSVEQTVYASLTLSNSSDQALLAGPVEVTVDDDFLLTAALPTLAPGGARRVGLGPV
                     EGIQVSRRTNLHESASGLRGSTTVLDHRVHVELANRLAGPVTVEVRERVPVTADPDVR
                     IEERADWTEPEGGSVQDHPAAGTRVWRVDIPVGGTTELDGGYEIRIPANRTVVGGNRR
                     S"
     misc_feature    237348..237614
                     /locus_tag="Sfla_0189"
                     /note="N-terminal domain of unknown function (DUF4140);
                     Region: DUF4140; pfam13600"
                     /db_xref="CDD:257915"
     misc_feature    237936..239318
                     /locus_tag="Sfla_0189"
                     /note="Domain of unknown function (DUF4139); Region:
                     DUF4139; pfam13598"
                     /db_xref="CDD:257913"
     gene            239366..240928
                     /locus_tag="Sfla_0190"
                     /db_xref="GeneID:11369676"
     CDS             239366..240928
                     /locus_tag="Sfla_0190"
                     /inference="similar to AA sequence:KEGG:MXAN_3400"
                     /note="KEGG: mxa:MXAN_3400 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921175.1"
                     /db_xref="GI:357409439"
                     /db_xref="InterPro:IPR011935"
                     /db_xref="GeneID:11369676"
                     /translation="MATHTNPIALPVTAVTCLEDRAHVERVVVLDLAAGVQRLRLGPV
                     SALAVDRTLHAELSAGHSATVLDVRMTRSWTPRGPVPHPEDDSAPRLRVHALVREQLD
                     LEQRRERLDARRHLLDALAADLLREIGEGAGAGDTDSARWSRELDRTDEERASCGEQL
                     RVVEARLAAVHDERGEAERAMRLTEEEPAALVGHIELTVETAAAGPVELRLSHLTPCA
                     LWRPAYRAVLVGDSLTLETDAMVWQRTGEDWPDVRLTLSTARSALATEPPSLGEDRLT
                     LTDRSAAERRTVGVELREEETHTLGATSVVGLPGVDDGGEARVLRSPARVSLPGDGRA
                     HRVPLSRFTTEARSEYACSPELSPLVTQVARFDNRAGHALLAGPVDLVRDSGFVGRGT
                     LDFSAPGAPCELAFGSRDDHRVVRRASETRETAGLTQRTVLTREVQLHLSRFSPPGEQ
                     GDRVVTVRERLPVSEVSAVDVRLRKDSCVPEPDVVDAEGIARWDVALPPDGRRTVTLV
                     YEVSVSSKVTGL"
     misc_feature    239405..239707
                     /locus_tag="Sfla_0190"
                     /note="N-terminal domain of unknown function (DUF4140);
                     Region: DUF4140; pfam13600"
                     /db_xref="CDD:257915"
     misc_feature    239990..240901
                     /locus_tag="Sfla_0190"
                     /note="Domain of unknown function (DUF4139); Region:
                     DUF4139; pfam13598"
                     /db_xref="CDD:257913"
     gene            complement(240975..241745)
                     /locus_tag="Sfla_0191"
                     /db_xref="GeneID:11369677"
     CDS             complement(240975..241745)
                     /locus_tag="Sfla_0191"
                     /inference="protein motif:PFAM:PF04248"
                     /note="PFAM: protein of unknown function DUF427;
                     KEGG: sco:SCO7130 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921176.1"
                     /db_xref="GI:357409440"
                     /db_xref="InterPro:IPR007361"
                     /db_xref="GeneID:11369677"
                     /translation="MADESIQYPGLIVPAGHVEPVPRRVRATIGGSTVFDTRRALYVW
                     EWPPYPQFSIPVEDLSEGVLTDDGRTEERGAGPARRHTLTVGSEVREGAAWVWTDGAP
                     SALLGTVRFEWEALDSWFEEDEPVFVHPRSPYSRVDALRSSSSIRVELDGAVLAEAPG
                     CVKLFETGLPTRYYLDLTHVDRARLRRSDTVTRCPYKGTTSSYWSFDGDATHEDIAWA
                     YDFPTVHVDRIAGLVAFYNERVDLHVDGTKLPRPAGRA"
     misc_feature    complement(241008..241397)
                     /locus_tag="Sfla_0191"
                     /note="Domain of unknown function (DUF427); Region:
                     DUF427; cl00998"
                     /db_xref="CDD:260738"
     gene            complement(241905..244034)
                     /locus_tag="Sfla_0192"
                     /db_xref="GeneID:11369678"
     CDS             complement(241905..244034)
                     /locus_tag="Sfla_0192"
                     /inference="similar to AA sequence:KEGG:SGR_6895"
                     /note="KEGG: sgr:SGR_6895 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921177.1"
                     /db_xref="GI:357409441"
                     /db_xref="GeneID:11369678"
                     /translation="MSAEARKAAILRRSLRVTVAASVGFYLLLYVADLPAAALYALFA
                     PIAIGLLSAIPGSGRRQAFVVLRALPPALGLAALGTLLAVDTWSATGGMLVIGFLLAF
                     AAVAGPRPAGAAPGLQLFYILACFPPYAPDALGERLTGLAVGMLLLAASHALLPDPPV
                     PSYRKRLAAALATAARGVTTGEVTPQDLRDTGARMRLSRVPPSERPAGAGRTDRALEQ
                     GGRAVRRLLDQLAALPELPPPAPDHASDTLLGRVAVVCETCADSSVTGRRPPAPGALE
                     QAMRNFQSERVRTAPGPVAPARPAPEPPTAGANGRTPSLAVLRRQSRVLALAESARIV
                     EVTVDIAANGRPADPPAPRELFWYAELSTPKLWARRVLGNATLRSVLFQNAVRTALGL
                     AASRLVAGSLDLDHGFWVLLAVLTLGRTTVGATWRAARRALAGNAVGALVAGALLIGL
                     GAHTDAYAILLAPAMLVGFPLGPMLGTAYTQGLFTLVVATAFAQLAPVTWRLSEARMV
                     DVATGSVIGLLCGLLAWPAGAGREVRRAMAELLRTCGGLVPPTAEALLTPSPGSRSSP
                     RTLPSLHRFRLAKAAYAQYRSESGTASKDAEPDWHAVLIAAQHMLLGAHRLPRFGLRP
                     EIGPPNPSASRARTTAAGLRADADRIASLLTGGHPVSEPNTPPEPEGYSPASLSVDLE
                     VWMTSLGRQLAHVEASVTRRPAPDRAA"
     misc_feature    complement(242475..242846)
                     /locus_tag="Sfla_0192"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            complement(244375..244824)
                     /locus_tag="Sfla_0193"
                     /db_xref="GeneID:11369679"
     CDS             complement(244375..244824)
                     /locus_tag="Sfla_0193"
                     /inference="similar to AA sequence:KEGG:SCAB_86841"
                     /note="KEGG: scb:SCAB_86841 spore-associated protein
                     precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="spore-associated protein"
                     /protein_id="YP_004921178.1"
                     /db_xref="GI:357409442"
                     /db_xref="GeneID:11369679"
                     /translation="MRTARNVAAVGAATALLVGGTAAFGASASAAPNVTPQGVCGKAY
                     KTVNSVPVGSLGTVYLTYNSSNGLNCVATIRTNPGSAKPMSAYIYVPATDEWAGDDGS
                     FTSYAGPGYVYGKGYCVSWGGSISNVYVSVENSNCASLKERRTTEIR"
     gene            245154..245702
                     /locus_tag="Sfla_0194"
                     /db_xref="GeneID:11369680"
     CDS             245154..245702
                     /locus_tag="Sfla_0194"
                     /inference="similar to AA sequence:KEGG:SGR_262"
                     /note="KEGG: sgr:SGR_262  tellurium resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="YP_004921179.1"
                     /db_xref="GI:357409443"
                     /db_xref="GeneID:11369680"
                     /translation="MAVWDRLKDQARTLQQTQGARGQAAGRSTGQGSGGGSRAQLVST
                     LKSQLASLKTELKSGAYRDASMAMCALVAAADGHVDPAERQHVESLILGNEVLQNFPS
                     EQLRQRFNKHVDQLTRNFQQGKADALQEIAKTAKKPAEARAVIQTGIVVAGADGDFSQ
                     AEHMILREACTALGLSPVEFQL"
     misc_feature    245337..245678
                     /locus_tag="Sfla_0194"
                     /note="tellurite resistance protein terB; Region: terB;
                     cd07176"
                     /db_xref="CDD:143580"
     misc_feature    order(245379..245381,245400..245402,245616..245618,
                     245637..245639)
                     /locus_tag="Sfla_0194"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:143580"
     gene            complement(245963..246376)
                     /locus_tag="Sfla_0195"
                     /db_xref="GeneID:11369681"
     CDS             complement(245963..246376)
                     /locus_tag="Sfla_0195"
                     /inference="protein motif:PFAM:PF04134"
                     /note="PFAM: thiol-disulphide oxidoreductase DCC;
                     KEGG: sro:Sros_6276 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="YP_004921180.1"
                     /db_xref="GI:357409444"
                     /db_xref="InterPro:IPR007263"
                     /db_xref="GeneID:11369681"
                     /translation="MRARPVLIYDGDCAFCTSSVRFAERRLRPRCEISPWQFADLDAL
                     GVTRERAEYEVLWVTPAGVVHGGVQAVARLLQDAGRGWYVPGVLLTLPPLRWIAHGVY
                     RLVASHRERMPGGTPACALPTDRRSGAREPSGPVE"
     misc_feature    complement(246035..246358)
                     /locus_tag="Sfla_0195"
                     /note="Protein of unknown function, DUF393; Region:
                     DUF393; pfam04134"
                     /db_xref="CDD:252400"
     gene            246565..247575
                     /locus_tag="Sfla_0196"
                     /db_xref="GeneID:11369682"
     CDS             246565..247575
                     /locus_tag="Sfla_0196"
                     /inference="protein motif:PRIAM:3.5.2.6"
                     /note="KEGG: sgr:SGR_457  beta-lactamase;
                     PFAM: beta-lactamase"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase"
                     /protein_id="YP_004921181.1"
                     /db_xref="GI:357409445"
                     /db_xref="InterPro:IPR000871"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="GeneID:11369682"
                     /translation="MLRVDRLSPRAVPRSKEATATVPTPLPRRTALRTLAGLVALPVA
                     ACDPTTPAAAPPAVPSTPGGSGHRPGRAFQGLEKRFGARLGVYAIDTGTGASVTHRPD
                     ERFAYASTCKALLAGTVLGMHTLQQLERRVRYGPGDLVANSPVSERHVEAGMTLRALC
                     DAAVRHSDNTAANLLFREIGGPRRLQDALLALGDRTTRCDRYETDLSEAAPGDPRDTS
                     TPRALATDLRAYALGDVLGDEKRAVLTDWLRRNTTGDALIRAGTPAGWPVGDKTGTGG
                     YGTRNDIAVVWPPHSAPITIAVLSRRASRGAKPQDALIARAARVALTALAGQKYPVPQ
                     GR"
     misc_feature    246793..247482
                     /locus_tag="Sfla_0196"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; cl19191"
                     /db_xref="CDD:267544"
     gene            complement(247563..247949)
                     /locus_tag="Sfla_0197"
                     /db_xref="GeneID:11369683"
     CDS             complement(247563..247949)
                     /locus_tag="Sfla_0197"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: sco:SCO1092 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004921182.1"
                     /db_xref="GI:357409446"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:11369683"
                     /translation="MVHVLSSRVLLTPRDPEVSRDFYGRTLGLSVYREFGTGPERGTV
                     YFLGGGFLEVSGRSDAPPTETLRLWMQVDDCAAAHEEVAARGAHVLCPPLQEPWGLIE
                     MWIADPDGHRIVLTEVPARHPLRYRP"
     misc_feature    complement(247605..247925)
                     /locus_tag="Sfla_0197"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(247608..247610,247614..247616,
                     247638..247640,247749..247751,247794..247796,
                     247827..247829,247914..247916))
                     /locus_tag="Sfla_0197"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            complement(248343..249278)
                     /locus_tag="Sfla_0198"
                     /db_xref="GeneID:11369684"
     CDS             complement(248343..249278)
                     /locus_tag="Sfla_0198"
                     /inference="protein motif:TFAM:TIGR00212"
                     /note="KEGG: sco:SCO7343 porphobilinogen deaminase;
                     TIGRFAM: porphobilinogen deaminase;
                     PFAM: Porphobilinogen deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="YP_004921183.1"
                     /db_xref="GI:357409447"
                     /db_xref="GO:0004418"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="GeneID:11369684"
                     /translation="MSAPELIRIVSRDSPMALAQVERVRAGLAALHPDTVTEVVPVRT
                     TGDKWLGDLSKVEGKGAFTKEVDAALLAGEADLAVHCVKDIPADRPLPAGTTFAAFLE
                     RDDIRDALVHPDGLTLEQLPEGTRIGTSSVRRTAQLASSHPHLDCVPFRGNANRRLAK
                     LAAGEADALLLAVAGLHRIGRPDVISDILAPETMCPPIGAGVLALQCREDDTATIEAV
                     GALNHPGTYREITAERMFLHVLQGHCNSPIAGYATAHRNGDLSLRACVFTPDGKTVLN
                     AHEWAGPLDPATLGTSVAVSLLRQGARELIDSIAH"
     misc_feature    complement(248376..249260)
                     /locus_tag="Sfla_0198"
                     /note="porphobilinogen deaminase; Region: hemC; TIGR00212"
                     /db_xref="CDD:232876"
     misc_feature    complement(248385..249260)
                     /locus_tag="Sfla_0198"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(248451..248453,248457..248459,
                     248466..248468,248475..248477,248490..248492,
                     248529..248531,248535..248537,248547..248549,
                     248568..248570,248577..248582,248592..248594,
                     248601..248603,248622..248624,248676..248699,
                     248745..248750,248757..248759,248820..248822,
                     248859..248861,248871..248876,248880..248882,
                     248955..248972,248976..248981,249006..249008,
                     249018..249035,249222..249224,249237..249239))
                     /locus_tag="Sfla_0198"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(248547..248549,248676..248681,
                     248688..248690,248745..248747,248754..248756,
                     248763..248771,248808..248810,248829..248831,
                     248877..248882,248886..248894,249027..249032,
                     249036..249038,249219..249221,249231..249233))
                     /locus_tag="Sfla_0198"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            249673..250488
                     /locus_tag="Sfla_0199"
                     /db_xref="GeneID:11369685"
     CDS             249673..250488
                     /locus_tag="Sfla_0199"
                     /inference="protein motif:PFAM:PF04672"
                     /note="PFAM: protein of unknown function DUF574;
                     KEGG: sma:SAV_1049 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921184.1"
                     /db_xref="GI:357409448"
                     /db_xref="InterPro:IPR006764"
                     /db_xref="GeneID:11369685"
                     /translation="MSNGDTSIPKNIDVNVPSVARMYDYYLGGKDNYPADRVACEHLL
                     ERVPSTKVLAVNNRRFLRRVVHHLASEYGIRQFIDHGSGLPTQDNVHQVAQLVDPGAR
                     VVYIDNDPIVLAHGKAILEENDRTAVIQADMRDTEGILAHPEVVRLIDFDEPVAALFV
                     SVLHCIPDEDDPAGLVRRVAERLAPGSFLVVCQLVSEDAATRDFVTDYMAKSTGNQWG
                     RVRQQADVHGFLEGLDVLDPGLVEVSTWRPDSDLAPKQETEEWIEFGGVGRKW"
     misc_feature    249967..250257
                     /locus_tag="Sfla_0199"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     gene            complement(250532..251440)
                     /locus_tag="Sfla_0200"
                     /db_xref="GeneID:11369686"
     CDS             complement(250532..251440)
                     /locus_tag="Sfla_0200"
                     /inference="protein motif:SMART:SM00530"
                     /note="SMART: helix-turn-helix domain protein;
                     KEGG: fra:Francci3_3446 XRE family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921185.1"
                     /db_xref="GI:357409449"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11369686"
                     /translation="MPGIEPLQPSPKPTLASATGASPTALRLVLGAQLRRMRGEAGIT
                     PDVAADRIRCSTAKISRMETGHSPCKERDAADLLALYGVTDPARTAEFIDLVRRAGQR
                     GWWRNYADVLPDWFEPLVGLEEAAASIRTYEGHYVPGLLQTADYAYAVVRSGHALESE
                     EITRRRVELRLRRQQLLQRRDAPKLWVLLDEAVLMRPTGGARVMREQLVHLLEMTQLP
                     HVIVQVAPFEVTAHTSPGNGITYLRFAMDGLPDVAYIEHLTNATSVNKQESTDEYRWI
                     LDSLSAQSPSPVASRDLLRQALERYS"
     misc_feature    complement(251189..251350)
                     /locus_tag="Sfla_0200"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(251249..251251,251324..251326,
                     251336..251338))
                     /locus_tag="Sfla_0200"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(251252..251254,251327..251329))
                     /locus_tag="Sfla_0200"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(251246..251251,251261..251263,
                     251270..251272,251303..251308))
                     /locus_tag="Sfla_0200"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(251549..251785)
                     /locus_tag="Sfla_0201"
                     /db_xref="GeneID:11369687"
     CDS             complement(251549..251785)
                     /locus_tag="Sfla_0201"
                     /inference="protein motif:PFAM:PF04149"
                     /note="PFAM: protein of unknown function DUF397;
                     KEGG: sro:Sros_2513 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921186.1"
                     /db_xref="GI:357409450"
                     /db_xref="InterPro:IPR007278"
                     /db_xref="GeneID:11369687"
                     /translation="MQHYDNGVPANSLSGVEWRKSHHSNPSGNCVEMALLPGGEVAVR
                     NSRFPEGPALVYTGDEVRAFLAGVRDGDFDTMAG"
     misc_feature    complement(251576..251743)
                     /locus_tag="Sfla_0201"
                     /note="Domain of unknown function (DUF397); Region:
                     DUF397; pfam04149"
                     /db_xref="CDD:252412"
     gene            251988..252554
                     /locus_tag="Sfla_0202"
                     /db_xref="GeneID:11369688"
     CDS             251988..252554
                     /locus_tag="Sfla_0202"
                     /inference="similar to AA sequence:KEGG:SGR_7044t"
                     /note="KEGG: sgr:SGR_7044t regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_004921187.1"
                     /db_xref="GI:357409451"
                     /db_xref="GeneID:11369688"
                     /translation="MHEENTPRHGAAALPPRPASGGADPHEELARDLGIDAPGFTTRG
                     LGADPESLRQARAFVRDALECWGLGSCADDVTLVAGELVSNAVCHGIQPTEEHPELPT
                     ARLGLACQDGALVCAVNDSSPEVPVLRRAEDWLERGRGLRIIDALSSSWGWSRPTVAG
                     KTVWAVIPVLLGPALHSPTSAVQASARR"
     misc_feature    252120..252488
                     /locus_tag="Sfla_0202"
                     /note="Histidine kinase-like ATPase domain; Region:
                     HATPase_c_2; pfam13581"
                     /db_xref="CDD:257897"
     gene            complement(252512..253204)
                     /locus_tag="Sfla_0203"
                     /db_xref="GeneID:11369689"
     CDS             complement(252512..253204)
                     /locus_tag="Sfla_0203"
                     /inference="protein motif:PFAM:PF00657"
                     /note="PFAM: lipolytic protein G-D-S-L family;
                     KEGG: bcv:Bcav_3393 lipolytic protein G-D-S-L family"
                     /codon_start=1
                     /transl_table=11
                     /product="G-D-S-L family lipolytic protein"
                     /protein_id="YP_004921188.1"
                     /db_xref="GI:357409452"
                     /db_xref="GO:0008080"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="GeneID:11369689"
                     /translation="MTGSQGQDHRVPVPYRSECRVTVSLHHSATVLFQGDSITEVGRL
                     AERDCPLGNGYVRMAAESVRSARPDSGITFLNRGVAGDGVADMRARWRGDALDLRPDV
                     VSVLIGVNDTWRRYDSGTVTSVRAYEDDYRAVLTQVRDATGAQLILVEPFLVPVRDEQ
                     WAWREDLDPRIQTVRRLAEEFDAALLAADGLLNQAARAAGGPESIAGDGIHPTPLGHY
                     LLAEAWTALVGL"
     misc_feature    complement(252533..253114)
                     /locus_tag="Sfla_0203"
                     /note="SGNH_hydrolase subfamily. SGNH hydrolases are a
                     diverse family of lipases and esterases. The tertiary fold
                     of the enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site...; Region:
                     SGNH_hydrolase_like_2; cd01834"
                     /db_xref="CDD:238872"
     misc_feature    complement(order(252572..252574,252581..252583,
                     252875..252877,252962..252964,253094..253096))
                     /locus_tag="Sfla_0203"
                     /note="active site"
                     /db_xref="CDD:238872"
     misc_feature    complement(order(252572..252574,252581..252583,
                     253094..253096))
                     /locus_tag="Sfla_0203"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238872"
     misc_feature    complement(order(252875..252877,252962..252964,
                     253094..253096))
                     /locus_tag="Sfla_0203"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238872"
     gene            complement(253249..253410)
                     /locus_tag="Sfla_0204"
                     /db_xref="GeneID:11369690"
     CDS             complement(253249..253410)
                     /locus_tag="Sfla_0204"
                     /inference="similar to AA sequence:KEGG:SGR_6875"
                     /note="KEGG: sgr:SGR_6875 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921189.1"
                     /db_xref="GI:357409453"
                     /db_xref="GeneID:11369690"
                     /translation="MSSTEASDAPIYAGLVEEQGDVPAEVRRVAEETLLEVESALDFS
                     AVRAPAAAR"
     gene            253579..253651
                     /locus_tag="Sfla_R0001"
                     /note="tRNA-Trp1"
                     /db_xref="GeneID:11369691"
     tRNA            253579..253651
                     /locus_tag="Sfla_R0001"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:11369691"
     gene            complement(253695..254105)
                     /locus_tag="Sfla_0205"
                     /db_xref="GeneID:11369692"
     CDS             complement(253695..254105)
                     /locus_tag="Sfla_0205"
                     /inference="protein motif:TFAM:TIGR03561"
                     /note="KEGG: sgr:SGR_6917 hypothetical protein;
                     TIGRFAM: peroxiredoxin, Ohr subfamily;
                     PFAM: OsmC family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ohr subfamily peroxiredoxin"
                     /protein_id="YP_004921190.1"
                     /db_xref="GI:357409454"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR019953"
                     /db_xref="GeneID:11369692"
                     /translation="MDALYTAAATANGREGRAVSSDGQIDLALALPPALGGDGKGTNP
                     EQLFAAGYAACFASAMSSVAREMKVDTKDVSVTAEVSIGKDDSGFGLAVVMRVELPEA
                     LEGETGRRLVEATHAYCPYSKATRGNIDVELVIE"
     misc_feature    complement(253701..254096)
                     /locus_tag="Sfla_0205"
                     /note="peroxiredoxin, Ohr subfamily; Region:
                     organ_hyd_perox; TIGR03561"
                     /db_xref="CDD:234259"
     gene            254214..254693
                     /locus_tag="Sfla_0206"
                     /db_xref="GeneID:11369693"
     CDS             254214..254693
                     /locus_tag="Sfla_0206"
                     /inference="protein motif:PFAM:PF01047"
                     /note="KEGG: sgr:SGR_6918 MarR family transcriptional
                     regulator;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004921191.1"
                     /db_xref="GI:357409455"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="GeneID:11369693"
                     /translation="MTPTPPPAPAPSEPADSELLKLDHQVCFSLQAASRAFGGVYREA
                     LRDLGLTYPQYLAMMVLWEHGSLPVKTIGERLHLDSGTLSPLLKRLESAGLVRRERSP
                     QDERSVTVHLTDAGSELRGRALSVPRTILRATGLSVQEILALQETLGRLTASLGKAG"
     misc_feature    254304..254684
                     /locus_tag="Sfla_0206"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    254340..>254570
                     /locus_tag="Sfla_0206"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    order(254415..254423,254448..254459,254463..254468,
                     254475..254480,254484..254489,254505..254513)
                     /locus_tag="Sfla_0206"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(254415..254417,254424..254426)
                     /locus_tag="Sfla_0206"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            254803..255633
                     /locus_tag="Sfla_0207"
                     /db_xref="GeneID:11369694"
     CDS             254803..255633
                     /locus_tag="Sfla_0207"
                     /inference="protein motif:PFAM:PF07228"
                     /note="KEGG: sgr:SGR_310 hypothetical protein;
                     PFAM: Stage II sporulation protein E;
                     SMART: protein phosphatase 2C domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ser/Thr phosphatase"
                     /protein_id="YP_004921192.1"
                     /db_xref="GI:357409456"
                     /db_xref="GO:0004721"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="GeneID:11369694"
                     /translation="MNRRRTPRSASAEDLLSTLQHLTARARQEVQLHQARVELAQALQ
                     RDMLPATLPSFPGLRTAARYAPARDGLDIGGDWYDGFLLPDGALGLAIGDVQGHDVEA
                     AAFMGQIRIAMRAIASSTSDPGEVMGRTNDLIMSMNSTLFATCSFLRLDPRSRELRSA
                     RAGHVASVWATADGHSGVTADAGGLPLGIEPHQHYPVARRDLDVTGSFVLLTDGVIEG
                     PSLTIDDGLDRIRRLVSSHATADAEDLADQVLKAAALTGHEDDAAVLVLRHDAAAGPA
                     "
     misc_feature    255052..255612
                     /locus_tag="Sfla_0207"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     gene            255732..256694
                     /locus_tag="Sfla_0208"
                     /db_xref="GeneID:11369695"
     CDS             255732..256694
                     /locus_tag="Sfla_0208"
                     /inference="protein motif:PFAM:PF05231"
                     /note="PFAM: MASE1 domain protein;
                     KEGG: sgr:SGR_311  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor protein"
                     /protein_id="YP_004921193.1"
                     /db_xref="GI:357409457"
                     /db_xref="InterPro:IPR007895"
                     /db_xref="GeneID:11369695"
                     /translation="MLVLQILGITAVYYASAQLGLLRQVEVQGSVVTPLWPPSGIALA
                     SLLYLGLRIWPAIAAGALLTIMSITDSLTLWGVAVAAGSTLAPVCSFLALRAVGFRAQ
                     LDRLRDGVALVFLGALGGMVISATTGTGVQVLSGGQSASQFWPVWAAWWAGDAMGVLM
                     VTPLLLVLHKVRLPRMDDRWAEALALAVVAVTSAAIATRSPLSMIYLLFPVLVWAALR
                     FQLAGSAPCALLMSVMAIVAGTDGVGPFADHSVLEVMLNLCILNGCVALTALLLAAIV
                     TEHNNIRHETELACEELAALVEQLSPGPSPEGGPDGPRHGWDGA"
     misc_feature    255735..256481
                     /locus_tag="Sfla_0208"
                     /note="MASE1; Region: MASE1; cl17823"
                     /db_xref="CDD:266863"
     gene            complement(256691..258037)
                     /locus_tag="Sfla_0209"
                     /db_xref="GeneID:11369696"
     CDS             complement(256691..258037)
                     /locus_tag="Sfla_0209"
                     /inference="protein motif:PFAM:PF01565"
                     /note="PFAM: FAD linked oxidase domain protein;
                     D-arabinono-14-lactone oxidase;
                     KEGG: sro:Sros_2313 sorbitol oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase domain-containing protein"
                     /protein_id="YP_004921194.1"
                     /db_xref="GI:357409458"
                     /db_xref="GO:0003885"
                     /db_xref="GO:0016491"
                     /db_xref="GO:0050660"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="GeneID:11369696"
                     /translation="MRGAGTEPEDGRGVSSVAMIDHSEHGLSARRTNWAGNIAFGAKQ
                     LHTPASITELQELVSAGTAVRALGTGHSFNTVADTHGALISVAGLPRSVEIDTEARTA
                     TVSAGMRFGELTGTLHRSGLALHNLGSLPHISVAGACATGTHGSGVGNRALAGAVRAL
                     ELVTADGSVRTLERGDADFPGSVVSLGALGVVTRLTLDLVPAFEIQQWVYEGLPQEEL
                     LGRFDEVMSEAYSVSLFTGWHGGPIDQVWLKRRVGPGTPGTAPHRWHGSTLARGPRHP
                     VPGVAAEHCTEQQGVPGPWHARLPHFRLEFTPSNGDELQSEYFVARQDAVAAYEALDR
                     IRQDFAPLLQIGEIRTVAADDLWLSPAQGRDSVAFHFTWVPDTAAVTPVLGAVEEALA
                     PFAARPHWGKVFTTPPGVLRELYDHYADFERLTERFDPTGTFRNDFLARHFPRTGG"
     misc_feature    complement(256709..257944)
                     /locus_tag="Sfla_0209"
                     /note="FAD-linked oxidoreductase; Region: bact_FAD_ox;
                     TIGR01679"
                     /db_xref="CDD:130740"
     misc_feature    complement(257522..257899)
                     /locus_tag="Sfla_0209"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    complement(256712..257452)
                     /locus_tag="Sfla_0209"
                     /note="D-arabinono-1,4-lactone oxidase; Region: ALO;
                     pfam04030"
                     /db_xref="CDD:252326"
     gene            258339..258533
                     /locus_tag="Sfla_0210"
                     /db_xref="GeneID:11369697"
     CDS             258339..258533
                     /locus_tag="Sfla_0210"
                     /inference="similar to AA sequence:KEGG:SGR_312"
                     /note="KEGG: sgr:SGR_312 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921195.1"
                     /db_xref="GI:357409459"
                     /db_xref="GeneID:11369697"
                     /translation="MSALDKIKKMLKGHEDQAGKGIDKAGDMVDDRTQGKYSKHVDTG
                     QDKLKQQLGSDRDRNDPPRA"
     misc_feature    258348..258497
                     /locus_tag="Sfla_0210"
                     /note="MT0933-like antitoxin protein; Region:
                     MT0933_antitox; pfam14013"
                     /db_xref="CDD:258248"
     gene            258742..260337
                     /locus_tag="Sfla_0211"
                     /db_xref="GeneID:11369698"
     CDS             258742..260337
                     /locus_tag="Sfla_0211"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="KEGG: sgr:SGR_313 RNA polymerase ECF-subfamily
                     sigma factor;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: SCP-like extracellular; sigma-70 region 2 domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma 70 family subunit"
                     /protein_id="YP_004921196.1"
                     /db_xref="GI:357409460"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0016987"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:11369698"
                     /translation="MGETRETALIKAAQKGDPEAQDRLVASYLPLVYNIVGRALNGHA
                     DVDDVVQDSVLRMIRGLPSLRTPKSFRSWLVAITMNEIRGHWRERSTGGMSADPIQDA
                     YDVVDPAADFVELTIVRLGLTGQRREAAEATRWLDDDDRELVSLWWLETAGELSRAEV
                     ASALDLSPQHTAVRVQRMKERLEAARVVVRALAADPRCVLLEDLTVRWDGVPSALWRK
                     RLARHARECTVCAGHRSGLVPAEGLLVGLALVPVAASFAGTSEQLLPTAFLPATAAAA
                     GPGRAERRRDSARRRRRTTVVAGLAAVAVLGGGGAAVHLYTDDTDEDAATAVAPLDGP
                     PAPVSTASSPSAAPSSASPTPSSASPSPSAPPSPSASRSRSATATATPEKTRKPSTPS
                     SKPMAAPEASSAPSVADEVIALVNTERAKEGCGAVSGNGLLAKAASDHSADMVARDYF
                     SHTSPDGTDPGARITAAGYRWSTYGENIAKGQQTAESVMDAWMNSEGHRANILNCALK
                     ELGVGRVDSSGGPVWTQNFGTAL"
     misc_feature    258796..259287
                     /locus_tag="Sfla_0211"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    258811..259011
                     /locus_tag="Sfla_0211"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    259147..259278
                     /locus_tag="Sfla_0211"
                     /note="AsnC-type helix-turn-helix domain; Region:
                     HTH_AsnC-type; pfam13404"
                     /db_xref="CDD:257729"
     misc_feature    <259903..260331
                     /locus_tag="Sfla_0211"
                     /note="Uncharacterized protein with SCP/PR1 domains
                     [Function unknown]; Region: COG2340"
                     /db_xref="CDD:225218"
     misc_feature    259963..260325
                     /locus_tag="Sfla_0211"
                     /note="SCP_bacterial: SCP-like extracellular protein
                     domain, as found in bacteria and archaea. The wider family
                     of SCP containing proteins includes plant
                     pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
                     cysteine-rich secretory proteins, and allergen 5...;
                     Region: SCP_bacterial; cd05379"
                     /db_xref="CDD:240179"
     gene            260478..262310
                     /locus_tag="Sfla_0212"
                     /db_xref="GeneID:11369699"
     CDS             260478..262310
                     /locus_tag="Sfla_0212"
                     /inference="similar to AA sequence:KEGG:SAV_6248"
                     /note="KEGG: sma:SAV_6248 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921197.1"
                     /db_xref="GI:357409461"
                     /db_xref="InterPro:IPR018211"
                     /db_xref="GeneID:11369699"
                     /translation="MPTPPFPATRFPPWLAHVLRAQRGPVPWSAVLRGALAAVPLLLS
                     VLAERPTAGVPVALGAMLAGINDRPGSRRASVARLGLPALAGSAGLLCGSVVAETVGD
                     GRSLVVVPLVFGLLGLGAGAISSTGPVASACGTQVLVAVVIGAGMPLPEPGPVRALLF
                     LAGAGWLLLLRLVLPSPGGRRSGPYALDGEREAVAAVYEAVAGLLLAAGSPGARAGRT
                     ALSATLDQAQDALSGPRLRRRAGSAAERRLHARYAAALPLAEAATALAWAGVTLPVRF
                     SEGPRRLAAAVRSGVPCGPLPAPAGTDAGLRALDDALLRAAAVFDRPARVPPGERPGR
                     PGTSVLRRAWSAAGLEYGLRVAVSCAASTVLAQWLHHEHWYWLPATTVFLVKPDLGPL
                     ASRVVCRAVGTVAGAAVFGVLGVLSSGPSALVATVALCGALLPVATRHFALQTAVVTV
                     LVLSLVLLGGEPAASWARVVESLLACGTVLLTGHLPLPGRRGHGVRAALDTAVGAAHR
                     YLGHVLDAPEDKALGGALRRDAYRSLAKARTAIDLSAAELPPVSRHSAGSEGVAGALE
                     QLIDTTTACAVELGHRAAGLPAAHAEVLAAHLSELDRARAVPVG"
     misc_feature    261558..261920
                     /locus_tag="Sfla_0212"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            262346..262723
                     /locus_tag="Sfla_0213"
                     /db_xref="GeneID:11369700"
     CDS             262346..262723
                     /locus_tag="Sfla_0213"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: sgr:SGR_314 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004921198.1"
                     /db_xref="GI:357409462"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:11369700"
                     /translation="MIAELECVVLDCADPAGLARFYAAVLGGETDRPDGRWARGEDWA
                     TIHTPAGQVFCFQRVPEYRPPLWPDPAHPQQFHLDFAVPDLDRAHEQVVALGATVLDE
                     GDGCRSWRVFADPAGHPFCLVRH"
     misc_feature    262367..262711
                     /locus_tag="Sfla_0213"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(262376..262378,262472..262474,262508..262510,
                     262514..262516,262574..262576,262673..262675,
                     262700..262702,262706..262708)
                     /locus_tag="Sfla_0213"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            complement(262773..263114)
                     /locus_tag="Sfla_0214"
                     /db_xref="GeneID:11369701"
     CDS             complement(262773..263114)
                     /locus_tag="Sfla_0214"
                     /inference="similar to AA sequence:KEGG:SGR_315"
                     /note="KEGG: sgr:SGR_315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921199.1"
                     /db_xref="GI:357409463"
                     /db_xref="GeneID:11369701"
                     /translation="MEPDKESARGLAQVEGYLLWNAEVEEARRQARSFTGSLPWLTTA
                     QREDVERVYVADRVELCRDTLTRIAGRAVELRGEYTERYERLRARCVALSVLTVAGMG
                     GACAFLALVSR"
     gene            complement(263150..264880)
                     /locus_tag="Sfla_0215"
                     /db_xref="GeneID:11369702"
     CDS             complement(263150..264880)
                     /locus_tag="Sfla_0215"
                     /inference="protein motif:TFAM:TIGR02891"
                     /note="KEGG: sgr:SGR_316  cytochrome c oxidase subunit I;
                     TIGRFAM: cytochrome c oxidase, subunit I;
                     PFAM: cytochrome c oxidase subunit I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="YP_004921200.1"
                     /db_xref="GI:357409464"
                     /db_xref="GO:0004129"
                     /db_xref="GO:0005507"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="InterPro:IPR014241"
                     /db_xref="GeneID:11369702"
                     /translation="MTTRGPAVSAEADDAYQDELPVRRRQPGNVVITWLTTTDHKTIG
                     TLYLGTSFAFFMLGGVLALVMRAELARPGTQIVSNEQYNQAFTMHGTIMLLMFATPLF
                     AGFANWIMPLQIGAPDVAFPRLNMFAYWLYLFGSLIAVAGFLTPQGAADFGWFAYSPL
                     TDAVRSPGVGGDLWIMGLAFSGFGTILGSVNFITTIICMRAPGMTMFRMPIFTWNVLL
                     TGVLVLLAFPVLAAALLALEADRKFGAQVFNASNGGALLWQHLFWFFGHPEVYIIALP
                     FFGIVSEIIPVFSRKPIFGYVGLVAATIAIAGLSVTVWAHHMYVTGGVLLPFFSFMTF
                     LIAVPTGVKFFNWIGTMWKGSLSFETPMLWSVGFLVTFLFGGLTGVILASPPLDFHVS
                     DSYFVVAHFHYVVFGTVVFAMFAGFHFWWPKFTGKMLDERLGKITFWTLFIGFHGTFL
                     VQHWLGAEGMPRRYADYLAADGFTGLNTVSSIASFLLGLSMLPFMYNVWKTAKYGKKI
                     EVDDPWGYGRSLEWATSCPPPRHNFLTLPRIRSESPAFDLHYPSIRALEDATNRPHES
                     VTVAPGDKQE"
     misc_feature    complement(263165..264790)
                     /locus_tag="Sfla_0215"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    complement(263282..264781)
                     /locus_tag="Sfla_0215"
                     /note="Ubiquinol oxidase subunit I.  Ubiquinol oxidase,
                     the terminal oxidase in the respiratory chains of aerobic
                     bacteria, is a multi-chain transmembrane protein located
                     in the cell membrane.  It catalyzes the reduction of O2
                     and simultaneously pumps protons...; Region:
                     Ubiquinol_Oxidase_I; cd01662"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(264296..264298,264308..264310,
                     264326..264331,264497..264499,264506..264508,
                     264527..264529,264557..264559,264740..264742))
                     /locus_tag="Sfla_0215"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(264623..264631,264638..264640,
                     264686..264691,264698..264700,264710..264712))
                     /locus_tag="Sfla_0215"
                     /note="Putative ubiquinol binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(263420..263422,263537..263539,
                     263663..263665,263675..263677,264614..264616))
                     /locus_tag="Sfla_0215"
                     /note="Low-spin heme (heme b) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(263495..263497,263702..263707,
                     263717..263719,264101..264106))
                     /locus_tag="Sfla_0215"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(263681..263683,263930..263935,
                     264080..264082))
                     /locus_tag="Sfla_0215"
                     /note="Binuclear center (heme o3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(263852..263854,263861..263863,
                     263930..263935,264035..264037,264068..264070,
                     264080..264082))
                     /locus_tag="Sfla_0215"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    complement(order(263492..263497,263702..263707,
                     263930..263932))
                     /locus_tag="Sfla_0215"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238832"
     gene            complement(265091..265642)
                     /locus_tag="Sfla_0216"
                     /db_xref="GeneID:11369703"
     CDS             complement(265091..265642)
                     /locus_tag="Sfla_0216"
                     /inference="protein motif:PFAM:PF01183"
                     /note="KEGG: sgr:SGR_6772  glycosyl hydrolase;
                     PFAM: glycoside hydrolase 25;
                     SMART: Glycoside hydrolase, family 25 subgroup"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase 25"
                     /protein_id="YP_004921201.1"
                     /db_xref="GI:357409465"
                     /db_xref="GO:0003796"
                     /db_xref="InterPro:IPR002053"
                     /db_xref="InterPro:IPR018077"
                     /db_xref="GeneID:11369703"
                     /translation="MLHGIDVSAYQTEFDTDGLDFVFVKATEGRSYVNPRLRSQVKRV
                     RDAECVVGFYHFLWPGHAKDQAEYFVERTPDKEGDLLAVDWERTGEGTRASSADKDRF
                     IREVKRLRPHRRVLLYCNRSFWVGHDTSSYVGDGLWIADYGKAAAPRIDADWRIHQYT
                     DDPLDKNVADFPSREALRAWAEA"
     misc_feature    complement(265136..265636)
                     /locus_tag="Sfla_0216"
                     /note="Endo-N-acetylmuramidases (muramidases) are
                     lysozymes (also referred to as peptidoglycan hydrolases)
                     that degrade bacterial cell walls by catalyzing the
                     hydrolysis of 1,4-beta-linkages between N-acetylmuramic
                     acid and N-acetyl-D-glucosamine residues; Region:
                     GH25_muramidase; cd00599"
                     /db_xref="CDD:119373"
     misc_feature    complement(265139..265630)
                     /locus_tag="Sfla_0216"
                     /note="Glycosyl hydrolases family 25; Region:
                     Glyco_hydro_25; pfam01183"
                     /db_xref="CDD:250424"
     misc_feature    complement(order(265148..265150,265169..265171,
                     265229..265231,265289..265291,265385..265387,
                     265391..265393,265475..265477,265481..265483,
                     265568..265570,265625..265627))
                     /locus_tag="Sfla_0216"
                     /note="active site"
                     /db_xref="CDD:119373"
     gene            265830..266489
                     /locus_tag="Sfla_0217"
                     /db_xref="GeneID:11369704"
     CDS             265830..266489
                     /locus_tag="Sfla_0217"
                     /inference="protein motif:PFAM:PF03807"
                     /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
                     KEGG: sgr:SGR_317  oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420-dependent NADP oxidoreductase"
                     /protein_id="YP_004921202.1"
                     /db_xref="GI:357409466"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="GeneID:11369704"
                     /translation="MKIGIIGAGNIGGNLVRRLTALGHDVSVANSRGPETLKALAEET
                     GTTAVTASEAAKGARIVVVTVPLKAVPDLPSGLLDGAADDVAVIDTGNYYPQQRDGRI
                     PAIEDGLTESRWTEQQIGHAVVKAFNGTYAQDILDKGTPPGTPGRQALPVAGDDPEAK
                     QAVRDLIDELGFDTVDAGGIDESWRQQPGTPVYGNRGDAVTITKALADASPERTADWR
                     A"
     misc_feature    265830..266414
                     /locus_tag="Sfla_0217"
                     /note="Predicted dinucleotide-binding enzymes [General
                     function prediction only]; Region: COG2085"
                     /db_xref="CDD:224996"
     misc_feature    265851..266108
                     /locus_tag="Sfla_0217"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; pfam03807"
                     /db_xref="CDD:252177"
     gene            266683..267231
                     /locus_tag="Sfla_0218"
                     /db_xref="GeneID:11369705"
     CDS             266683..267231
                     /locus_tag="Sfla_0218"
                     /inference="protein motif:PFAM:PF10604"
                     /note="PFAM: Polyketide cyclase/dehydrase;
                     KEGG: sgr:SGR_325 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase/dehydrase"
                     /protein_id="YP_004921203.1"
                     /db_xref="GI:357409467"
                     /db_xref="InterPro:IPR019587"
                     /db_xref="GeneID:11369705"
                     /translation="MPRTMSVSDSILIRMAPSAVYRELSDPTAMGRWSPENRGARVLG
                     EHRGAHVGMVFEGRNKRGSFRWTTKCTVTAADPGERFAFRVHAIGARRPLLPGAIALW
                     EYRFESVDGFTRVTETWTDNRRSWPDFVANAFDRVATRGHTFAEFQRRNIRTTLERLK
                     AVLEADGAEDVRVEGDPGVGGA"
     misc_feature    266701..267171
                     /locus_tag="Sfla_0218"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cd07812"
                     /db_xref="CDD:176854"
     misc_feature    order(266701..266703,266707..266709,266713..266715,
                     266740..266748,266752..266757,266800..266802,
                     266818..266820,266824..266826,266830..266832,
                     266836..266838,266890..266892,266896..266898,
                     266902..266904,266923..266925,266929..266931,
                     266992..266997,267001..267003,267007..267009,
                     267025..267027,267031..267033,267037..267039,
                     267043..267045,267112..267126,267130..267135,
                     267142..267150,267157..267159)
                     /locus_tag="Sfla_0218"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(267341..268171)
                     /locus_tag="Sfla_0219"
                     /db_xref="GeneID:11369706"
     CDS             complement(267341..268171)
                     /locus_tag="Sfla_0219"
                     /inference="protein motif:PFAM:PF00657"
                     /note="PFAM: lipolytic protein G-D-S-L family;
                     KEGG: pjd:Pjdr2_5542 lipolytic protein G-D-S-L family"
                     /codon_start=1
                     /transl_table=11
                     /product="G-D-S-L family lipolytic protein"
                     /protein_id="YP_004921204.1"
                     /db_xref="GI:357409468"
                     /db_xref="GO:0016987"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11369706"
                     /translation="MSRSAVNSTTTRRRFLLGAAGALTAGVAGTLCAPGSASATGRTP
                     TAAGTLYIASDSTAQTYSSGYYPQAGWGQKLSPYFTSAVTVANRAIGGRSSRSFIEQG
                     RLAAIHAVIRPGDYLFVQFGHNDATVGNAERYTPPADYKEYLRNDYIRATRALGATPV
                     VVTPVSRRSYDASTGKFNVSFPAYVDAAKAVAREENAPLVDLSAASRSYLDRTGVEAS
                     KGIFLWLDAGQYPSFPGGVQDNTHFQERGAAEMARLVSRSVAGLGLPLSGEVVPTAAR
                     "
     misc_feature    complement(267401..268027)
                     /locus_tag="Sfla_0219"
                     /note="Rhamnogalacturan_acetylesterase_like subgroup of
                     SGNH-hydrolases. Rhamnogalacturan acetylesterase removes
                     acetyl esters from rhamnogalacturonan substrates, and
                     renders them susceptible to degradation by
                     rhamnogalacturonases. Rhamnogalacturonans are...; Region:
                     Rhamnogalacturan_acetylesterase_like; cd01821"
                     /db_xref="CDD:238859"
     misc_feature    complement(order(267446..267448,267800..267802,
                     267896..267898,268004..268006))
                     /locus_tag="Sfla_0219"
                     /note="active site"
                     /db_xref="CDD:238859"
     misc_feature    complement(order(267446..267448,267455..267457,
                     268004..268006))
                     /locus_tag="Sfla_0219"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238859"
     gene            complement(268282..269142)
                     /locus_tag="Sfla_0220"
                     /db_xref="GeneID:11369707"
     CDS             complement(268282..269142)
                     /locus_tag="Sfla_0220"
                     /inference="protein motif:PFAM:PF00805"
                     /note="PFAM: pentapeptide repeat protein;
                     KEGG: sgr:SGR_326 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat-containing protein"
                     /protein_id="YP_004921205.1"
                     /db_xref="GI:357409469"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="GeneID:11369707"
                     /translation="MPDHDPTAPAVTAPADLRADCANCFGLCCVALTLTASADFAIDK
                     DAGIPCPNLADDFRCGIHARLRTEGFTGCTVYDCFGAGQKVSQETYGGRDWRSAPDTA
                     RQMFQVFPVMRQLHELLRYLTEALTLPAAERLYADLRDVLATTEHLTRLPAGELADLD
                     VSAHRDRVASLLLRAGELERATVRRRDTRSRRGADLIGASLKGADLRGAELRGAYLIA
                     ADLRGADLRRAELIGADFRDADLSDADLSGALFLTQAQVNAARGNAATKLPDSLTRPP
                     HWAADRPGTA"
     misc_feature    complement(268306..>268566)
                     /locus_tag="Sfla_0220"
                     /note="Pentapeptide repeats containing protein [Function
                     unknown]; Region: COG1357"
                     /db_xref="CDD:224276"
     misc_feature    complement(268399..268518)
                     /locus_tag="Sfla_0220"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     gene            269273..269752
                     /locus_tag="Sfla_0221"
                     /db_xref="GeneID:11369708"
     CDS             269273..269752
                     /locus_tag="Sfla_0221"
                     /inference="similar to AA sequence:KEGG:SGR_327"
                     /note="KEGG: sgr:SGR_327 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921206.1"
                     /db_xref="GI:357409470"
                     /db_xref="GeneID:11369708"
                     /translation="MSASQERGFEPATGDGPENPADAEVRVAEVRTAFEGMLQIRRLT
                     RADLADPEGVPAPWELNRPLRAVALALEAAGIPASAVGTSGERVASGYRVCDGEAPGS
                     VRVEWVGPPGSGAAHDEEEALGRCVTVLRRLGWTALSYRGPRRRRFLEVEAPPSARS"
     gene            269816..270043
                     /locus_tag="Sfla_0222"
                     /db_xref="GeneID:11369709"
     CDS             269816..270043
                     /locus_tag="Sfla_0222"
                     /inference="similar to AA sequence:KEGG:SGR_328"
                     /note="KEGG: sgr:SGR_328 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921207.1"
                     /db_xref="GI:357409471"
                     /db_xref="GeneID:11369709"
                     /translation="MHQAEITAAQAYIRLMAATRAALADPDVAPLYMSVLASPMEEAD
                     EALRSAGLTGNEDRFFALVRQLQPTLTGSDR"
     gene            complement(270107..270865)
                     /locus_tag="Sfla_0223"
                     /db_xref="GeneID:11369710"
     CDS             complement(270107..270865)
                     /locus_tag="Sfla_0223"
                     /inference="protein motif:PFAM:PF08327"
                     /note="KEGG: ach:Achl_1019 transcriptional regulator, ArsR
                     family;
                     PFAM: Activator of Hsp90 ATPase 1 family protein;
                     regulatory protein ArsR;
                     SMART: regulatory protein ArsR"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="YP_004921208.1"
                     /db_xref="GI:357409472"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="GeneID:11369710"
                     /translation="MDAVFKALADPTRRRLLDELFRDDGQTLGALEARFAMTRFAVMK
                     HLKQLEAAGLVVTRRRGREKLHFLNPVPIRLVHDRWVSKYAEPWAAGLGDLKSRLENP
                     MEKVFEIYIRTTPERLWEAITDPEIRSKYNFGARVVSDWTEGSRFEMGAPGAAGPLGE
                     GKNLEVDPPHRLVQSMVALWSDDVRNEGATRITWEIEQVADSCRLTVTHDELRDGAHE
                     ELYGGWPMILSGLKTWLETGELLTTPGSLMYGDQ"
     misc_feature    complement(270650..270853)
                     /locus_tag="Sfla_0223"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(270707..270709,270797..270799,
                     270809..270814,270821..270826,270833..270835,
                     270842..270844,270848..270853))
                     /locus_tag="Sfla_0223"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(270668..270676,270689..270697,
                     270713..270718,270722..270727,270734..270739,
                     270743..270754,270779..270787,270827..270835,
                     270845..270850))
                     /locus_tag="Sfla_0223"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(270776..270778,270785..270787))
                     /locus_tag="Sfla_0223"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(270155..270556)
                     /locus_tag="Sfla_0223"
                     /note="Putative hydrophobic ligand-binding SRPBCC domain
                     of an uncharacterized subgroup of CalC- and Aha1-like
                     proteins; some contain an N-terminal GntR family winged
                     HTH DNA-binding domain; Region:
                     SRPBCC_CalC_Aha1-like_GntR-HTH; cd08893"
                     /db_xref="CDD:176902"
     misc_feature    complement(order(270173..270175,270182..270190,
                     270194..270220,270230..270232,270236..270238,
                     270242..270244,270248..270250,270278..270280,
                     270284..270286,270290..270295,270341..270346,
                     270350..270352,270368..270370,270377..270379,
                     270383..270388,270392..270394,270416..270418,
                     270422..270424,270428..270430,270434..270436,
                     270455..270457,270482..270484,270497..270502,
                     270506..270514,270539..270541,270545..270547,
                     270551..270553))
                     /locus_tag="Sfla_0223"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176902"
     gene            271079..272245
                     /locus_tag="Sfla_0224"
                     /db_xref="GeneID:11369711"
     CDS             271079..272245
                     /locus_tag="Sfla_0224"
                     /inference="protein motif:TFAM:TIGR02635"
                     /note="TIGRFAM: L-rhamnose isomerase;
                     KEGG: cai:Caci_6712 L-rhamnose isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose isomerase"
                     /protein_id="YP_004921209.1"
                     /db_xref="GI:357409473"
                     /db_xref="InterPro:IPR013457"
                     /db_xref="GeneID:11369711"
                     /translation="MSDVSAVKAALKSQVIETPSWGYGNSGTRFKVFAQPGVPRNPFE
                     KLADAAQVHAHTGVAPKVSLHIPWDRVEDYTALTRYAEELGLRVGAINSNVFQDEDFK
                     LGSVTHPDPKVRRKATDHLLECVDIMDATGSPDLKLWFSDGTNYPGQDDIAGRQDRLA
                     EALAEVYERLGHDQRMLLEYKLFEPAFYTTDVPDWGTSYAHCLKLGPKAQVVVDTGHH
                     APGTNIEFIVAFLLREGKLGAFDFNSRFYADDDLMAGAADPFQLFRIMHEVVKNGGLK
                     SETGVNFMLDQCHNIEAKIPAVIRSVTNVQEATAKALLIDAEALAAAQLSGDVLAANG
                     VLMDAFNTDVRPLLAAVREELGLAPDPFAAYLASGNQERIAADRVGGEQAGWGA"
     misc_feature    271088..272215
                     /locus_tag="Sfla_0224"
                     /note="L-rhamnose isomerase (RhaA); Region: RhaA; cl19165"
                     /db_xref="CDD:267518"
     gene            272315..274360
                     /locus_tag="Sfla_0225"
                     /db_xref="GeneID:11369712"
     CDS             272315..274360
                     /locus_tag="Sfla_0225"
                     /inference="protein motif:TFAM:TIGR02632"
                     /note="KEGG: sco:SCO0813 short chain dehydrogenase;
                     TIGRFAM: rhamnulose-1-phosphate aldolase/alcohol
                     dehydrogenase;
                     PFAM: class II aldolase/adducin family protein;
                     short-chain dehydrogenase/reductase SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulose-1-phosphate aldolase/alcohol
                     dehydrogenase"
                     /protein_id="YP_004921210.1"
                     /db_xref="GI:357409474"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013454"
                     /db_xref="GeneID:11369712"
                     /translation="MTSATHAEVAALLERAHRIGSDPRNTNYAGGNASAKATAADPVT
                     GGEAELLWVKGSGGDLGTLTEAGLAVLRLDRVRALKDVYPGVDREDEMVSAFDYCLHG
                     KGGAAPSIDTAMHALVEATHVDHLHPDSGIALACAADGEKLTAECFGDQVAWVGWRRP
                     GFQLGLDIAAVKERNPQAVGVILGGHGITAWGDTSEECERNALWMIRTAETFLEERGK
                     AEPFGAVLPGREALDREARLERAAALAPVIRGLASEDRPQVGHFTDAAPVLDFLARAE
                     HPRLAALGTSCPDHFLRTKVSPLVLDLPADAPLEEAVARLGVLHEEYREAYRSYYERH
                     AAPDSPAMRGADPAIVLVPGVGMFSFGKDKQTARVAGEFYLNAINVMRGAEAVSTYAP
                     IEESEKFRIEYWELEEAKLRRMPRPKALATRVALVTGAGSGIGRAIAHRLVGEGACVV
                     VADLNTETAAAVAEELGGPDKAVAVTVDVTSEEQIAEAFKAAAVAFGGVDLVVNNAGI
                     SISKPLLETSARDWDLQHDIMARGSFLVSREAARVMRAQRLGGDIVYITSKNAVFAGP
                     NNIAYSATKADQAHQVRLLAAELGEHGIRVNGVNPDGVVRGSGIFAAGWGAQRAATYG
                     IEEEKLGEFYAQRTILKREVLPEHVANAVFALTGGDLTHTTGLHIPVDAGVAAAFLR"
     misc_feature    272324..274357
                     /locus_tag="Sfla_0225"
                     /note="short chain dehydrogenase; Validated; Region:
                     PRK08324"
                     /db_xref="CDD:236241"
     misc_feature    272357..272953
                     /locus_tag="Sfla_0225"
                     /note="Class II Aldolase and Adducin N-terminal domain;
                     Region: Aldolase_II; smart01007"
                     /db_xref="CDD:214970"
     misc_feature    order(272639..272647,272687..272689,272693..272695,
                     272870..272872)
                     /locus_tag="Sfla_0225"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    order(272687..272689,272693..272695,272870..272872)
                     /locus_tag="Sfla_0225"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     misc_feature    order(272693..272695,272699..272704,272717..272725,
                     272753..272755,272783..272785,272867..272869,
                     272900..272902,272921..272923,272933..272935)
                     /locus_tag="Sfla_0225"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    273578..274339
                     /locus_tag="Sfla_0225"
                     /note="rhamnulose-1-phosphate aldolase/alcohol
                     dehydrogenase, classical (c) SDRs; Region: R1PA_ADH_SDR_c;
                     cd08943"
                     /db_xref="CDD:187647"
     misc_feature    order(273599..273601,273605..273616,273671..273679,
                     273743..273751,273827..273835,273896..273898,
                     273980..273988,274025..274027,274037..274039,
                     274115..274126,274130..274135)
                     /locus_tag="Sfla_0225"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187647"
     misc_feature    order(273899..273901,273986..273988,274025..274027,
                     274037..274039)
                     /locus_tag="Sfla_0225"
                     /note="active site"
                     /db_xref="CDD:187647"
     gene            274443..275924
                     /locus_tag="Sfla_0226"
                     /db_xref="GeneID:11369713"
     CDS             274443..275924
                     /locus_tag="Sfla_0226"
                     /inference="protein motif:PFAM:PF02782"
                     /note="PFAM: Carbohydrate kinase, FGGY-like;
                     KEGG: sen:SACE_4103  rhamnose kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbohydrate kinase, FGGY-like protein"
                     /protein_id="YP_004921211.1"
                     /db_xref="GI:357409475"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="GeneID:11369713"
                     /translation="MPATSRHDAAFAAVDLGATSGRVITGRVGPDELVLTEAHRFATT
                     PVHLPDGLHWDVLALYQGMLDGLRVAARGGPVTSVGIDTWAVDYGLLDADGSLLGLPF
                     HYRDARNAAAAEAVLARCDAQELYGVGGLQHLPFNTVFQLEAHRSTAQWSAARTLLMM
                     PDLLVHWLTGTVGAEVTNASTTGLFDARTGEWSDALMGRLGLERSLFPALREPGAPAG
                     TLLPHVAEFTGLPADTPVTTVASHDTASAVAAVPATGPGFAYVSCGTWSLAGLELDTP
                     VLTEESRAANFTNERGVDGTVRFLRNIMGMWLLEECRRTWERDGVATDLESLFWDAAR
                     VRPFAAVIDPDDPVFLAPGDMPSRIDAALVRTGQQVPDGPGGYVRCVLESLALAHRRT
                     LRRAAGLAGRELTRVHLVGGGSRNELLCQWTADATGLPVTAGPAEATALGNVLLQARA
                     HGLVGGLTEMRGLVARTQELRHYAPRGDTAAWDRAEDRLTARA"
     misc_feature    274470..275783
                     /locus_tag="Sfla_0226"
                     /note="L-rhamnulose kinases; a subfamily of the FGGY
                     family of carbohydrate kinases; Region: FGGY_RhuK;
                     cd07771"
                     /db_xref="CDD:198349"
     misc_feature    order(274473..274487,274494..274499,274506..274508,
                     274512..274514,274518..274520,274524..274526,
                     274539..274541,274545..274547,274560..274562,
                     274671..274694,274752..274757,274806..274811,
                     274818..274820,274830..274844,274848..274850,
                     274968..274973,274980..274982,275001..275003,
                     275082..275084,275151..275159,275166..275180,
                     275187..275189,275193..275198,275235..275240,
                     275268..275276,275280..275282,275286..275291,
                     275298..275321,275331..275336,275346..275348,
                     275361..275363,275370..275372,275490..275495,
                     275751..275753,275757..275765,275769..275774,
                     275778..275783)
                     /locus_tag="Sfla_0226"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198349"
     misc_feature    274476..275852
                     /locus_tag="Sfla_0226"
                     /note="rhamnulokinase; Region: rhamnulo_kin; TIGR02627"
                     /db_xref="CDD:233955"
     misc_feature    order(274485..274487,274491..274502,274506..274508,
                     274692..274700,274752..274754,275166..275174,
                     275229..275240,275244..275246,275346..275348,
                     275358..275360,275370..275372,275415..275417,
                     275427..275429,275673..275681,275685..275690)
                     /locus_tag="Sfla_0226"
                     /note="active site"
                     /db_xref="CDD:198349"
     misc_feature    order(274485..274487,274494..274496,275169..275171)
                     /locus_tag="Sfla_0226"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:198349"
     misc_feature    order(274485..274487,275169..275171)
                     /locus_tag="Sfla_0226"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198349"
     misc_feature    order(274491..274502,274506..274508,275229..275237,
                     275358..275360,275370..275372,275415..275417,
                     275427..275429,275673..275681,275685..275690)
                     /locus_tag="Sfla_0226"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198349"
     misc_feature    order(274692..274700,274752..274754,275166..275174,
                     275238..275240,275244..275246,275346..275348)
                     /locus_tag="Sfla_0226"
                     /note="carbohydrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198349"
     gene            complement(276060..277118)
                     /locus_tag="Sfla_0227"
                     /db_xref="GeneID:11369714"
     CDS             complement(276060..277118)
                     /locus_tag="Sfla_0227"
                     /inference="protein motif:PFAM:PF00378"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: sgr:SGR_329  enoyl-CoA hydratase/isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_004921212.1"
                     /db_xref="GI:357409476"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:11369714"
                     /translation="MNDDEPVLLHTEGHILHLTLNRPRALNALTHTMVRGIDEALVRA
                     ADDDAVTAVVIDGAGGRGLCAGGDIRSIYEDARAGRSASVDFWRDEYRLNARIARFPK
                     PYVALMDGIVMGGGVGVSAHGDVRVVTERSRVAMPETAIGFVPDVGGTHLLAAAPGEL
                     GTHLALTGRTVGAADAVLCGLADHFVPSQHLADLVTELARSATPTEVQETVRRYATTA
                     PEGELAAQRTWIDECYAADTVEEIIDRLSNSGVTAAKETAAALLTASPTALKVTLAAV
                     RRAARLGSLEAVLDQEFRVSCRAFTGHDLTEGVRARIIDKDRTPRWSPAEIHEVTAAE
                     VARHFEPLGDRELGLFTS"
     misc_feature    complement(276096..277112)
                     /locus_tag="Sfla_0227"
                     /note="3-hydroxyisobutyryl-CoA hydrolase; Provisional;
                     Region: PRK05617"
                     /db_xref="CDD:235533"
     misc_feature    complement(276519..277100)
                     /locus_tag="Sfla_0227"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(276696..276698,276705..276710,
                     276774..276782,276786..276788,276912..276926,
                     276936..276938,277035..277037,277041..277043))
                     /locus_tag="Sfla_0227"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(276774..276776,276918..276920))
                     /locus_tag="Sfla_0227"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(276525..276527,276570..276572,
                     276579..276581,276612..276614,276621..276626,
                     276630..276635,276639..276641,276654..276659,
                     276663..276671,276675..276677,276693..276704,
                     276738..276749,276810..276812,276834..276836))
                     /locus_tag="Sfla_0227"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(276099..276452)
                     /locus_tag="Sfla_0227"
                     /note="2-enoyl-CoA Hydratase C-terminal region; Region:
                     ECH_C; pfam13766"
                     /db_xref="CDD:258052"
     gene            277298..279391
                     /locus_tag="Sfla_0228"
                     /db_xref="GeneID:11369715"
     CDS             277298..279391
                     /locus_tag="Sfla_0228"
                     /inference="protein motif:PFAM:PF07228"
                     /note="KEGG: sgr:SGR_330 hypothetical protein;
                     PFAM: Stage II sporulation protein E; PAS fold-3 domain
                     protein;
                     SMART: protein phosphatase 2C domain protein; PAC
                     repeat-containing protein; GAF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor protein"
                     /protein_id="YP_004921213.1"
                     /db_xref="GI:357409477"
                     /db_xref="GO:0004721"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="GeneID:11369715"
                     /translation="MTDSSRRADGDALSRLPLERHRAGETGTVERLALNRTGSFEWDL
                     DARTVDVDDAGLMVFGLDPATFDASPSAVIDRLDAADRARLETTIDEAVAGGSNSYSV
                     HFQMPMEDGTHQWTHVQARILRSEDGRAHRVIGVVRDATAEVTHSAFVLDLEKRRRRQ
                     TSIVERTTTAMSRAVTVDDVTAALTGPGGLVGIGADGLALGLVENSALKIIALSGDSV
                     EVLAGLGAGRLDATLPLGDTILSGRPRFITSLGALVQRYPALEPHIGELKFRAVAYLP
                     LIAQARPLGGLALFYRERTAFSADERILCLGLAAIVAQSLQRAILFDEEREFATGLQS
                     AMLPRRIQEIEGGEIAVRYHSAWSGREVGGDWYDVVTLPRGRIGVAVGDVQGHDTHAA
                     AIMGQLRIALRAYAAEGHPPATVLARASRFLAELDTDRFATSTYAQVDLATGEVRVAR
                     AGHFGPLIRHTDGRVGVPQVRGGLPLGISSDFGDEEYPETRLDLVPGETLVLYTDGLV
                     EEPGADVDAGVAALIHEVSEGPDGAEALADHLSDRLWERWGSGDDVALLVLRRSPDLG
                     SPQAPRLHQYIHQADPQGLSEARAIVRQALTDWGLAGLADDAETVTGELLVNVLLHTE
                     GGAVLTLEVLPEPVRRIRLSVQDRSSVWPRRRTPGETSTSGRGLLLLDAVAERWGIEP
                     RGEGKAVWCEIGPDA"
     misc_feature    277406..277714
                     /locus_tag="Sfla_0228"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    277442..277708
                     /locus_tag="Sfla_0228"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(277448..277450,277460..277462,277478..277480,
                     277523..277534,277613..277615,277628..277630)
                     /locus_tag="Sfla_0228"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(277514..277516,277526..277528,277550..277552,
                     277559..277564,277649..277651,277655..277657)
                     /locus_tag="Sfla_0228"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    277874..278248
                     /locus_tag="Sfla_0228"
                     /note="GAF domain; Region: GAF_2; pfam13185"
                     /db_xref="CDD:257553"
     misc_feature    278414..278980
                     /locus_tag="Sfla_0228"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     misc_feature    279035..279376
                     /locus_tag="Sfla_0228"
                     /note="Histidine kinase-like ATPase domain; Region:
                     HATPase_c_2; pfam13581"
                     /db_xref="CDD:257897"
     gene            complement(279557..280216)
                     /locus_tag="Sfla_0229"
                     /db_xref="GeneID:11369716"
     CDS             complement(279557..280216)
                     /locus_tag="Sfla_0229"
                     /inference="similar to AA sequence:KEGG:SGR_331"
                     /note="KEGG: sgr:SGR_331 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921214.1"
                     /db_xref="GI:357409478"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="InterPro:IPR019931"
                     /db_xref="GeneID:11369716"
                     /translation="MTIPRRSWRGAGAFAAAAVVGLAGGVISAAPAAAHTPTWAVTCS
                     EVTLNLTAYSSKATNEVTVSVVGGEDLLATTEFGREYHTKTPLQLPKHDKELQVRLVV
                     KAGDDDKYSFEQTKTAPVCEDDETPPQETPSETPSETPSETPSTEPSASETAEPSAEP
                     SETATEAAPAPAESSSSAPDLAETGSSSATPVIGGAALAVLLAGGGILWSVRKRRGVQ
                     H"
     misc_feature    complement(<279644..279862)
                     /locus_tag="Sfla_0229"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(280421..280909)
                     /locus_tag="Sfla_0230"
                     /db_xref="GeneID:11369717"
     CDS             complement(280421..280909)
                     /locus_tag="Sfla_0230"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: sgr:SGR_333  acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_004921215.1"
                     /db_xref="GI:357409479"
                     /db_xref="GO:0008080"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11369717"
                     /translation="MLIREATEKDWPSIWPFFRTIVTAGETFTYPTDLEEDQAQGWWL
                     LEEPNRTVVAVDDTGAVLGTAKMNRNHMGNGSHISSASYMVAPEHSGRGVGRALCEHT
                     LDWAREAGYRAMQFNAVVETNTNAMKLYRSLGFEIIGTLPEGFRHPEHGYVGLHIMHK
                     SL"
     misc_feature    complement(280502..280906)
                     /locus_tag="Sfla_0230"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(280568..280756)
                     /locus_tag="Sfla_0230"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(280622..280627,280655..280663))
                     /locus_tag="Sfla_0230"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(280950..281945)
                     /locus_tag="Sfla_0231"
                     /db_xref="GeneID:11369718"
     CDS             complement(280950..281945)
                     /locus_tag="Sfla_0231"
                     /inference="similar to AA sequence:KEGG:SGR_334"
                     /note="KEGG: sgr:SGR_334 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921216.1"
                     /db_xref="GI:357409480"
                     /db_xref="GeneID:11369718"
                     /translation="MTVTGAGRALAARTGAPVSLGRAAQELALRRGDFDLAVQLGLIR
                     AELPAGGTRPRIRREEIDRLRALPGFPDSLREQVRTAGTAEGASLLGVGTSRFTGLAR
                     IGCISPVAFCLNRYRTVVWLYLVDELLAFAAREPHLIAGQSPVGMRTMLDSGTDRRAR
                     NWRSRRIDRLLNRTEDPWRRAALQATALDPVQLAEVVDDPYERAYLARMAPDPAFGRP
                     ASVSGREAMARLILADDPDEILWRRVNLTLELEQARETRSAPRPGYDPALRPLEAGSD
                     RSPREARARDFPVPDGRSSASRGPGRSSRGPAARRAACRGLLVRIGLRGHGRRAG"
     gene            complement(282054..282464)
                     /locus_tag="Sfla_0232"
                     /db_xref="GeneID:11369719"
     CDS             complement(282054..282464)
                     /locus_tag="Sfla_0232"
                     /inference="protein motif:PFAM:PF03259"
                     /note="PFAM: Roadblock/LC7 family protein;
                     KEGG: sgr:SGR_335 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Roadblock/LC7 family protein"
                     /protein_id="YP_004921217.1"
                     /db_xref="GI:357409481"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="GeneID:11369719"
                     /translation="MALDRGLDWLLDDLTSRVEHIQHALVLSNDGLVTGASTSLARED
                     AEHLAAVSSGLQSLARGSGRHFGAGRARQTMVEFDEALLFVTAAGDGSCLCVLTAAEA
                     DIGQVAYEMTLLVNRVGEHLGVTVRQGADSVDHL"
     misc_feature    complement(282171..282446)
                     /locus_tag="Sfla_0232"
                     /note="Roadblock/LC7 domain; Region: Robl_LC7; pfam03259"
                     /db_xref="CDD:251835"
     gene            complement(282681..283316)
                     /locus_tag="Sfla_0233"
                     /db_xref="GeneID:11369720"
     CDS             complement(282681..283316)
                     /locus_tag="Sfla_0233"
                     /inference="protein motif:PFAM:PF03029"
                     /note="PFAM: protein of unknown function ATP binding;
                     KEGG: sma:SAV_1579 ATP/GTP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921218.1"
                     /db_xref="GI:357409482"
                     /db_xref="GO:0000166"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="GeneID:11369720"
                     /translation="MSLEHVHSTDGEEAGDSSSLALKILVAGGFGAGKTTLVGAVSEI
                     RPLRTEELLSEAGQLVDDTGGVDQKTTTTVAMDFGRITIRSGLSLYLFGTPGQDRFWF
                     LWDELSQGALGAVVLADTRRLEDCFPAVDYFEHRRIPFVVAVNCFSGARTYAEEDVAR
                     ALDLDRGTPVVLCDARDRASGKDVLIRMVEYAGRMHTARLLESVGQGAGPE"
     misc_feature    complement(282747..283244)
                     /locus_tag="Sfla_0233"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cd00882"
                     /db_xref="CDD:206648"
     misc_feature    complement(282741..283241)
                     /locus_tag="Sfla_0233"
                     /note="Conserved hypothetical ATP binding protein; Region:
                     ATP_bind_1; pfam03029"
                     /db_xref="CDD:251682"
     misc_feature    complement(283212..283235)
                     /locus_tag="Sfla_0233"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(282789..282797,282879..282884,
                     283029..283031,283209..283229))
                     /locus_tag="Sfla_0233"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    complement(283098..283100)
                     /locus_tag="Sfla_0233"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(283080..283088)
                     /locus_tag="Sfla_0233"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(283029..283040)
                     /locus_tag="Sfla_0233"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(282978..282983,283029..283034))
                     /locus_tag="Sfla_0233"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(282876..282884)
                     /locus_tag="Sfla_0233"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(282789..282797)
                     /locus_tag="Sfla_0233"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     gene            complement(283490..283876)
                     /locus_tag="Sfla_0234"
                     /db_xref="GeneID:11369721"
     CDS             complement(283490..283876)
                     /locus_tag="Sfla_0234"
                     /inference="protein motif:PFAM:PF05331"
                     /note="PFAM: protein of unknown function DUF742;
                     KEGG: sco:SCO1158 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921219.1"
                     /db_xref="GI:357409483"
                     /db_xref="InterPro:IPR007995"
                     /db_xref="GeneID:11369721"
                     /translation="MPPGSQWYDAEAGPLVRPYAVTGGRTRSGPGGVRFDLIALVEAD
                     DAAADRRGASLLGPEHRALLSLCGQDARSVAELSADADLPVGVVRVLLGDLLEAGCVR
                     VSRPVPPARLPDEWVLREVIDGLRAL"
     misc_feature    complement(283493..283849)
                     /locus_tag="Sfla_0234"
                     /note="Protein of unknown function (DUF742); Region:
                     DUF742; pfam05331"
                     /db_xref="CDD:253154"
     gene            complement(284025..284462)
                     /locus_tag="Sfla_0235"
                     /db_xref="GeneID:11369722"
     CDS             complement(284025..284462)
                     /locus_tag="Sfla_0235"
                     /inference="protein motif:PFAM:PF03259"
                     /note="PFAM: Roadblock/LC7 family protein;
                     KEGG: sma:SAV_1581 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Roadblock/LC7 family protein"
                     /protein_id="YP_004921220.1"
                     /db_xref="GI:357409484"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="GeneID:11369722"
                     /translation="MIVNERPGKASGHSGELDWLLDDLVARVAEIRHAVVLSDDGLTV
                     GASCALSRQDAEHLAAVASGFNSLAKGTGRHFGAGSVRRTMVEMDDGFLFVVAAGHGS
                     CLTVLSTALTDIGLVAYEMARLVKRVGEHLVAPVRSAGPPATG"
     misc_feature    complement(284139..284414)
                     /locus_tag="Sfla_0235"
                     /note="Roadblock/LC7 domain; Region: Robl_LC7; pfam03259"
                     /db_xref="CDD:251835"
     gene            complement(284459..287095)
                     /locus_tag="Sfla_0236"
                     /db_xref="GeneID:11369723"
     CDS             complement(284459..287095)
                     /locus_tag="Sfla_0236"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: scb:SCAB_79951 hypothetical protein;
                     PFAM: ATP-binding region ATPase domain protein;
                     SMART: ATP-binding region ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding region ATPase domain-containing
                     protein"
                     /protein_id="YP_004921221.1"
                     /db_xref="GI:357409485"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR010910"
                     /db_xref="GeneID:11369723"
                     /translation="MRTPRTTTPGPGAPAGRPATPPRGRRAHAGRPADERPGPETGAS
                     AGRRPRHGSLRPRTVRAKIISLLMVPVVSLLALWGFATVTTAQDVARLREVRRLDTTV
                     RGPVTEAVRALQDERTAALRQLAAPGTGHAATLRERAGRTDAALKALSIGGGHTVADA
                     GLLPVGTAARLTAFLDEVKQVRTVRTRLLSPSRNGSGAPPATGTRGPDTAAGRPAGTE
                     TPSAYTQYGDAVTAALGVCGSLTGIQEAETGSRTRVLLELTRSGEMLAREESLLASAA
                     PKGTLDAEGLRAFAGAVAARRAFADTAGADLPGPGRQAWRELTGRDSYARLEAAEDTV
                     LALPAGRRAKAVPVASWERDAAAVRTELRAIETAAGQGSAGRTDPVARALLSPAAAAV
                     LLGFLAVAASLVISVRIGRGLVVELVGLRDSALDIARRKLPHAMRRLRAGEEIDVRAE
                     TPPGRMSHDEIGQVGEALDTVHRAALDAAVERAELADGISGVFVNLARRSQTLVHRQL
                     ALLDAMERRADDPEELGDLFRLDHLTTRMRRHAESLIILSGAAPGRAWRMPVSLTDVV
                     RAAVSEIEDYARVDVPALPDAAVQGGAVADLTHLLAELVENAAQFSPPHTRVRITGEP
                     VGNGYVLEIEDRGLGMGREVLDEANRRIEQAGALDLFDSDRLGLFVVSRLSARHSVKV
                     QLRTSAYGGTTAVVLLPTALLQGGLPRGSEARTAVGAAPEDVVGAGDGGPRTGHPGAA
                     ARTRIPGPPRPTARTAPIAVPAVGPGGRPAPREEGPVPARTSAPHRRPASTEDGELPR
                     RVRQASLVPQLRDGPGPQDSGQYPGRRAVPAAYTPEQARDRMSAYRAGWVRGGGAPPG
                     SPAEGRSVPVSLSRRHTEGDRS"
     misc_feature    complement(285965..286780)
                     /locus_tag="Sfla_0236"
                     /note="Nitrate and nitrite sensing; Region: NIT;
                     pfam08376"
                     /db_xref="CDD:254763"
     misc_feature    complement(284999..285970)
                     /locus_tag="Sfla_0236"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(285002..285307)
                     /locus_tag="Sfla_0236"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(285014..285016,285020..285025,
                     285038..285040,285044..285046,285092..285103,
                     285176..285181,285185..285187,285191..285193,
                     285197..285199,285266..285268,285275..285277,
                     285287..285289))
                     /locus_tag="Sfla_0236"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(285275..285277)
                     /locus_tag="Sfla_0236"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(285095..285097,285101..285103,
                     285179..285181,285185..285187))
                     /locus_tag="Sfla_0236"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(287271..288068)
                     /locus_tag="Sfla_0237"
                     /db_xref="GeneID:11369802"
     CDS             complement(287271..288068)
                     /locus_tag="Sfla_0237"
                     /inference="protein motif:PFAM:PF03707"
                     /note="PFAM: MHYT domain protein;
                     KEGG: scb:SCAB_79941  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor protein"
                     /protein_id="YP_004921222.1"
                     /db_xref="GI:357409486"
                     /db_xref="InterPro:IPR005330"
                     /db_xref="GeneID:11369802"
                     /translation="MGHLDHAAFGWLTPVLSYAMAAIGAALGLRCTVRALGSRGRSRR
                     NWLITAASALGTGIWTMHFVAMLGFGVTGTDIRYDVPLTLLSLLVAMLVVGAGVFTVG
                     YGKDRPRALVVGGLTTGLGVASMHYLGMAALRLHGSVAYDPLLVTVSVGIAVVAATAA
                     LWAALNIRSAGAVAVASLVMGAAVSSMHYTGMLAVDVRVAPSTSALPGATVMQFIFPL
                     AVGLGSYLFLTSAFVALSPAAREHTAAPPPAVVEDASAERHTRTTAS"
     misc_feature    complement(287364..288023)
                     /locus_tag="Sfla_0237"
                     /note="MHYT domain (predicted integral membrane sensor
                     domain) [Signal transduction mechanisms]; Region: COG3300"
                     /db_xref="CDD:225837"
     misc_feature    complement(287721..287906)
                     /locus_tag="Sfla_0237"
                     /note="Bacterial signalling protein N terminal repeat;
                     Region: MHYT; pfam03707"
                     /db_xref="CDD:252111"
     misc_feature    complement(<287613..287714)
                     /locus_tag="Sfla_0237"
                     /note="Bacterial signalling protein N terminal repeat;
                     Region: MHYT; pfam03707"
                     /db_xref="CDD:252111"
     gene            288230..288829
                     /locus_tag="Sfla_0238"
                     /db_xref="GeneID:11369803"
     CDS             288230..288829
                     /locus_tag="Sfla_0238"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11;
                     KEGG: sgr:SGR_342  methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_004921223.1"
                     /db_xref="GI:357409487"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:11369803"
                     /translation="MADDHSHVQDFFAPRAAGWDTRFPDDGPAYAAAVRELGLRPGDT
                     AIDAGCGTGRALPALREAVGAGGTVIGVDLTREMLDAARRAGREASGALLLSDVARLP
                     LPSGVADAVLAAGLVSHLPHPGRGLVELARVVRPGGRLALFHPIGRAALAARHGRPLS
                     DDDLRAEPRLTPLLADAGWRLDAYTDEDSRFLALAVRTG"
     misc_feature    288359..288655
                     /locus_tag="Sfla_0238"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(288371..288391,288446..288451,288515..288523,
                     288569..288571)
                     /locus_tag="Sfla_0238"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(288864..289769)
                     /locus_tag="Sfla_0239"
                     /db_xref="GeneID:11369804"
     CDS             complement(288864..289769)
                     /locus_tag="Sfla_0239"
                     /inference="similar to AA sequence:KEGG:SGR_343"
                     /note="KEGG: sgr:SGR_343 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921224.1"
                     /db_xref="GI:357409488"
                     /db_xref="GeneID:11369804"
                     /translation="MVQRYERLKEIQRLDPERDFLEIYRLTVTYEFPWDITRALELAL
                     YRTYAVPSIGRLLAETAELTERSQKRYDDTALLLDAVVEHGFDSERGRTAVRRINRMH
                     RSYDISNDDMRYVLCTFVVTPKRWIDAYGWRRLSGHELRAFAAYYRTLGAHMGIQDVP
                     QTYEDFERLLDAYEDEHFGWDRGARAVSDATLALMGSWYPRPLAPVVRRASLALLDDS
                     LLRAFRYARPGPLTRGLTRGSLRLRARAVRLLPPRQSPHYARQNPEIKGYPHGYELAR
                     LGTFPTPGVRGCPMPHGRPPEEPAG"
     misc_feature    complement(289143..289643)
                     /locus_tag="Sfla_0239"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2236); Region: DUF2236; cl01472"
                     /db_xref="CDD:260952"
     gene            289967..290845
                     /locus_tag="Sfla_0240"
                     /db_xref="GeneID:11369805"
     CDS             289967..290845
                     /locus_tag="Sfla_0240"
                     /inference="similar to AA sequence:KEGG:SCO1165"
                     /note="KEGG: sco:SCO1165 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921225.1"
                     /db_xref="GI:357409489"
                     /db_xref="GeneID:11369805"
                     /translation="MRVGAVVGTDETAADDALFVLTAVLLTPAQFPSVLGDDYVAACG
                     ALGLEPYAEGYGLVLGQDSGGARWTVVVEDVSLVAVAIASWDCGMEYDLSPDDRSVVC
                     ALPGWPLALAVAAPGVPEPHDPPPGPDGDDPAPLTPPDTDVWGPPQRRLGADEIALQW
                     SAWRGRIDDETAFGRSDEAATDAGERTDGGPAGEGPADSAGPARHPGVRMALEAAGAY
                     IDSPPPAGRIRSAFAPGGARTLRVDGPGWSLVARTDDIAFVLLDEEPGEIIPVGRGPE
                     LPKLLKALDELAVRPS"
     gene            complement(290889..291395)
                     /locus_tag="Sfla_0241"
                     /db_xref="GeneID:11369806"
     CDS             complement(290889..291395)
                     /locus_tag="Sfla_0241"
                     /inference="protein motif:PFAM:PF03473"
                     /note="PFAM: MOSC domain containing protein;
                     KEGG: sgr:SGR_1554 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MOSC domain-containing protein"
                     /protein_id="YP_004921226.1"
                     /db_xref="GI:357409490"
                     /db_xref="GO:0003824"
                     /db_xref="GO:0030151"
                     /db_xref="GO:0030170"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="GeneID:11369806"
                     /translation="MYSFTKPSRDSVTLLAGLGVEGDVHAGVTVKHRSRVAQDPTQPN
                     LRQVHLIHQELFAELRQAGFEVSPGDLGENITTEGIDLLGLPVGTLLHLGDEAVVEVT
                     GLRNPCLQIDTFQAGLLKQVVGRADDGTVVRKAGIMSVVRTGGVVRPGDVIKAVLPVG
                     PHRRLERV"
     misc_feature    complement(290931..291344)
                     /locus_tag="Sfla_0241"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:251984"
     gene            complement(291428..291610)
                     /locus_tag="Sfla_0242"
                     /db_xref="GeneID:11369807"
     CDS             complement(291428..291610)
                     /locus_tag="Sfla_0242"
                     /inference="similar to AA sequence:KEGG:SGR_345"
                     /note="KEGG: sgr:SGR_345 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921227.1"
                     /db_xref="GI:357409491"
                     /db_xref="GeneID:11369807"
                     /translation="MSNGAKIAIGGVVAAVVLIPFIGFWWSLLVLIGVPVVGYLMLDP
                     SQRRRLRRISRKEIGR"
     gene            complement(291705..292769)
                     /locus_tag="Sfla_0243"
                     /db_xref="GeneID:11369808"
     CDS             complement(291705..292769)
                     /locus_tag="Sfla_0243"
                     /inference="protein motif:PFAM:PF00487"
                     /note="PFAM: fatty acid desaturase;
                     KEGG: sgr:SGR_346  delta-6 fatty acid desaturase"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="YP_004921228.1"
                     /db_xref="GI:357409492"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="GeneID:11369808"
                     /translation="MPQAVTATVAEHIRDGSDGPGSAQAPGSDFAPLLKAVRGQGLLE
                     RRTGWYAAGIAVNLVALGAVITGMFLLGDTWWNLLLALPLALLWTRTAFYGHDAGHAQ
                     ITAGRKAGRVVGLVHANLLLGMNEAWWNDKHVRHHANPNHVDKDPDVGVGALVWTQKQ
                     AAQREGFARWLTRNQARLFFPMLLLEGIALKIYGFQFLRRQPARERALSGLLLTGHLA
                     LYAALLLTVMSPGKALVFALVHHALFGLHLGMAFAPNHKGMEMPDPDGDRWGHLQRQV
                     LTSRNVRGAVLTDWLLGGLNYQIEHHLFPSMPRPHLRLAQPLVKAHCASIGMPYAETG
                     IVESYRQALRHMHEVGEPLR"
     misc_feature    complement(291786..292508)
                     /locus_tag="Sfla_0243"
                     /note="The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like
                     CD includes the integral-membrane enzymes: delta-4,
                     delta-5, delta-6, delta-8, delta-8-sphingolipid, and
                     delta-11 desaturases found in vertebrates, higher plants,
                     fungi, and bacteria. These desaturases...; Region:
                     Delta6-FADS-like; cd03506"
                     /db_xref="CDD:239583"
     misc_feature    complement(order(291864..291869,291876..291878,
                     292359..292364,292371..292373,292470..292472,
                     292482..292484))
                     /locus_tag="Sfla_0243"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239583"
     gene            292965..295943
                     /locus_tag="Sfla_0244"
                     /db_xref="GeneID:11369809"
     CDS             292965..295943
                     /locus_tag="Sfla_0244"
                     /inference="protein motif:PFAM:PF00176"
                     /note="KEGG: sgr:SGR_347 SNF2/RAD54 family helicase;
                     PFAM: SNF2-related protein; helicase domain protein;
                     SMART: DEAD-like helicase ; helicase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SNF2-like protein"
                     /protein_id="YP_004921229.1"
                     /db_xref="GI:357409493"
                     /db_xref="GO:0003676"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004386"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:11369809"
                     /translation="MGGVPSATPGSLVKFEESDIAVHRLPAETLDEISELSRCSAVFL
                     PADPARTGLIAFWNADGSTPPGHPGIRLHEGEGPPGTAGGRTDLTIVGSDVRPYVVPA
                     LLLPVSEALPVLTRARTGARSSPSTAFWGAAGLLALQLVARGLLLPGLSPADHDAWRA
                     GPLTADDIERIRVLAASMPPEAHAVPLDAAAGPVMLPDPESLLRSFLDAVADGLPRTP
                     AATAVTGTPAFAARGAQRLPRLRTWAADVAAGHDAGVRLSLRVEVSGLAAAAGEGDAE
                     GAPSFRAVLQIHSIQDPALVADAADVWADRSPAASSFGPRARMDALLALRRAARAWPP
                     LTPLLSAAVPDAIEPADDEIAELLGPAARALAATGVQVHWPKELARKLTARAVISPQD
                     DEDATAARTESDTPSFLSADALLAFDWWFALGDRKLSREELDRLAEAGRPLVRLRDQW
                     VLIDPEDARRARESRDRKVTPIDALGAVLTGSTEVDGRRVDVAATGWLEQLRARIAAP
                     ESGDLRAVGQPEALDAALRDYQLRGLNWLHTMTSLGLGCCLADDMGLGKTITLIALHL
                     HRRTIEAAAGPTLVVCPASLMGNWQREVERFAPGTPVRRFHGGSRSLEGLADGEFVLT
                     TYGTMRLDTARLAEVTWGMVVADEAQHVKNPHSATARQLRTIGARARVALTGTPVENN
                     LSELWAILDWTTPGLLGRLGTFRTRWASAVESGNDPAAAERLASLVRPFLLRRRKSDP
                     GIAPELPPKTETDRAVSLTAEQAGLYEAVVRETLDEISGADGFARRGLIVKLMTALKQ
                     ICNHPAQYLKEEQPRIADRSGKVELLDELLDTILSEGAGVLVFTQYVQMARLLERHLA
                     ARGVPTQFLHGGTPIAEREAMVDRFQAGRVPVFLLSLKAAGTGLNLTRAEHVVHVDRW
                     WNPAVEAQATDRAYRIGQTRPVQVHRLITEGTIEDRIAAMLARKQGLADAVLGGGEAA
                     LTELSDAELAELVELRGGAR"
     misc_feature    293979..294404
                     /locus_tag="Sfla_0244"
                     /note="SNF2 Helicase protein; Region: DUF3670; pfam12419"
                     /db_xref="CDD:257038"
     misc_feature    294549..295373
                     /locus_tag="Sfla_0244"
                     /note="SNF2 family N-terminal domain; Region: SNF2_N;
                     pfam00176"
                     /db_xref="CDD:249654"
     misc_feature    294609..294998
                     /locus_tag="Sfla_0244"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    294624..294638
                     /locus_tag="Sfla_0244"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    294903..294914
                     /locus_tag="Sfla_0244"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    <295401..>295763
                     /locus_tag="Sfla_0244"
                     /note="Superfamily II DNA and RNA helicases [DNA
                     replication, recombination, and repair / Transcription /
                     Translation, ribosomal structure and biogenesis]; Region:
                     SrmB; COG0513"
                     /db_xref="CDD:223587"
     misc_feature    295413..295778
                     /locus_tag="Sfla_0244"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(295491..295502,295560..295565,295641..295649)
                     /locus_tag="Sfla_0244"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(295665..295667,295728..295730,295740..295742,
                     295749..295751)
                     /locus_tag="Sfla_0244"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            295940..297229
                     /locus_tag="Sfla_0245"
                     /db_xref="GeneID:11369810"
     CDS             295940..297229
                     /locus_tag="Sfla_0245"
                     /inference="similar to AA sequence:KEGG:SGR_348"
                     /note="KEGG: sgr:SGR_348 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921230.1"
                     /db_xref="GI:357409494"
                     /db_xref="GeneID:11369810"
                     /translation="MNKGDEPERTFAALPPAQGRGFACSWWGRAWLKALEDTALDGQQ
                     LKRGRRLAREGRVGAVSVRPGRLTAVVQDHDATACRSDVLLQELSEEEWDRFLDMASE
                     RSGHIAALLDREMPPHLVEDAAAAGLHLLPGIGDLEPECGCGAWDHCPHSGALCYQVA
                     RLLDQDPFVLLLLRGRDERRLLDELQVRSAARAVRVPGAEAAEDQAGGPAPRGVRADE
                     AYAARDILPPLPSPPPLPTEPGLPPSLDTGTTPAAGVDASGLEYLAADSAVRAYAMLA
                     EAMAVGHERQPPAAGLTPEQDAVRLTADGRPDPRLTARLAAAAGRTPAGLDIAVRAWR
                     YGGTAALEVCDEEWRPGPAELARARAQLAAAWEDGEGPRLRGTDNRWTVIGSGAQLRY
                     GRDGRWWPFVKEHGRWTPAGPAEDDPAAALAGTPAGS"
     misc_feature    296006..>296572
                     /locus_tag="Sfla_0245"
                     /note="SWIM zinc finger; Region: SWIM; cl19527"
                     /db_xref="CDD:267880"
     gene            297321..297902
                     /locus_tag="Sfla_0246"
                     /db_xref="GeneID:11369811"
     CDS             297321..297902
                     /locus_tag="Sfla_0246"
                     /inference="protein motif:PFAM:PF01510"
                     /note="KEGG: sgr:SGR_349  N-acetylmuramoyl-L-alanine
                     amidase;
                     PFAM: N-acetylmuramoyl-L-alanine amidase 2;
                     SMART: N-acetylmuramoyl-L-alanine amidase 2"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="YP_004921231.1"
                     /db_xref="GI:357409495"
                     /db_xref="GO:0008745"
                     /db_xref="InterPro:IPR002502"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11369811"
                     /translation="MQRRRILQGAAVTAAAALLPASVRAVAAPTEGTDFPSAQWYPAS
                     TSNYTVSSRPSAYPVERVIIHVAQQTFTETIGIFQNPAKQVSAHYVVRSGDGFVGQCV
                     RERDIAWHAGNWDYNTRSIGIEHEGWVDQPSYFTHAMYERSARLTADICDRHGLTKDR
                     AHIIGHHEVPGSDHTDPGVNWDWVRYIRLVNLA"
     misc_feature    297492..297854
                     /locus_tag="Sfla_0246"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    order(297513..297515,297579..297581,297816..297818,
                     297840..297842,297846..297848)
                     /locus_tag="Sfla_0246"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(297513..297515,297816..297818,297846..297848)
                     /locus_tag="Sfla_0246"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(297516..297518,297579..297581,297624..297626,
                     297645..297650,297669..297671,297816..297818,
                     297828..297830,297840..297848)
                     /locus_tag="Sfla_0246"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     gene            complement(297911..299578)
                     /locus_tag="Sfla_0247"
                     /db_xref="GeneID:11369812"
     CDS             complement(297911..299578)
                     /locus_tag="Sfla_0247"
                     /inference="protein motif:TFAM:TIGR00711"
                     /note="KEGG: sgr:SGR_469 major facilitator superfamily
                     permease;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily;
                     PFAM: major facilitator superfamily MFS_1"
                     /codon_start=1
                     /transl_table=11
                     /product="EmrB/QacA subfamily drug resistance transporter"
                     /protein_id="YP_004921232.1"
                     /db_xref="GI:357409496"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11369812"
                     /translation="MTGSRAESAQVADSPERGHGKGIALLIIASCQLMVVLDITIVNI
                     ALPHIQSSLGFSTESLSWVINAYTLTFGGLLLLGGRLGDILGRRRVFVFGVLLFVLAS
                     LLGGLSQESWQLLAARALQGVGGAIASPTALSLITTTFREGPERNRAFGVFAAVSAGG
                     SAIGLLAGGVLVEWLDWRWVFFVNVPIGLLIAFATPRFIKESQRHPGHFDLLGALTST
                     LGMVLLVYGFIRASEDGWTDVLTIGAFAGAVVFMAVFLTVERRSRQPITPLHMFRDRN
                     RAGAYGMMLSLAAAMFGMFFFLTLFVQNILDFSPLRAGLAFLPVSVIIAISAGLASQL
                     LPRWGPKPFMVTGAILAAGGLAWLTQTDVNSTYLGSILGPILVFGSGMGMQFVSLTLM
                     AVSGVEPREAGAASGVLNATQQVGGSLGLSILVTVFGTASRNEAMDQIPRFLAEATPA
                     QQLRFRRTGELPAPWGDQVLASGVSTAFVVAAVIAGVAALIALFVIQVRSSDLERLRG
                     GGVPVPVDEPEDALDGAAGDRPGHGGTDGPRGPAVPPHNRGGSPPPG"
     misc_feature    complement(298283..299506)
                     /locus_tag="Sfla_0247"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(298319..299497)
                     /locus_tag="Sfla_0247"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(298328..298330,298337..298342,
                     298349..298354,298361..298366,298397..298399,
                     298406..298411,298421..298423,298430..298435,
                     298442..298444,298595..298597,298607..298609,
                     298616..298618,298628..298630,298640..298642,
                     298682..298684,298691..298696,298703..298708,
                     298715..298717,299096..299098,299114..299119,
                     299126..299131,299168..299170,299177..299182,
                     299189..299194,299201..299206,299342..299347,
                     299351..299356,299366..299368,299375..299380,
                     299387..299389,299438..299443,299447..299455,
                     299462..299464))
                     /locus_tag="Sfla_0247"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(299755..300429)
                     /locus_tag="Sfla_0248"
                     /db_xref="GeneID:11369813"
     CDS             complement(299755..300429)
                     /locus_tag="Sfla_0248"
                     /inference="protein motif:PFAM:PF03067"
                     /note="PFAM: chitin-binding domain 3 protein;
                     KEGG: sco:SCO0643  cellulose-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="chitin-binding protein"
                     /protein_id="YP_004921233.1"
                     /db_xref="GI:357409497"
                     /db_xref="InterPro:IPR004302"
                     /db_xref="GeneID:11369813"
                     /translation="MRKNCHERVSLVGWARRVGGVCVSVVLCLLPWTGTASAHGSVVD
                     PASRNYGCWLRWGDDFQNPAMEQEDPMCWQAWQADPNAMWNWNGLYRNGSGGDFPAAV
                     PDGQLCSGGRTESGRYDSLDSVGAWKTTDITDDFTVKLYDQASHGADYFQVYVTRQGF
                     DPAAEALTWSDLQLVAETGRYAPSQNYEIPVTTSGLSGRHVVYTIWQASHMDQTYFLC
                     SDVNFT"
     misc_feature    complement(299764..300315)
                     /locus_tag="Sfla_0248"
                     /note="Chitin binding domain; Region: Chitin_bind_3;
                     pfam03067"
                     /db_xref="CDD:251707"
     gene            complement(300543..300698)
                     /locus_tag="Sfla_0249"
                     /db_xref="GeneID:11369814"
     CDS             complement(300543..300698)
                     /locus_tag="Sfla_0249"
                     /inference="similar to AA sequence:KEGG:SAV_2357"
                     /note="KEGG: sma:SAV_2357 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921234.1"
                     /db_xref="GI:357409498"
                     /db_xref="GeneID:11369814"
                     /translation="MIIVGAILLILGLVTGLGVLWTIGIILLVVGLALWLLGAVGHAV
                     GGRRHYW"
     gene            complement(300816..301094)
                     /locus_tag="Sfla_0250"
                     /db_xref="GeneID:11369815"
     CDS             complement(300816..301094)
                     /locus_tag="Sfla_0250"
                     /inference="protein motif:PFAM:PF05121"
                     /note="PFAM: Gas vesicle K;
                     KEGG: sma:SAV_2347 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein K"
                     /protein_id="YP_004921235.1"
                     /db_xref="GI:357409499"
                     /db_xref="InterPro:IPR007805"
                     /db_xref="GeneID:11369815"
                     /translation="MTGSRLDVDSGELGRDLVALVLTVVELLRQLMERQAIRRIDQGD
                     LTDGQVEEIGTTLMMLDQRMAELCEQHGVRPEDLNLDLGPLGSLLPRE"
     misc_feature    complement(300822..301085)
                     /locus_tag="Sfla_0250"
                     /note="Gas vesicle protein K; Region: GvpK; pfam05121"
                     /db_xref="CDD:191196"
     gene            complement(301091..301318)
                     /locus_tag="Sfla_0251"
                     /db_xref="GeneID:11369816"
     CDS             complement(301091..301318)
                     /locus_tag="Sfla_0251"
                     /inference="protein motif:PFAM:PF00741"
                     /note="PFAM: gas vesicle protein GVPa;
                     KEGG: sma:SAV_2348 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein GvpA"
                     /protein_id="YP_004921236.1"
                     /db_xref="GI:357409500"
                     /db_xref="GO:0005198"
                     /db_xref="InterPro:IPR000638"
                     /db_xref="GeneID:11369816"
                     /translation="MEREVVPWDNPEPLRGPVGVPLVDLLDRVLATGVVVSGDLVIAI
                     ADVPLVRLSLHALLSSVNERVPAPWADGGPL"
     misc_feature    complement(301142..301258)
                     /locus_tag="Sfla_0251"
                     /note="Gas vesicle protein; Region: Gas_vesicle;
                     pfam00741"
                     /db_xref="CDD:144370"
     gene            complement(301318..302130)
                     /locus_tag="Sfla_0252"
                     /db_xref="GeneID:11369817"
     CDS             complement(301318..302130)
                     /locus_tag="Sfla_0252"
                     /inference="protein motif:PFAM:PF06386"
                     /note="PFAM: Gas vesicle synthesis GvpLGvpF;
                     KEGG: sma:SAV_2349 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle synthesis protein GvpLGvpF"
                     /protein_id="YP_004921237.1"
                     /db_xref="GI:357409501"
                     /db_xref="InterPro:IPR009430"
                     /db_xref="GeneID:11369817"
                     /translation="MTDRETEQVSAESVLYVFAVCRLPDPTAFAGLPGVAAGEALRRL
                     RFGELTAIVQTVRAADFTDEAWQARMADRGELERYARAHHDVVSAAAVSCPTVPLPMA
                     TLYHGEERAQQALLAETERFLAALRRTADHSEWGVKVYTAAPAVSVPARTRPATSPGS
                     SRPTPGAGLAYLERKRGAQAQRERRHEDSLRLAETVDAAFQGLAAAGRRLRLHVPETT
                     GTGHVQVLNATYLVAEHRAAELAPLTRALQESTGARIDVSGPWVPYSFVGEV"
     misc_feature    complement(301330..302100)
                     /locus_tag="Sfla_0252"
                     /note="Gas vesicle synthesis protein GvpL/GvpF; Region:
                     GvpL_GvpF; pfam06386"
                     /db_xref="CDD:253698"
     gene            complement(302150..302494)
                     /locus_tag="Sfla_0253"
                     /db_xref="GeneID:11369818"
     CDS             complement(302150..302494)
                     /locus_tag="Sfla_0253"
                     /inference="protein motif:PFAM:PF00741"
                     /note="PFAM: gas vesicle protein GVPa;
                     KEGG: sma:SAV_2350 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein GvpA"
                     /protein_id="YP_004921238.1"
                     /db_xref="GI:357409502"
                     /db_xref="GO:0005198"
                     /db_xref="InterPro:IPR000638"
                     /db_xref="InterPro:IPR018493"
                     /db_xref="GeneID:11369818"
                     /translation="MTDLDFGPEAYPIPGPPNSSLADILERVLDKGIVIAGDIKIDLL
                     DIELLTIRLRLFVASVDTAKKAGIDWWETDPALSSRAAQNSLLDENRALRERLDALEA
                     KTDEKEETSDHT"
     misc_feature    complement(302321..302437)
                     /locus_tag="Sfla_0253"
                     /note="Gas vesicle protein; Region: Gas_vesicle;
                     pfam00741"
                     /db_xref="CDD:144370"
     gene            complement(302491..303594)
                     /locus_tag="Sfla_0254"
                     /db_xref="GeneID:11369819"
     CDS             complement(302491..303594)
                     /locus_tag="Sfla_0254"
                     /inference="protein motif:PFAM:PF03364"
                     /note="PFAM: cyclase/dehydrase;
                     KEGG: sma:SAV_2351 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="YP_004921239.1"
                     /db_xref="GI:357409503"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="GeneID:11369819"
                     /translation="MARTDKDEPEASESGIDRLRGEFTNFLGAQTDKLAQKAGDKLTG
                     LTGQLTDIADNGGSLPSVASRVMQGESPVKAFVSEKAGNVKDKVVDKAKEAFGGGKGK
                     SQSGGGKSMNIIEVLDVGVPLRDAYDHWTRYDKFGSFTKGVQSVSMDEEMSSDWKVKI
                     GPSSRGFKATVQEQVPDDRIVWTSEGAKGSTRGCVSFHELAPSLTRIVLVIEYYPSGF
                     FEKTGNLWRVQGRRMRLDFKHFQRFVTLTDEEPEGWRGEIRDGEVVVTHEEAMEKEEA
                     ESEEPDESDDSEDEEYEDEAGPEDDEDEEEEEEDYEDEDEEEPDEDTEEDYEDEEDEE
                     EEPEEEEEEEPEEEGEEEEEDAPRKRRGRRASR"
     misc_feature    complement(302863..303261)
                     /locus_tag="Sfla_0254"
                     /note="Ligand-binding SRPBCC domain of an uncharacterized
                     subfamily of proteins; Region: SRPBCC_8; cd07817"
                     /db_xref="CDD:176859"
     misc_feature    complement(order(302875..302877,302884..302892,
                     302896..302904,302908..302922,302956..302958,
                     302962..302964,302968..302970,302974..302976,
                     303004..303006,303010..303012,303016..303021,
                     303049..303051,303055..303057,303073..303075,
                     303082..303084,303088..303090,303121..303123,
                     303127..303129,303133..303135,303139..303141,
                     303157..303159,303202..303207,303211..303219,
                     303244..303246,303250..303252,303256..303258))
                     /locus_tag="Sfla_0254"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176859"
     gene            complement(303601..304533)
                     /locus_tag="Sfla_0255"
                     /db_xref="GeneID:11369820"
     CDS             complement(303601..304533)
                     /locus_tag="Sfla_0255"
                     /inference="similar to AA sequence:KEGG:SAV_2352"
                     /note="KEGG: sma:SAV_2352 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921240.1"
                     /db_xref="GI:357409504"
                     /db_xref="GeneID:11369820"
                     /translation="MEDQTKVTLAAAVVGGYVLGRTKKGRLALSIATYLAGRRFGLEP
                     RQIAAEGVRRLSEMPQFAELQDQLKGEVLESGRKALTAAADRGMNSLADALSDRTSRL
                     GAPEEEEEEEDEGEYEDENEPEYEDEEGDEDEEEDEEPEEPEEEYEEEEPEEEEPEEE
                     EGEEEPEEEEPEEEEPEEEEPRRTKSSDGAAGRGAGRKPAKKQPPAKKAPAKKAPAKK
                     AAAEKPAAKKSAPPKKTAAKKSAPAKKTAAKKAPAKKAASASRKAAAKKAAPAKKTAA
                     KKAPAKKSSARKTTSAKKTTSSKRTASKRGERRR"
     gene            complement(304541..304795)
                     /locus_tag="Sfla_0256"
                     /db_xref="GeneID:11369821"
     CDS             complement(304541..304795)
                     /locus_tag="Sfla_0256"
                     /inference="similar to AA sequence:KEGG:SAV_2353"
                     /note="KEGG: sma:SAV_2353 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle synthesis protein"
                     /protein_id="YP_004921241.1"
                     /db_xref="GI:357409505"
                     /db_xref="GeneID:11369821"
                     /translation="MGLLSGLLLLPLAPVRGVIWVAEKAEEVADRELHDPSVIRAQLA
                     ELNQELEDGNVGLEEFEREEEELLDRLHAGTVRPSPNHRR"
     misc_feature    complement(<304631..304759)
                     /locus_tag="Sfla_0256"
                     /note="Gas vesicle protein G; Region: GvpG; pfam05120"
                     /db_xref="CDD:253022"
     gene            complement(304797..305546)
                     /locus_tag="Sfla_0257"
                     /db_xref="GeneID:11369822"
     CDS             complement(304797..305546)
                     /locus_tag="Sfla_0257"
                     /inference="protein motif:PFAM:PF06386"
                     /note="PFAM: Gas vesicle synthesis GvpLGvpF;
                     KEGG: sma:SAV_2354 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle synthesis protein GvpLGvpF"
                     /protein_id="YP_004921242.1"
                     /db_xref="GI:357409506"
                     /db_xref="InterPro:IPR009430"
                     /db_xref="GeneID:11369822"
                     /translation="MTGNGVYVYAIIPAGKALPAGAVGVGGPAAALRLVDEGRVTAVV
                     SAAPPQLRARRRDLMAHQEVLQRLTDTGPVLPMRFGTVAPDEESVRAQLAGSQAEHLA
                     TLSHLRGGVEFNLKALPAQDALAAVVAEEKNVRRLREAVRRRPGYEANVRLGEAVSAA
                     LSRRAAEAGRKILHELTPLARETAPGPEVHGCVLNVSFLVDRSRGDSFRTTVQRFADR
                     HRDHVELRVAGPLPCYSFVSSRPLRTPVAGG"
     misc_feature    complement(304824..305537)
                     /locus_tag="Sfla_0257"
                     /note="Gas vesicle synthesis protein GvpL/GvpF; Region:
                     GvpL_GvpF; pfam06386"
                     /db_xref="CDD:253698"
     gene            complement(305550..306002)
                     /locus_tag="Sfla_0258"
                     /db_xref="GeneID:11369823"
     CDS             complement(305550..306002)
                     /locus_tag="Sfla_0258"
                     /inference="protein motif:PFAM:PF00741"
                     /note="PFAM: gas vesicle protein GVPa;
                     KEGG: sma:SAV_2355 gas vesicle synthesis-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle protein GvpA"
                     /protein_id="YP_004921243.1"
                     /db_xref="GI:357409507"
                     /db_xref="GO:0005198"
                     /db_xref="InterPro:IPR000638"
                     /db_xref="InterPro:IPR018493"
                     /db_xref="GeneID:11369823"
                     /translation="MTTTMYADEVAPCPPRAGTLYDVLELILDRGMVIDVFVRVSLVG
                     IEILKIDARIVVASVDTYLRFAEACNRLDLERDSGSTTIPELLGGRAAKSIGKRKVRQ
                     AAESVGDTVRKAVGSGDDDDEDDDRNERPKKRRAPARDGSSRRRRVEA"
     misc_feature    complement(305562..305996)
                     /locus_tag="Sfla_0258"
                     /note="gas vesicle synthesis-like protein; Reviewed;
                     Region: PRK09368"
                     /db_xref="CDD:236485"
     gene            complement(306034..306378)
                     /locus_tag="Sfla_0259"
                     /db_xref="GeneID:11369824"
     CDS             complement(306034..306378)
                     /locus_tag="Sfla_0259"
                     /inference="protein motif:PFAM:PF05800"
                     /note="PFAM: Gas vesicle synthesis family protein;
                     KEGG: sma:SAV_2356 gas vesicle synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="gas vesicle synthesis family protein"
                     /protein_id="YP_004921244.1"
                     /db_xref="GI:357409508"
                     /db_xref="InterPro:IPR008634"
                     /db_xref="GeneID:11369824"
                     /translation="MAENRPARSGQTAKRAAKKTAKRAAPRSSARRGPEDAAHAACES
                     LERLICHAAEGVSAVRRKDDGWCVVVDVLEVPRIPDTTSLLASYEVQIDERGELMEYS
                     RVRRYRRGSADE"
     misc_feature    complement(306037..306303)
                     /locus_tag="Sfla_0259"
                     /note="Gas vesicle synthesis protein GvpO; Region: GvpO;
                     pfam05800"
                     /db_xref="CDD:147774"
     gene            306500..306934
                     /locus_tag="Sfla_0260"
                     /db_xref="GeneID:11369825"
     CDS             306500..306934
                     /locus_tag="Sfla_0260"
                     /inference="similar to AA sequence:KEGG:SAV_1016"
                     /note="KEGG: sma:SAV_1016 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921245.1"
                     /db_xref="GI:357409509"
                     /db_xref="GeneID:11369825"
                     /translation="MSESGEPDEEHVRPPGTGDTTVEALGALSEALEKVERARGQLYG
                     FHQLMGGADLTLDRAVELLRMGGHPEHADLVEREIVGRNVVPGCWTFQLVEAYDDTYY
                     RPFVEVEERVRQELVGGRRHLYEAQMKEVRRTRGHPQHTARP"
     gene            306937..307959
                     /locus_tag="Sfla_0261"
                     /db_xref="GeneID:11369826"
     CDS             306937..307959
                     /locus_tag="Sfla_0261"
                     /inference="protein motif:PFAM:PF02811"
                     /note="KEGG: sma:SAV_7440 hypothetical protein;
                     PFAM: PHP domain protein;
                     SMART: phosphoesterase PHP domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="YP_004921246.1"
                     /db_xref="GI:357409510"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR003141"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR017078"
                     /db_xref="GeneID:11369826"
                     /translation="MDPADALRRIAFLLERSQAATYRVKAFRTAADAIGSMDGAEIAD
                     RVTRGSLESVRGIGPKTAKVIREAVEGATPSYLEALEEEASTPLTAGGESLLAALRGD
                     CHLHSDWSDGGSPIADMGRTAKELGHEWAVLTDHSPRLTVANGLSTERLLDQLAVVAE
                     LNERWAPFRLLTGIECDILDDGSLDQDPDVLERLDVVVVSVHSKLRMDATAMTARMLA
                     AVRNPHADILGHCTGRLLGGKKRPQSLFDAERVFAACAEAGTAVEINCRPERLDPPRG
                     LLRQAVASGALLSIDTDAHAPGQLDWQIYGCARAEECGVPVDRVVTSWTMERLLEWTG
                     GKAARS"
     misc_feature    306937..307944
                     /locus_tag="Sfla_0261"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07945"
                     /db_xref="CDD:236135"
     misc_feature    306946..307146
                     /locus_tag="Sfla_0261"
                     /note="Helix-hairpin-helix domain; Region: HHH_8;
                     pfam14716"
                     /db_xref="CDD:258853"
     misc_feature    307222..307932
                     /locus_tag="Sfla_0261"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     bacterial polymerase X; Region: PHP_PolX; cd07436"
                     /db_xref="CDD:213991"
     misc_feature    order(307246..307248,307252..307254,307267..307269,
                     307342..307344,307459..307461,307540..307542,
                     307624..307626,307813..307815,307819..307821)
                     /locus_tag="Sfla_0261"
                     /note="active site"
                     /db_xref="CDD:213991"
     gene            308048..309010
                     /locus_tag="Sfla_0262"
                     /db_xref="GeneID:11369827"
     CDS             308048..309010
                     /locus_tag="Sfla_0262"
                     /inference="similar to AA sequence:KEGG:SCO0759"
                     /note="KEGG: sco:SCO0759 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921247.1"
                     /db_xref="GI:357409511"
                     /db_xref="GeneID:11369827"
                     /translation="MTRHRTGPPLPRARGELSAGVIAFLRDDGALPDRGAARDADPYG
                     DDLQLALYVCYELHYRGFAGVRPELEWDPPLLTVRGALEDRFLTALRHDVPATDELDG
                     VLEGLLVEPIRGSGVSWFLQDRGELRHLREYAIQRSLYHLKEADPHAWVLPRLSGRAK
                     AGMAAIEYDEFGAGRADRVHAGLFAGLMSDLGLDTAYGRYLDQGCAPMLALVNVMSLF
                     GLHRRLRGALVGHFAAVEITSSPGSRRLAHAMKRNGAGPAAEFFYTEHVEADAVHEQV
                     VRRDVIGGLLDEEPAMATDIAFGITATSYLEERLGDRMLADWKV"
     misc_feature    308534..308851
                     /locus_tag="Sfla_0262"
                     /note="Iron-containing redox enzyme; Region:
                     Haem_oxygenas_2; pfam14518"
                     /db_xref="CDD:258658"
     gene            309063..309746
                     /locus_tag="Sfla_0263"
                     /db_xref="GeneID:11369828"
     CDS             309063..309746
                     /locus_tag="Sfla_0263"
                     /inference="protein motif:TFAM:TIGR00537"
                     /note="KEGG: sma:SAV_7194 methyltransferas;
                     TIGRFAM: methylase;
                     PFAM: methyltransferase small"
                     /codon_start=1
                     /transl_table=11
                     /product="methylase"
                     /protein_id="YP_004921248.1"
                     /db_xref="GI:357409512"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004557"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="GeneID:11369828"
                     /translation="MSADLAQAPRALPLMTLPGVYAPQHDTRLLMAALNREGISPGTE
                     VLDVGTGSGALALHAARLGARVTAVDIARRAVATARLNALLHRRRITVQRSDLLSALP
                     GRSYDLVICNPPYVPSPLDRIPGHGAARAWDAGCDGRAILDRMCETAPAALRPGGRLL
                     LVHSGLCDSDITVRRLSDAGLRARVSDRALVPLGPVLRSRLRWLRDTGLVGAGDTAEE
                     LVVIRAEQL"
     misc_feature    309195..309548
                     /locus_tag="Sfla_0263"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(309204..309224,309270..309275,309345..309353,
                     309396..309398)
                     /locus_tag="Sfla_0263"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            309730..309957
                     /locus_tag="Sfla_0264"
                     /db_xref="GeneID:11369829"
     CDS             309730..309957
                     /locus_tag="Sfla_0264"
                     /inference="protein motif:PFAM:PF09360"
                     /note="PFAM: Iron sulphur-containing domain, CDGSH-type;
                     KEGG: sma:SAV_7195 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CDGSH-type iron sulfur domain-containing
                     protein"
                     /protein_id="YP_004921249.1"
                     /db_xref="GI:357409513"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR006622"
                     /db_xref="InterPro:IPR018967"
                     /db_xref="GeneID:11369829"
                     /translation="MPNSSEHPCRITIGDDGPLLVEGPVEVTCADGTVAVSDRFVVAL
                     CMCRRSRMYPWCDTSHRRRTQPGEKSRRDTG"
     misc_feature    309826..309918
                     /locus_tag="Sfla_0264"
                     /note="Iron-binding zinc finger CDGSH type; Region:
                     zf-CDGSH; cl02748"
                     /db_xref="CDD:261429"
     gene            complement(309964..311283)
                     /locus_tag="Sfla_0265"
                     /db_xref="GeneID:11369830"
     CDS             complement(309964..311283)
                     /locus_tag="Sfla_0265"
                     /inference="similar to AA sequence:KEGG:SCAB_9271"
                     /note="KEGG: scb:SCAB_9271  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921250.1"
                     /db_xref="GI:357409514"
                     /db_xref="GeneID:11369830"
                     /translation="MAARVRPYGVRAGPRAVPVPRTGHRLGMPAVVTPEPVVKLVQRT
                     TEPAAAQTLRSTAAAVIAFAVAQSVLPEPHPAPLTAPLTALLVVQVTLYATLTTGIRR
                     VNAVVVGVLIASGFSSLVGLSWWTLGLTIFTSLLIGRVVRVNEFVPEVAISAMLVLGV
                     AQVADTAWERVLETLVGAGVGLLFNLLLAPPVWVESAGVSIGGLGERMGKMFRALGEE
                     IGGNHPVREAAARLHEARRLDHDIVEVDASLRQAEESLMLNPRVKEGLLNRVVLRTGL
                     DTLEICAVVLRVLTRTLTDLAKARTEEALFPEDVATDLRELFGHMSDAIEGFALMITT
                     PMAQSGEEAEERLAEALVRSRRTRDHVADLLLEDVQEHPRQWQLHGALLAEVDRILDE
                     LDIDKRTERLAEELDRRSAEAHDRHPRLRAISRRLRGAAQARRREGG"
     misc_feature    complement(310732..311067)
                     /locus_tag="Sfla_0265"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            311331..311513
                     /locus_tag="Sfla_0266"
                     /db_xref="GeneID:11369831"
     CDS             311331..311513
                     /locus_tag="Sfla_0266"
                     /inference="similar to AA sequence:KEGG:SGR_485"
                     /note="KEGG: sgr:SGR_485 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921251.1"
                     /db_xref="GI:357409515"
                     /db_xref="GeneID:11369831"
                     /translation="MAISLTPPGETPPAEGCISEAHVERPDGGIWEHPAFWAGLVLLG
                     SVVFAGFFIARIFGFA"
     gene            311510..312124
                     /locus_tag="Sfla_0267"
                     /db_xref="GeneID:11369832"
     CDS             311510..312124
                     /locus_tag="Sfla_0267"
                     /inference="similar to AA sequence:KEGG:SCO6964"
                     /note="KEGG: sco:SCO6964 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921252.1"
                     /db_xref="GI:357409516"
                     /db_xref="GeneID:11369832"
                     /translation="MSGRRTLDALLERHGTTYAAEAGIRLRDTPQPLYQLLVLSDLLS
                     ARIRAGIAVAAARALFSRGLRTPRRMADATWQERVDALGEGGYRRYDERTATQLGDGA
                     LLLLDAFGGDLRRLRREAGGDVHALRSGLRRFPGIGPTGADIFLREVQTVWPETAPYL
                     DKKALQGAERLGLPGTPAALTRLARDEDPAVLAAALVRGALDKG"
     gene            complement(312131..312880)
                     /locus_tag="Sfla_0268"
                     /db_xref="GeneID:11369833"
     CDS             complement(312131..312880)
                     /locus_tag="Sfla_0268"
                     /inference="similar to AA sequence:KEGG:SGR_491"
                     /note="KEGG: sgr:SGR_491 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921253.1"
                     /db_xref="GI:357409517"
                     /db_xref="GeneID:11369833"
                     /translation="MSFPHPGRQSGAAHHEYCNNALCCRCQQRQWTTKLGDERLCGPC
                     AACCRDCGRAPAPHVDGLDDGLCAECRGRCGRCHSALPAEGPCPCRKWRERAAGDPVA
                     YILQALPQPLVQALGHRHPRTVHDLIHRELTRRTPDQLLERLERRWNVRWSHALHEKD
                     EDGRRRWAPQEIAEALVSPGNCGDPQCEDGYLLTTDTPCGRCLRPTHRFVTSVADRTA
                     TSDHARATAAQIRRALVEGRSTKPGKRRPTS"
     gene            complement(313038..313232)
                     /locus_tag="Sfla_0269"
                     /db_xref="GeneID:11369834"
     CDS             complement(313038..313232)
                     /locus_tag="Sfla_0269"
                     /inference="similar to AA sequence:KEGG:SGR_492"
                     /note="KEGG: sgr:SGR_492 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921254.1"
                     /db_xref="GI:357409518"
                     /db_xref="GeneID:11369834"
                     /translation="MAISISVVLLLLVLAAIFLRNGGLKISHAIVCALLGFLLAGTSM
                     APTIHEGITATADVVSGLRP"
     gene            complement(313371..314261)
                     /locus_tag="Sfla_0270"
                     /db_xref="GeneID:11369835"
     CDS             complement(313371..314261)
                     /locus_tag="Sfla_0270"
                     /inference="similar to AA sequence:KEGG:SGR_493"
                     /note="KEGG: sgr:SGR_493 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921255.1"
                     /db_xref="GI:357409519"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11369835"
                     /translation="MAHLTRRRVVTTALATAAAGAFVPAQAAAAAPAGTVRPRGPHPL
                     ARAHAHNDYLHPRPLHDALAHGFTSVEADIFLVDGELLVAHEPGSLDPARTLVSLYLD
                     PLLARVRANHGSVHAGHRDPLQLLIDIKTEGAATYLALDQVLRRYRKILTRCDRGRVR
                     PGAVTPVISGDRAARAPMEAQTTRYAFYDGRPEDLGGAAHASFIPLISGNWTTNFGWP
                     GTGPFPAAERTRLRAFVSAAHANGQRVRFWATPDIAGPERDAVWNELLAADVDHLNTD
                     DLGGLESFLRRREDGGRRSV"
     misc_feature    complement(313431..314126)
                     /locus_tag="Sfla_0270"
                     /note="Uncharacterized hypothetical proteins similar to
                     the catalytic domains of Phosphoinositide-specific
                     phospholipaseand Glycerophosphodiester phosphodiesterases;
                     Region: PI-PLCc_GDPD_SF_unchar3; cd08577"
                     /db_xref="CDD:176519"
     misc_feature    complement(order(313518..313520,313749..313751,
                     313878..313880,314043..314045,314049..314051,
                     314112..314114))
                     /locus_tag="Sfla_0270"
                     /note="putative active site [active]"
                     /db_xref="CDD:176519"
     misc_feature    complement(order(314007..314009,314112..314114))
                     /locus_tag="Sfla_0270"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176519"
     gene            complement(314473..315594)
                     /locus_tag="Sfla_0271"
                     /db_xref="GeneID:11369836"
     CDS             complement(314473..315594)
                     /locus_tag="Sfla_0271"
                     /inference="protein motif:PFAM:PF02771"
                     /note="PFAM: acyl-CoA dehydrogenase domain-containing
                     protein;
                     KEGG: sgr:SGR_500  acyl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004921256.1"
                     /db_xref="GI:357409520"
                     /db_xref="GO:0003995"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="GeneID:11369836"
                     /translation="MTVQTEAVQAPDLLYSEAEEDLRSAVRSLLADRADAPTVIAGIE
                     SDTPYDLRLWESLAAGIGAAGLLVPEKLGGQGATHREAAVVLEELGRSVAPAPYLTSA
                     VVATEILLALGADGGPAAGLLAELASGRKVAVLALPFSTPPADAGAAMTGTLERTVSG
                     VAEAAAADVLLVPTADGLYAVETAGDGVDVRALVPLDLTRPLATVTLAGATGTLLADA
                     APAAEAVSRGLLAGAGLLASEQLGLAEWCLTETVRHTRERHQFNRPVGSFQSLKHRMA
                     QLWLEVVSARAAARNAADALAAGSPDAPLAVAVAQAYCSEVAVHAAEECVQLHGGIGM
                     TWEHPAHLYLKRAKADSIAYGTAGRHREAVAALVELPAP"
     misc_feature    complement(314476..315564)
                     /locus_tag="Sfla_0271"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(315262..315549)
                     /locus_tag="Sfla_0271"
                     /note="Acyl-CoA dehydrogenase, N-terminal domain; Region:
                     Acyl-CoA_dh_N; pfam02771"
                     /db_xref="CDD:251519"
     misc_feature    complement(314500..>314874)
                     /locus_tag="Sfla_0271"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(314521..314523,314527..314529,
                     314533..314541))
                     /locus_tag="Sfla_0271"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(315591..316781)
                     /locus_tag="Sfla_0272"
                     /db_xref="GeneID:11369837"
     CDS             complement(315591..316781)
                     /locus_tag="Sfla_0272"
                     /inference="protein motif:PFAM:PF02771"
                     /note="PFAM: acyl-CoA dehydrogenase domain-containing
                     protein;
                     KEGG: sgr:SGR_501  acyl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_004921257.1"
                     /db_xref="GI:357409521"
                     /db_xref="GO:0003995"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="GeneID:11369837"
                     /translation="MSTAVDAAGIRRFTQQLLADRPPATTDRTDFLEARFDAGLAWVH
                     YPVGLGGLDAPRSLQPVVDAELAAAGAPDNDPRRIGIGLGMAAPTILGYGTEEQKRRF
                     LRPLWTGAEVWCQLFSEPGAGSDLAALGTRAVRDGDDWVVDGQKVWTSSAHLARWGIL
                     IARTDPDVPKHRGISYFICDMTDPGVEVRPLRQITGEAEFNEVFLTGVRIPDSRRLGP
                     VGDGWNVAQTTLMNERVSIGGARIPREGGMIGTVAKTWREQPGLRTHDLHQRLLTLWV
                     EAEVARLTGERLRQQLVAGQPGPEGSGMKLAFARLNQEISGLEVELLGDEGLLYSDWT
                     MRRPELVDFTGRDAGYRYLRSKGNSIEGGTSEVLLNIVAERVLGLPVEPRNDKDVAWK
                     DLAR"
     misc_feature    complement(315642..316760)
                     /locus_tag="Sfla_0272"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(315648..316760)
                     /locus_tag="Sfla_0272"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(315684..315686,315690..315692,
                     315696..315704,316332..316334,316338..316340,
                     316431..316433,316437..316439,316527..316529))
                     /locus_tag="Sfla_0272"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(316778..317746)
                     /locus_tag="Sfla_0273"
                     /db_xref="GeneID:11369838"
     CDS             complement(316778..317746)
                     /locus_tag="Sfla_0273"
                     /inference="protein motif:PFAM:PF00107"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: sgr:SGR_502  oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_004921258.1"
                     /db_xref="GI:357409522"
                     /db_xref="GO:0008270"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:11369838"
                     /translation="MQAWRVHRNGEPSEVMELEQADRPTPGEGQVLIAVRAANINFPD
                     ALLCRGQYQVRPPLPFTPGVEICGETADGRRVLATPALPHGGFAEYVVADEAALLPAP
                     EALDDAQAAALHIGYQTGWFGLHRRARLQAGETLLVHAAAGGVGSAAVQLGKAAGATV
                     IGVVGGPEKAAVARELGCDLVIDRHGEDIVAAVKEATGGRGADVVYDPVGGEAYAKSV
                     KCIAFEGRVVVVGFASGAIPTPGLNHALVKNYSIVGLHWGLYNTKDPAAVRACHDELT
                     ALAAKGVVKPLISERVPMADAARAVQRVADGTSTGRIVVLPSGGTR"
     misc_feature    complement(316796..317746)
                     /locus_tag="Sfla_0273"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    complement(316802..317746)
                     /locus_tag="Sfla_0273"
                     /note="Quinone oxidoreductase (QOR); Region: QOR1;
                     cd08241"
                     /db_xref="CDD:176203"
     misc_feature    complement(order(316814..316816,316820..316822,
                     316826..316828,316976..316984,317045..317050,
                     317054..317059,317123..317125,317195..317197,
                     317240..317242,317252..317257,317312..317320,
                     317327..317329,317390..317392,317402..317404,
                     317621..317626))
                     /locus_tag="Sfla_0273"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176203"
     gene            complement(317850..318458)
                     /locus_tag="Sfla_0274"
                     /db_xref="GeneID:11369839"
     CDS             complement(317850..318458)
                     /locus_tag="Sfla_0274"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: sgr:SGR_503  transcriptional regulator;
                     PFAM: helix-turn-helix domain protein; Cupin 2 conserved
                     barrel domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921259.1"
                     /db_xref="GI:357409523"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:11369839"
                     /translation="MDCMKEQNQDDPGLDAVLTGVGPRLRRLRKDRGVTLAALSEATG
                     ISVSTLSRLESGGRRPSLELLLPIARAHEVPLDDLVGAPPVSDPRVRAKPIVHGSRTS
                     LPLTSRPGGLQAYKVVQKAPCTEVPEQRTHEGYEWLYVLSGRLRLKLAEHDLVLGPGE
                     AAEFDTRLPHWFGPVGDEPVEFLSLFGPQGERMHVRAKPKRS"
     misc_feature    complement(317895..318395)
                     /locus_tag="Sfla_0274"
                     /note="DNA-binding transcriptional repressor PuuR;
                     Provisional; Region: PRK09943"
                     /db_xref="CDD:182158"
     misc_feature    complement(318222..318395)
                     /locus_tag="Sfla_0274"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(318294..318296,318369..318371,
                     318381..318383))
                     /locus_tag="Sfla_0274"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(318297..318299,318372..318374))
                     /locus_tag="Sfla_0274"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(318291..318296,318306..318308,
                     318315..318317,318348..318353))
                     /locus_tag="Sfla_0274"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(317901..318098)
                     /locus_tag="Sfla_0274"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            complement(318557..319279)
                     /locus_tag="Sfla_0275"
                     /db_xref="GeneID:11369840"
     CDS             complement(318557..319279)
                     /locus_tag="Sfla_0275"
                     /inference="protein motif:PFAM:PF02585"
                     /note="KEGG: sco:SCO0804 hypothetical protein;
                     manually curated;
                     PFAM: LmbE family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_004921260.1"
                     /db_xref="GI:357409524"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:11369840"
                     /translation="MTRQLEPMPTDWRRALAVVAHPDDLEYGCAAAVAGWTDEGREVA
                     YLLVTRGEAGIDTIAPSACAPLREREQRASAEAVGVSSVEFLDHRDGVIEYGTALRRD
                     IAAAVRRHRPELLITLNHRDTWGAVAWNTPDHRAVGRATLDAAGDAGNRWIFSELGLE
                     PWDGVRWVAVAGTDRPTHAVDATPGFERSVRSLLAHRTYIEVLTDEDPEAYCRTFLAG
                     TTGAAAERFGGRPAVAFEVFPR"
     misc_feature    complement(318563..319249)
                     /locus_tag="Sfla_0275"
                     /note="Uncharacterized proteins, LmbE homologs [Function
                     unknown]; Region: COG2120"
                     /db_xref="CDD:225031"
     gene            319488..320060
                     /locus_tag="Sfla_0276"
                     /db_xref="GeneID:11369841"
     CDS             319488..320060
                     /locus_tag="Sfla_0276"
                     /inference="protein motif:PFAM:PF00581"
                     /note="KEGG: sgr:SGR_505 hypothetical protein;
                     PFAM: Rhodanese domain protein;
                     SMART: Rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese domain-containing protein"
                     /protein_id="YP_004921261.1"
                     /db_xref="GI:357409525"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:11369841"
                     /translation="MISPASLSPFEAAARLEEFTVIDVRAPGEYASGHVPGALNIPLD
                     RLPEAVPALKSASARGSLLMVCASGVRSTRACEILADADIDAATLAGGTSAWEGDGNG
                     LERPAGARATWPMERQVRFAAGSLVVAGLVAGRRLPAARWLSAGIGAGLVYSAVTNTC
                     GMAAALARLPHNRAPHQAAGLDATLDALQG"
     misc_feature    319518..319778
                     /locus_tag="Sfla_0276"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    319683..319685
                     /locus_tag="Sfla_0276"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    319827..319985
                     /locus_tag="Sfla_0276"
                     /note="Protein of unknown function (DUF2892); Region:
                     DUF2892; pfam11127"
                     /db_xref="CDD:256306"
     gene            complement(320064..321365)
                     /locus_tag="Sfla_0277"
                     /db_xref="GeneID:11369842"
     CDS             complement(320064..321365)
                     /locus_tag="Sfla_0277"
                     /inference="protein motif:PRIAM:3.4.11.5"
                     /note="KEGG: sgr:SGR_506  prolyl aminopeptidase;
                     PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl aminopeptidase"
                     /protein_id="YP_004921262.1"
                     /db_xref="GI:357409526"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR002410"
                     /db_xref="GeneID:11369842"
                     /translation="MNSYRQPGIVLTDRRFTVPLDHDDPGGETIEIFGREAVAAGRPS
                     EGLPWLVYLEGGPGFGARRFVGAEAWLGRAVREFRVLLLDQRGTGLSTPANRQTLPKR
                     GGPREQADYLAHFRSDSIVRDCELIRPRLTGGAPWTVLGQSFGGFCAVHYLSAAPEGL
                     EAVLITGGLPSLDAHADEVYRAAYPRIERKVAAHYARYPQDVARARAVAAYLAEHRPD
                     SAGHTLTPEGFQSLGIMLGSGSGSHQLHYLLENAFVEGPHGAELSDTFQEAMRTSTSF
                     AGHPLYALMHEVIYGQGAMPTDWSAERVRAEFPQFDVNAALAGDGPVLFTGESIHPWH
                     FAVDPALRPLRETAELLAARTDWPVLYDAERLAANEVPVAAAVYHDDMYVDTGHALRT
                     ASAIRGLRTWVTSEYEHDGVRAGGPHVLDRLLALVRGEADR"
     misc_feature    complement(<320865..321245)
                     /locus_tag="Sfla_0277"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            321569..322393
                     /locus_tag="Sfla_0278"
                     /db_xref="GeneID:11369843"
     CDS             321569..322393
                     /locus_tag="Sfla_0278"
                     /inference="protein motif:PRIAM:1.1.1.283"
                     /note="KEGG: sgr:SGR_508  oxidoreductase;
                     PFAM: aldo/keto reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="methylglyoxal reductase"
                     /protein_id="YP_004921263.1"
                     /db_xref="GI:357409527"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="GeneID:11369843"
                     /translation="MSTVPTVTLNNGVTIPQLGFGVFQVPDDETTAAVTAALEAGYRS
                     IDTAAVYGNETGVGRALAESGLGREELFVTTKLWNADQGYDATLTAFDASLAKLGLDH
                     VDLYLIHWPTPARDLYTDTWRALEKLLAEGRIRAAGVSNFQPAHLRRLREESSLVPAV
                     NQIELHPGLQQRELRSLHAGSGIATEAWSPLAQGALLDDEVLTSLAGRHGRSPAQVVL
                     RWHLQLGNVVIPKSVTPARIRQNIDVFDFELSADDMEAIAGLDRGMRTGPDPDTLN"
     misc_feature    321584..322348
                     /locus_tag="Sfla_0278"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(321629..321637,321704..321706,321719..321721,
                     321794..321796,321893..321898,321986..321991,
                     322052..322054,322130..322147,322208..322210,
                     322253..322264,322277..322279,322286..322291)
                     /locus_tag="Sfla_0278"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(321704..321706,321719..321721,321794..321796,
                     321893..321895)
                     /locus_tag="Sfla_0278"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(322479..322754)
                     /locus_tag="Sfla_0279"
                     /db_xref="GeneID:11369844"
     CDS             complement(322479..322754)
                     /locus_tag="Sfla_0279"
                     /inference="protein motif:PFAM:PF09860"
                     /note="PFAM: Protein of unknown function DUF2087;
                     KEGG: sgr:SGR_509 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921264.1"
                     /db_xref="GI:357409528"
                     /db_xref="InterPro:IPR018656"
                     /db_xref="GeneID:11369844"
                     /translation="MSDSELRGSRQVAALFSGGRLTAIPRKPARREQLLTHLAQTLFE
                     RDRVYTEREVNDALLTVHDDCSALRRYLVVAGLLERPRDGSSYRRGR"
     misc_feature    complement(322488..322700)
                     /locus_tag="Sfla_0279"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2087); Region: DUF2087; pfam09860"
                     /db_xref="CDD:255610"
     gene            322885..323859
                     /locus_tag="Sfla_0280"
                     /db_xref="GeneID:11369845"
     CDS             322885..323859
                     /locus_tag="Sfla_0280"
                     /inference="protein motif:PRIAM:3.1.1.41"
                     /note="KEGG: sma:SAV_1302 acetyl xylan esterase;
                     PFAM: Acetyl xylan esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="cephalosporin-C deacetylase"
                     /protein_id="YP_004921265.1"
                     /db_xref="GI:357409529"
                     /db_xref="InterPro:IPR008391"
                     /db_xref="GeneID:11369845"
                     /translation="MALFDLPLDELHAYRSRSVEPEDFDAFWSATLDEARTHDLDARF
                     ELCADLGLTTVDVYDVTFAGFGGHPVKGWFVIPAGTTEPLPVLVEFIGYGGGRSLPHA
                     HLLWASAGMAHFVMDTRGQGSGWAPGDTADPVGSGPSLAGFMTQGIEDPATYYFRRVI
                     TDAVRAVEAARSHPLADASRTAAIGASQGGGLALAVGGLVTDLAALAPDVPFLCDFPR
                     ATRVTDRKPYREIIDYLKTHRGRAEKAFRTLSYFDGVHFAARGSAPALFSVALEDQTC
                     PPSSVFAAYNAYAHADKEIEVYEYNDHEGGGPFQHAAQLTRLPRLLKA"
     misc_feature    322885..323847
                     /locus_tag="Sfla_0280"
                     /note="Acetyl xylan esterase (AXE1); Region: AXE1;
                     pfam05448"
                     /db_xref="CDD:253201"
     gene            323883..325130
                     /locus_tag="Sfla_0281"
                     /db_xref="GeneID:11369846"
     CDS             323883..325130
                     /locus_tag="Sfla_0281"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein; Oxidoreductase
                     domain;
                     KEGG: sma:SAV_7022 oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain-containing protein"
                     /protein_id="YP_004921266.1"
                     /db_xref="GI:357409530"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="GeneID:11369846"
                     /translation="MTHLAAEPRFPVEKALAVQWAHLSPSEEVFVTTSNPSRRKPVRV
                     AIVGTGAIARGSHLPALTALAAGQPLEIIAAVDVDAASVEAFCAEAGIAHAYTDLDRM
                     LAEQRPDLVTLATPPRFHRDQTVAALRAGAWVWCEKPPCPSLEDFDAIEAAEGPSGQG
                     PYAAIVFQHRFGSGARHVRALLAGHAMGRPLVAHCQTTWYRDEAYYAVPWRGTWSSEG
                     GGPSMGHGIHQMDLLLDLLGPWAEIRAMAGRLVHDVETEDVSTALIRFENGAMATVVN
                     SVLSPDEVSRIRIDCERATVELTHLYGHRNTDWRITPAPGVTSEEADAWRDFGADVPS
                     SHEAQLTGLLGDLRAGRRPRSSGPDGRKSLELVAALYKAAFTGSTVRAGEIGPGDPFY
                     GALHGDVPDWAPRNVDRAEGVVA"
     misc_feature    324000..325034
                     /locus_tag="Sfla_0281"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    324006..324344
                     /locus_tag="Sfla_0281"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    324417..324752
                     /locus_tag="Sfla_0281"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            325127..326056
                     /locus_tag="Sfla_0282"
                     /db_xref="GeneID:11369847"
     CDS             325127..326056
                     /locus_tag="Sfla_0282"
                     /inference="similar to AA sequence:KEGG:SCAB_77621"
                     /note="KEGG: scb:SCAB_77621 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921267.1"
                     /db_xref="GI:357409531"
                     /db_xref="GeneID:11369847"
                     /translation="MTRTAELVHRHGDHLSVTAAGSGVELLRYVYRAEDAWEAPKPYI
                     HPLRTLSGRVVTGYRPNDHRWHKGLQMTASHLSGANLWGGNSYVDGEGYLALPERVGS
                     MAHAGFDDVSVHDGGVRFTERLTWHPHDGGLWAQETRRVEVHDVDEVTGSWALTWSSE
                     ITNRRDEPLRFGSPTTHGRPNAGYTGLFWRGPRAFRDGRIISPEAEGPDLMGQQAPWL
                     AYSGEHDESDGHATLVFVHSPGNDHTGAGGAHPAHWFVRNTPFAAVAPSFAFHEELVL
                     DPGATLARRYRVLVADGAWDRDRIASAVGRLSW"
     misc_feature    325163..326035
                     /locus_tag="Sfla_0282"
                     /note="Methane oxygenase PmoA; Region: PmoA; pfam14100"
                     /db_xref="CDD:258320"
     gene            complement(326182..326625)
                     /locus_tag="Sfla_0283"
                     /db_xref="GeneID:11369848"
     CDS             complement(326182..326625)
                     /locus_tag="Sfla_0283"
                     /inference="similar to AA sequence:KEGG:Ndas_1126"
                     /note="KEGG: nda:Ndas_1126 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921268.1"
                     /db_xref="GI:357409532"
                     /db_xref="InterPro:IPR004378"
                     /db_xref="GeneID:11369848"
                     /translation="MPMEGEYEPSPTTWVREQVELIESSGGTQGTTMRGMPVILLTTR
                     GAKSGKLRKTPLMRVEHDGQYAVVASLGGAPKHPVWYYNVLADPEVELRDGTVRQDMT
                     AREITGEEKALWWSRAVEAFPDYAEYQTKTDREIPVFVLSPSGER"
     misc_feature    complement(326197..326586)
                     /locus_tag="Sfla_0283"
                     /note="Domain of unknown function (DUF385); Region:
                     DUF385; pfam04075"
                     /db_xref="CDD:112871"
     gene            326959..328320
                     /locus_tag="Sfla_0284"
                     /db_xref="GeneID:11369849"
     CDS             326959..328320
                     /locus_tag="Sfla_0284"
                     /inference="protein motif:PFAM:PF07992"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: sgr:SGR_479  ferredoxin/ferredoxin-NADP reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004921269.1"
                     /db_xref="GI:357409533"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:11369849"
                     /translation="MTRPVRVAIVGAGPAGIYAADALLKSEAAQEPGVSIDLFERMPA
                     PFGLIRYGVAPDHPRIKGIVKALHQVLDKPQLRLFGNVDYPNDIGLDDLRSFYDAVIF
                     STGADADRALDIPGIELDGSYGAAEFVAWYDGHPEVPRTWPLEAEKVAVLGVGNVALD
                     VARILAKTADELLPTEIPANVYDGLKANKALEVHVFGRRGPAQAKFSPMELRELDHSP
                     NIEVIVNPEDIDYDEGSIATRRENKQANMVASTLENWAIRDVGDRPHKLFLHFFESPV
                     EVVGEDGRVVALRTERTELDGTGNVKGTGRHTDWDVQSVYRAVGYYSEELPKLPFDVV
                     SGTVPHAAGRVLTGDEPMPSVYVTGWIKRGPIGLIGHTKGDANETVACLLEDHAAGRL
                     PAPAQPDTDAVVDFLEQRGVRYTTKEGWHRLDAHEQALGAEQGRERVKVVERAAMLDA
                     SGA"
     misc_feature    326962..328317
                     /locus_tag="Sfla_0284"
                     /note="ferredoxin-NADP+ reductase; Region: PLN02852"
                     /db_xref="CDD:215457"
     misc_feature    326980..327474
                     /locus_tag="Sfla_0284"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            328496..328870
                     /locus_tag="Sfla_0285"
                     /db_xref="GeneID:11369850"
     CDS             328496..328870
                     /locus_tag="Sfla_0285"
                     /inference="protein motif:PFAM:PF03551"
                     /note="PFAM: transcriptional regulator PadR family
                     protein;
                     KEGG: sco:SCO2859 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PadR-like family transcriptional regulator"
                     /protein_id="YP_004921270.1"
                     /db_xref="GI:357409534"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="GeneID:11369850"
                     /translation="MEPGDSTKQARAAAQLRKGVLEYCVLALMRDRPRYGVELLQALE
                     DSGALATSQGTVYPLLSRLRRDDLVTTTWQESASGPPRRYYALTDSGRAALDEFTRVW
                     PGFRDAVDTFLSPPPPSTGDHA"
     misc_feature    328568..328777
                     /locus_tag="Sfla_0285"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(328598..328600,328607..328609,328769..328771)
                     /locus_tag="Sfla_0285"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(328598..328606,328649..328660,328664..328669,
                     328676..328681,328685..328690,328706..328714,
                     328742..328750)
                     /locus_tag="Sfla_0285"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            328867..329460
                     /locus_tag="Sfla_0286"
                     /db_xref="GeneID:11369851"
     CDS             328867..329460
                     /locus_tag="Sfla_0286"
                     /inference="similar to AA sequence:KEGG:SGR_427"
                     /note="KEGG: sgr:SGR_427 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921271.1"
                     /db_xref="GI:357409535"
                     /db_xref="GeneID:11369851"
                     /translation="MKTPADPVRDYLRAVEREASALPADRRQELVADLAEHVEVTRAE
                     RPDATPGEILAELGDPRTIAATALAEAGRAPGIPAEGGAGDPARRGKVHPLVPLLMLT
                     LSLPFVMVFSDSPGPLFGLLFRIAGVVLLCTSVHWTTVRKTTGVLLAGVVPTVVIASW
                     NLSSGGPAGDTPALVGNLGMLALLTGTAVWLWRSRRA"
     misc_feature    328894..>329391
                     /locus_tag="Sfla_0286"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4709"
                     /db_xref="CDD:227053"
     gene            complement(329544..330437)
                     /locus_tag="Sfla_0287"
                     /db_xref="GeneID:11369852"
     CDS             complement(329544..330437)
                     /locus_tag="Sfla_0287"
                     /inference="similar to AA sequence:KEGG:SACE_7270"
                     /note="KEGG: sen:SACE_7270 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921272.1"
                     /db_xref="GI:357409536"
                     /db_xref="GeneID:11369852"
                     /translation="MPSPDRADRGRQNPEDGREVAVPPDRGPGESRSDVFLDVPALHV
                     DELNLEVDDLEAHVSLQAEVLDLLKLNVGADVRLGRVELDIEGVDVQAQLRVRLHNIA
                     AIVTRLLSTVDRNPQILEQLTRGVGEAVENVGAGAGTAVERLGEGTSTAVSDVGRGAG
                     EAVESVAADAGTAVKGIGEGAGEAVEDVGRSGARAVEGADDAVGEITGDVVGSTRDDE
                     GPGAAKKTESGRKPRARGAPASKDDASAKKSRAKKAPARKAAADAGAAAKPAAKKAAG
                     VARRSGGKVTGGAAGRRRRPA"
     misc_feature    complement(329787..>330056)
                     /locus_tag="Sfla_0287"
                     /note="Prophage tail length tape measure protein; Region:
                     TMP_2; pfam06791"
                     /db_xref="CDD:253913"
     gene            330610..331230
                     /locus_tag="Sfla_0288"
                     /db_xref="GeneID:11369853"
     CDS             330610..331230
                     /locus_tag="Sfla_0288"
                     /inference="protein motif:TFAM:TIGR00057"
                     /note="KEGG: sgr:SGR_302 hypothetical protein;
                     TIGRFAM: Sua5/YciO/YrdC/YwlC family protein;
                     PFAM: SUA5/yciO/yrdC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC/YwlC family protein"
                     /protein_id="YP_004921273.1"
                     /db_xref="GI:357409537"
                     /db_xref="InterPro:IPR004388"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="GeneID:11369853"
                     /translation="MAKYFDVHPENPQRRTITNVAESIRSGALVAYPTDSCYALGCQL
                     GSRDGIDRIRSIRNLDDRHHFTLVCQNFAQLGQFVQVDNDVFRAIKAATPGSYTFILP
                     ATKEVPRQLLHPKKKTVGVRIPDHVVTQALLTELGEPLLSSTLLLPDEEEPLTQGWEI
                     KERLEHVVDVVLDSGDCGTEPTTVIDFSGGELEVVRRGAGDVSRFE"
     misc_feature    330610..331224
                     /locus_tag="Sfla_0288"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     cl00305"
                     /db_xref="CDD:260340"
     gene            331276..331533
                     /locus_tag="Sfla_0289"
                     /db_xref="GeneID:11369854"
     CDS             331276..331533
                     /locus_tag="Sfla_0289"
                     /inference="similar to AA sequence:KEGG:SCO4218"
                     /note="KEGG: sco:SCO4218 small hydrophilic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921274.1"
                     /db_xref="GI:357409538"
                     /db_xref="GeneID:11369854"
                     /translation="MRAPLGAWFGGGVRSAQWQGVIMSESEDVRARLRRMRGQAEDLE
                     KAAEQASDPSERRRLQDEAHRLESQSVQVSGMASGDIYPME"
     misc_feature    331366..>331440
                     /locus_tag="Sfla_0289"
                     /note="Transcriptional regulators CsoR (copper-sensitive
                     operon repressor), RcnR, and FrmR, and related domains;
                     this domain superfamily was previously known as DUF156;
                     Region: CsoR-like_DUF156; cl00846"
                     /db_xref="CDD:260655"
     gene            331722..332108
                     /locus_tag="Sfla_0290"
                     /db_xref="GeneID:11369855"
     CDS             331722..332108
                     /locus_tag="Sfla_0290"
                     /inference="similar to AA sequence:KEGG:SAV_460"
                     /note="KEGG: sma:SAV_460 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921275.1"
                     /db_xref="GI:357409539"
                     /db_xref="GeneID:11369855"
                     /translation="MRWRPFLEAVQERGDYPSVAEAERASRVVLALLGAHLVGEERNE
                     LAARLPETFALILLNPLQAAEPLSSERFVRAVSAWIEGATERTAAWDTGAVLSVVADA
                     SGEELLERLLLQLPPGYDLLFGHPGG"
     misc_feature    331725..332090
                     /locus_tag="Sfla_0290"
                     /note="Uncharacterized conserved protein (DUF2267);
                     Region: DUF2267; pfam10025"
                     /db_xref="CDD:255704"
     gene            complement(332111..333110)
                     /locus_tag="Sfla_0291"
                     /pseudo
                     /db_xref="GeneID:11369856"
     gene            complement(333195..333590)
                     /locus_tag="Sfla_0292"
                     /db_xref="GeneID:11369857"
     CDS             complement(333195..333590)
                     /locus_tag="Sfla_0292"
                     /inference="protein motif:PFAM:PF01022"
                     /note="KEGG: sgr:SGR_7010 ArsR family transcriptional
                     regulator;
                     PFAM: regulatory protein ArsR;
                     SMART: regulatory protein ArsR"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_004921276.1"
                     /db_xref="GI:357409540"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:11369857"
                     /translation="MAAMGHGRDEQTSATTRERLDAVGAAGVAATLQALATPSRLRIL
                     ARLQEGPCAVGDLAEAVEMEPSACSHQLRLLRNLGLVAGERQGRSIVYALYDHHVAEL
                     LDQALYHVEHLRLGLRDAPAEIAATATGH"
     misc_feature    complement(333270..333497)
                     /locus_tag="Sfla_0292"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(333270..333278,333282..333290,
                     333294..333299,333354..333356,333444..333446,
                     333453..333458,333465..333470,333477..333479,
                     333486..333488,333492..333497))
                     /locus_tag="Sfla_0292"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(333315..333323,333336..333344,
                     333360..333365,333369..333374,333381..333386,
                     333390..333401,333426..333434,333471..333479,
                     333489..333494))
                     /locus_tag="Sfla_0292"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(333297..333299,333423..333425,
                     333432..333434))
                     /locus_tag="Sfla_0292"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            333679..335694
                     /locus_tag="Sfla_0293"
                     /db_xref="GeneID:11369858"
     CDS             333679..335694
                     /locus_tag="Sfla_0293"
                     /inference="protein motif:TFAM:TIGR01512"
                     /note="KEGG: sgr:SGR_7009  cation-transporting P-type
                     ATPase;
                     TIGRFAM: cadmium-translocating P-type ATPase; ATPase,
                     P-type (transporting), HAD superfamily, subfamily IC;
                     heavy metal translocating P-type ATPase;
                     PFAM: E1-E2 ATPase-associated domain protein; Haloacid
                     dehalogenase domain protein hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="cadmium-translocating P-type ATPase"
                     /protein_id="YP_004921277.1"
                     /db_xref="GI:357409541"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0046872"
                     /db_xref="GO:0046873"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR001366"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006404"
                     /db_xref="InterPro:IPR006416"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="GeneID:11369858"
                     /translation="MPAAVIPPPTRLASPGRGEAPRRRTRVLALAEARWAAAALALFL
                     LALPLHLTGAPGWAWGPLYALVYVAGGWEPALSGLRELREKVLDVDLLMIVAALGAAS
                     IGQVMDGALLIVIFATSGALEALATARTQDAVRGLLDLAPATASRLTADGSEESVATG
                     ELTVGDVIRIRPGERVGADGRVLDGASEVDQATITGEPLPTAKEPGDEVFAGTLNGTG
                     TLRVAVERDASESVIARIVAMTEEAARTKAPTQLFIEKVEQRYSLGMVVATLAVFLVP
                     LAFGDDVTGSLLRAMTFMIVASPCAVVLATMPPLLSAMANAGRHGVLVKSAVVMERLG
                     QADAVALDKTGTLTEGTPRVTRVHPLAGSGLTGDALLALAAAAEHPSEHPLARAVVKA
                     AQERGLRLSPVSEFDSAPGTGVTATVDGRVISVGSPVRLLRDVAASASADATASAAVL
                     EEAGSTAVLVLRDGEPVGVLGVADRMRHDAAATVAAMAGLTDVPPMLLTGDHARAAAR
                     LAAEAGITDVRAGLLPQDKAAAVREQEQAGRRVLVVGDGVNDAPALAAAHVGVAMGRA
                     GSDLAVEAADAVVIRDELAAVPTVVALSRATRRLVVQNLVVAGVFISVLVVWDLVGHL
                     PLPLGVLGHEGSTVIVGLNGLRLLRETAWRRAAEQGRGVKSVRRRRD"
     misc_feature    333943..335619
                     /locus_tag="Sfla_0293"
                     /note="heavy metal translocating P-type ATPase; Region:
                     ATPase-IB_hvy; TIGR01525"
                     /db_xref="CDD:233447"
     misc_feature    334009..334674
                     /locus_tag="Sfla_0293"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    <335230..335415
                     /locus_tag="Sfla_0293"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            complement(335666..336880)
                     /locus_tag="Sfla_0294"
                     /db_xref="GeneID:11369859"
     CDS             complement(335666..336880)
                     /locus_tag="Sfla_0294"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: sgr:SGR_4338 major facilitator superfamily permease"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004921278.1"
                     /db_xref="GI:357409542"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:11369859"
                     /translation="MRRNSSIVLLSLGHACVDVHQGAAAALVPFFAAERAYTYAVASG
                     VVLAASLLSSVVQPVFGALTDRWPMPWLLPAATLLSGAGIGVSGLSGSYALTLVCVAV
                     SGLGVAAYHPESARVARIAARGSHRAMGWFSTGGNIGFALAPLMVGTVVGAGGLHRTP
                     LLALPALAGAAMCLPVVHALRRERAGGSHTAPPTGNDDVPSFLKLSLAVVFRSIAFVG
                     LSTFISLYARQRLGGSAAAGTAALSVFYLGGAVGSVLGGSLASRWDRVRVSRCSYVLT
                     AVAVTGVVWVPGPAIHVFVALASVGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTVS
                     IGGLAAPALGALADATSLRTALAPLALMPLLSWLLFRALPEPAAPKASAPPPAAGDGG
                     GAAVSPAAGERS"
     misc_feature    complement(335900..336862)
                     /locus_tag="Sfla_0294"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(335906..335911,335942..335944,
                     335951..335956,335966..335971,335978..335980,
                     336122..336124,336134..336136,336143..336145,
                     336155..336157,336167..336169,336209..336211,
                     336218..336223,336230..336235,336242..336244,
                     336461..336463,336479..336484,336491..336496,
                     336524..336526,336533..336538,336545..336550,
                     336557..336562,336698..336703,336707..336712,
                     336722..336724,336731..336736,336743..336745,
                     336794..336799,336803..336811,336818..336820))
                     /locus_tag="Sfla_0294"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(335900..336814)
                     /locus_tag="Sfla_0294"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            336887..337678
                     /locus_tag="Sfla_0295"
                     /db_xref="GeneID:11369860"
     CDS             336887..337678
                     /locus_tag="Sfla_0295"
                     /inference="protein motif:PFAM:PF00165"
                     /note="KEGG: sma:SAV_653 AraC family transcription
                     regulator;
                     PFAM: helix-turn-helix- domain containing protein AraC
                     type;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004921279.1"
                     /db_xref="GI:357409543"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11369860"
                     /translation="MFGVRHRVALSINCHLMTEIRHDPVAPTRTQWLASGAAIDAHRH
                     DDHQIVYAGRGVLSVTTSEGSWVAPGTRAIWVPAGTVHAHRAYGELDLHLVGLAATEN
                     PLGLGAPTVLAVGPLLRELIIAYTRTEDDAGPERARLRAVLLDQLRASPQQPLHLPTP
                     ATPLLRAVYDILIADPGDSRTLSELGREVGASDRTLSRLFRSDLGMTFPQWRTQLRLH
                     HALILLTGRTPVTTVAHRCGWSSASAFIDAFRRAFGHTPGCRPAE"
     misc_feature    <336983..337171
                     /locus_tag="Sfla_0295"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    337316..337660
                     /locus_tag="Sfla_0295"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    337400..337525
                     /locus_tag="Sfla_0295"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(337731..338621)
                     /locus_tag="Sfla_0296"
                     /db_xref="GeneID:11369861"
     CDS             complement(337731..338621)
                     /locus_tag="Sfla_0296"
                     /inference="similar to AA sequence:KEGG:SGR_6883"
                     /note="KEGG: sgr:SGR_6883 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921280.1"
                     /db_xref="GI:357409544"
                     /db_xref="GeneID:11369861"
                     /translation="MAGRALSLPSSRRRAVAGAAAFLASVLGAGLLAGCAGDAAASGG
                     DEPTRATRTADVLLPTPGAGFDYQIGGGYTPPEGVRALSRDREDDPAPGRYNVCYVNA
                     FQTQPGALKWWQDTHPDLLLRDGDGEMIIDEGWDEVLLDTSTAARRTQLEKIVGEWID
                     GCAESGFQAVEPDNLDSFERSKGRLTQDHNAAFAQALAERAHGDGLAIGQKNTTDLLD
                     RHEEIGFDFAVAEECAQFDECDAYADAYDGRVFVIEYEGEGEVGFDESCDRWGDRISL
                     VLRDLDVLPAGEKGYVFRTC"
     misc_feature    complement(338280..338465)
                     /locus_tag="Sfla_0296"
                     /note="Glycoside-hydrolase family GH114; Region:
                     Glyco_hydro_114; pfam03537"
                     /db_xref="CDD:252016"
     misc_feature    complement(<337935..338213)
                     /locus_tag="Sfla_0296"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy_3; cl17304"
                     /db_xref="CDD:266616"
     gene            complement(338711..339634)
                     /locus_tag="Sfla_0297"
                     /db_xref="GeneID:11369862"
     CDS             complement(338711..339634)
                     /locus_tag="Sfla_0297"
                     /inference="protein motif:PFAM:PF00294"
                     /note="PFAM: PfkB domain protein;
                     KEGG: sma:SAV_1511 sugar kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain-containing protein"
                     /protein_id="YP_004921281.1"
                     /db_xref="GI:357409545"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:11369862"
                     /translation="MHQQTDVLVVGGAGVDTVVHVPELPLPHADSYMIRPGIETRAGQ
                     SGDFVALGLHALGLRTHHLDMIGDDHEGDLVRALHRDRGIPLTEAHQASGTKRAVNLV
                     APDGRRLSLYDASRGDDAGRFDETAVRRLAAATRHAHVVITQPCALTLPVLREAGVTI
                     STDLHDWDGVDGYHETFALQADIVFLSTTALTDPERTMRDIAGRGRARIVVATAGADG
                     SYLLHDDELTHTPAATPPAPVVDSNGAGDAFASGFLLGVLSGEHPLRCALHGTVAGAY
                     ACTVPSTGTAAIGREELLARVAELEKERAAG"
     misc_feature    complement(338786..339619)
                     /locus_tag="Sfla_0297"
                     /note="Adenosine kinase (AK) catalyzes the phosphorylation
                     of ribofuranosyl-containing nucleoside analogues at the
                     5'-hydroxyl using ATP or GTP as the phosphate donor.The
                     physiological function of AK is associated with the
                     regulation of extracellular...; Region: adenosine_kinase;
                     cd01168"
                     /db_xref="CDD:238573"
     misc_feature    complement(order(338894..338896,338903..338908,
                     339131..339133,339233..339235,339296..339298,
                     339302..339304,339308..339310,339341..339343,
                     339491..339493,339500..339508,339536..339538,
                     339587..339589,339593..339595,339599..339601))
                     /locus_tag="Sfla_0297"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238573"
     misc_feature    complement(order(338801..338803,338813..338815,
                     338888..338890,338897..338902,338909..338911,
                     338918..338920,338939..338941,338945..338947,
                     338978..338980,338987..338992,338996..338998))
                     /locus_tag="Sfla_0297"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238573"
     gene            complement(339876..340634)
                     /locus_tag="Sfla_0298"
                     /db_xref="GeneID:11369863"
     CDS             complement(339876..340634)
                     /locus_tag="Sfla_0298"
                     /inference="protein motif:PFAM:PF09339"
                     /note="KEGG: art:Arth_4369 IclR family transcriptional
                     regulator;
                     PFAM: regulatory protein IclR; Transcriptional regulator
                     IclR;
                     SMART: regulatory protein IclR"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004921282.1"
                     /db_xref="GI:357409546"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR014757"
                     /db_xref="GeneID:11369863"
                     /translation="MADPKNYIIESLDTGLRLMRLFLTHDTLSVTDAARELDVARSTA
                     HRVLSTLESRGFATRDASGRGYSAGPELVTLGRPAGYGPEIRTRLQIVLDAAAAATGE
                     TVSTAALIGDQVIITDGRESAHPVRAVLETGRAHPAHATSAGKVLLAQLTTEQVCALY
                     PEERLPDVSGTTPTSRSDLLSSLAAVRTLGRADSTGESVRGMNTVAVPLAGTSWRDRL
                     ALMASMPADRGDESRRGRHALALQAAAGLLPPPS"
     misc_feature    complement(340353..340610)
                     /locus_tag="Sfla_0298"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(339927..340604)
                     /locus_tag="Sfla_0298"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(339936..340262)
                     /locus_tag="Sfla_0298"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            340995..342092
                     /locus_tag="Sfla_0299"
                     /db_xref="GeneID:11369864"
     CDS             340995..342092
                     /locus_tag="Sfla_0299"
                     /inference="protein motif:PFAM:PF00756"
                     /note="PFAM: esterase;
                     KEGG: sco:SCO0490 esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="YP_004921283.1"
                     /db_xref="GI:357409547"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="GeneID:11369864"
                     /translation="MRSVTEQAAFAARFGLSGTPGSDAFWATAGSPASVAADGGGWTT
                     LFLWRGSPASVSFESWSESVPLHRWEDTDCWYAEVPMPPRLRVTYQFLADSGEYGDPF
                     NPEGAGGDRSVFATPDAPRQPHWPAFGADDVLPVPSTRIRWASGVLGGRRTVRVHPVG
                     GGGPVVLLLDGDDWLYLHPAMTAFESAVEAGDMPPVTLVFLPSKDRAAEFGCGRELWQ
                     AVRDELLPLVAESGVHADPDRLVVAGQSLGGLSAMYAALEFPELVSRVACQSPSFWWT
                     PDALDRADLLDGPVGGSIAGRLRERPDLSGLRVAFDVGEHETRILPHCALVESLTEQA
                     GASVRVSRSASGHDRAGWRHALLRDVAWALT"
     misc_feature    341013..342086
                     /locus_tag="Sfla_0299"
                     /note="enterobactin/ferric enterobactin esterase;
                     Provisional; Region: PRK10439"
                     /db_xref="CDD:236695"
     misc_feature    341130..341369
                     /locus_tag="Sfla_0299"
                     /note="Domain of unknown function (DUF3327); Region:
                     DUF3327; pfam11806"
                     /db_xref="CDD:256636"
     misc_feature    341424..>341840
                     /locus_tag="Sfla_0299"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2819;
                     cl19187"
                     /db_xref="CDD:267540"
     gene            342409..342735
                     /locus_tag="Sfla_0300"
                     /db_xref="GeneID:11369865"
     CDS             342409..342735
                     /locus_tag="Sfla_0300"
                     /inference="similar to AA sequence:KEGG:SCP1.130"
                     /note="KEGG: sco:SCP1.130 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921284.1"
                     /db_xref="GI:357409548"
                     /db_xref="GeneID:11369865"
                     /translation="MTAGLVAFVRARFNEELEKARFAGNVVGSRPERFGVGPEEAAEH
                     ARFSVAAAEARIVLLDDTVVPYLGTAGPGGRNAEFQLRLLAAPYVEHRDYPHDDGSAR
                     RPGSPA"
     misc_feature    <342451..342576
                     /locus_tag="Sfla_0300"
                     /note="Syntaxin 6, N-terminal; Region: Syntaxin-6_N;
                     pfam09177"
                     /db_xref="CDD:255217"
     gene            342732..343154
                     /locus_tag="Sfla_0301"
                     /db_xref="GeneID:11369866"
     CDS             342732..343154
                     /locus_tag="Sfla_0301"
                     /inference="similar to AA sequence:KEGG:Krad_1688"
                     /note="KEGG: kra:Krad_1688 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921285.1"
                     /db_xref="GI:357409549"
                     /db_xref="GeneID:11369866"
                     /translation="MTAALVAFVRARLDEREAAAVAAGGAGEGWQAWGTGIYATSSPD
                     DDVPPLVTTGPEVGGSDEDAARAAHIALHDPPQVLRDVEAIRSLLEQYTAPEAGEGLP
                     DGLDQRTAGTRRPAVETAVRHLAQAHARHPDYRPEWRP"
     gene            343289..343816
                     /locus_tag="Sfla_0302"
                     /db_xref="GeneID:11369867"
     CDS             343289..343816
                     /locus_tag="Sfla_0302"
                     /inference="similar to AA sequence:KEGG:SAV_7202"
                     /note="KEGG: sma:SAV_7202 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921286.1"
                     /db_xref="GI:357409550"
                     /db_xref="GeneID:11369867"
                     /translation="MTETTPGWLTEDELGMARARMPVLYVEAVPVRVDETGDVTGIGL
                     LLRIGTDGTISRALVSGRVLHHERVRDALLRHLEKDLGSVALPRVPASLQPFTVAEYF
                     PTTGVTPFHDPRQHAVSLAYVVPVAGDCRPRQDALDLVWFSPQEAASPAVQNEMPGGH
                     GALLKQALAHMGHIY"
     misc_feature    <343469..343732
                     /locus_tag="Sfla_0302"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    order(343469..343477,343505..343531)
                     /locus_tag="Sfla_0302"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(343993..344283)
                     /locus_tag="Sfla_0303"
                     /db_xref="GeneID:11369868"
     CDS             complement(343993..344283)
                     /locus_tag="Sfla_0303"
                     /inference="similar to AA sequence:KEGG:SCAB_16441"
                     /note="KEGG: scb:SCAB_16441 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921287.1"
                     /db_xref="GI:357409551"
                     /db_xref="GeneID:11369868"
                     /translation="MRQQVLILFLANSALDAEVIGWSSYDGTGRTRPTTGDGDEPPYG
                     TGLDALLDGWRLIQASQLIPPHPGHEYDTSFLKHEFIFEKLHEEKGAAVTDA"
     gene            complement(344280..345080)
                     /locus_tag="Sfla_0304"
                     /db_xref="GeneID:11369869"
     CDS             complement(344280..345080)
                     /locus_tag="Sfla_0304"
                     /inference="similar to AA sequence:KEGG:SCAB_16451"
                     /note="KEGG: scb:SCAB_16451 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921288.1"
                     /db_xref="GI:357409552"
                     /db_xref="GeneID:11369869"
                     /translation="MLTSVQVARFVASGSLRLDAVVPPGMNEQAVAVLDAGIPPVPYG
                     TPLAEAFAPGSFAQRLTSLPAVAGAIRSLVGPGPTVDHHAVHVREPHQGSAQPLHGDA
                     IIDVRPDAFDIQLMYYPHEVTTDMGGTLSVPGSHLRRTNETDTGRYQNLRGQTRLVCP
                     AGTVVLLHHGIWHGGRRNDSDTPRYMFKIRLNPTVPQVRLWNTDDLGDPRVGDELRTV
                     FDWYEPAAGRLEVHNRVLLWRALTGDDTFDVDHWVTRVNNRPALGSNA"
     misc_feature    complement(344394..>344804)
                     /locus_tag="Sfla_0304"
                     /note="Phytanoyl-CoA dioxygenase (PhyH); Region: PhyH;
                     cl17312"
                     /db_xref="CDD:266621"
     gene            345169..345963
                     /locus_tag="Sfla_0305"
                     /db_xref="GeneID:11369870"
     CDS             345169..345963
                     /locus_tag="Sfla_0305"
                     /inference="protein motif:PFAM:PF00165"
                     /note="KEGG: kfl:Kfla_6214 transcriptional regulator, AraC
                     family;
                     PFAM: helix-turn-helix- domain containing protein AraC
                     type;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004921289.1"
                     /db_xref="GI:357409553"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11369870"
                     /translation="MDQVSLSLAEPPVVVNIGVGVHGVSGPRDVFRLPGLWQLHLYDW
                     TGHLTVGGSRHAIGPGRVSLVPPGTEAAFDYRGRSEHLYAHLRVADAGERRLVPVVQD
                     AGTEAPLISGLLKRALAAMPGAPAQATAEMWTALWRVAGLAGRERPGGAHGAVAAAMA
                     HIEAHLAAPLTVPEIARRSGVSHSHLTRLFRSETGSTVAAYIRARRLEHAGHLLREST
                     MSVQAIACSVGISDLQAFNKACHRELGGSPRAIRGRLLPGDAAGPG"
     misc_feature    345652..345777
                     /locus_tag="Sfla_0305"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    345673..345924
                     /locus_tag="Sfla_0305"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            complement(346006..347691)
                     /locus_tag="Sfla_0306"
                     /db_xref="GeneID:11369871"
     CDS             complement(346006..347691)
                     /locus_tag="Sfla_0306"
                     /inference="protein motif:PFAM:PF00664"
                     /note="PFAM: ABC transporter transmembrane region; ABC
                     transporter related;
                     KEGG: sgr:SGR_6717  ABC transporter ATPase and permease
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004921290.1"
                     /db_xref="GI:357409554"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:11369871"
                     /translation="MQRGRPGAGILRTALRRNSGAVARGTVLMGLYQAGETAFPIALG
                     LIVEHTMQDRSLGSLGLSIAALAVIITTVSLSWRFGMRVLQKANTTEAHRWRVKVAAC
                     GLQPVARDVDLKSGEVLTIATEDADQTADIVEVVPLLISSLVAVVVAAVALGMADLRL
                     GLLVIVGTVAILSVLSAMSRRIGSSTREQQARVARAGAKVADLITGLRPLHGFGGNHA
                     AFLSYRKVSTEAKHQAITVARVNGVYAGTALALNAVLAAAVTLTAGWLAYGGRITIGE
                     LVMAVGLAQFIMEPLKMFSEMPKYVMMARASADRMALVLAAPPSASPGRDRPAAGGDL
                     EVDGVHHGALHGLRFTVHAGEFVAVAAYQPRAGADLAALLGANVPPQAYEGVVRVSGR
                     EIKDLSVEALREHLLVNPYDGEIFEGSLRTNIDPSGTSGLVPEAVEASLLTDVVALHR
                     EGLDHAVRDRGANLSGGQRQRLSLARSLAADSDVLVLHDPTTAVDAVTEQLIARNIAK
                     LRKGRTTLVITSSPALLDAADRVLVLDDGAVTAEDTHRRLLATDEDYCRAVAR"
     misc_feature    complement(346021..347631)
                     /locus_tag="Sfla_0306"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    complement(346819..347592)
                     /locus_tag="Sfla_0306"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(346069..346698)
                     /locus_tag="Sfla_0306"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(order(346588..346599,346609..346611))
                     /locus_tag="Sfla_0306"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(346132..346134,346225..346230,
                     346459..346461,346585..346587,346588..346593))
                     /locus_tag="Sfla_0306"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(346459..346470)
                     /locus_tag="Sfla_0306"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(346273..346302)
                     /locus_tag="Sfla_0306"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(346225..346242)
                     /locus_tag="Sfla_0306"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(346207..346218)
                     /locus_tag="Sfla_0306"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(346126..346146)
                     /locus_tag="Sfla_0306"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(347693..358596)
                     /note="potential frameshift: common BLAST hit:
                     gi|21219030|ref|NP_624809.1| peptide synthetase"
     gene            complement(347693..349378)
                     /locus_tag="Sfla_0307"
                     /db_xref="GeneID:11369872"
     CDS             complement(347693..349378)
                     /locus_tag="Sfla_0307"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: sgr:SGR_6716  NRPS;
                     TIGRFAM: amino acid adenylation domain protein;
                     PFAM: AMP-dependent synthetase and ligase;
                     phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921291.1"
                     /db_xref="GI:357409555"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="GeneID:11369872"
                     /translation="MTFAQLRDRSRAVAGVLVGRGIGPETTVGLALPRSLDSIVALFA
                     VLRTGAAYVPLELDHPDERIAAIVDAARPDVILTVSSVSPRLSGDLIELDRPLPETEP
                     YVTFAPDSPDRLRHPAYTIYTSGSTGKPKGVVTEYAGLTNMLINHQRRIFEPVLAEHG
                     HRTFRVAHTVSFAFDMSWEELLWLADGHEVHICDEELRRDAPRLVEYCAEHGIDVINV
                     TPTYAQQLVAEGLLDDPARRPALVLLGGEAVTPTLWRRLAETEGTVGYNLYGPTEYTI
                     NTLGVGTFECQDPVVGVAIDNTDVYVLDPWLRPLPDGVPGELYVSGIGIARGYLGQPA
                     QTADRFVACPFGEPGGRMYRTGDLVSRRPDGNLVYLGRTDQQVKIRGHRVELGEVEAA
                     FAAHPAVRFVAAVAQPDPQVDGSHRLAAYLVLSGSDLAAVAAEAGGGLPDFLRPTHYA
                     QVDSIPLTVNGKADTKALPEARPLGVLTTVDERGPRTGTEEVVCEFFAEALDLDDDEV
                     SAVSDFVALGGHSMLAVRLIGLLRREYGPVVTIRDLLTLRTPEAIARHLDDNS"
     misc_feature    complement(347975..349378)
                     /locus_tag="Sfla_0307"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(348164..349375)
                     /locus_tag="Sfla_0307"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(348986..348991,348995..349012,
                     349019..349021))
                     /locus_tag="Sfla_0307"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(347993..347995,348263..348265,
                     348272..348274,348308..348310,348506..348508,
                     348563..348580,348638..348643,349007..349012))
                     /locus_tag="Sfla_0307"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(347708..347908)
                     /locus_tag="Sfla_0307"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(349375..358596)
                     /locus_tag="Sfla_0308"
                     /db_xref="GeneID:11369873"
     CDS             complement(349375..358596)
                     /locus_tag="Sfla_0308"
                     /inference="protein motif:TFAM:TIGR01733"
                     /note="KEGG: sco:SCO0492 peptide synthetase;
                     TIGRFAM: amino acid adenylation domain protein;
                     non-ribosomal peptide synthase;
                     PFAM: AMP-dependent synthetase and ligase;
                     phosphopantetheine-binding; condensation domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation protein"
                     /protein_id="YP_004921292.1"
                     /db_xref="GI:357409556"
                     /db_xref="GO:0016874"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010060"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11369873"
                     /translation="MTDPTARTVLLSAAGLDDVRRRTGDHSDRTITEACAIGLSYWAT
                     GTSPDGIDLTPSTLFADVLRWVGEGGTAPAGWEVGADGRSIRASADVMPPDAQLALDD
                     LTDFPDRPLGTIAPVGAEARLKALDEWNDTGADRLRPTVVEMFQEQARSRPDAVAIVD
                     EHRSLTYRETAELSAQLAHHLIERGLTSEQVVGISLGRSADMVVGLLGVLQAGCAFVP
                     LDPAWPAERRAVVVEDARIVLQLNDSGEHRDGEPPALAVDLGAWRYASCPAAPTGVTV
                     PGAALAYVIFTSGSTGRPKGAMIRHEAISERLLWQSQEILGFGHDDASLFKAPLSFDI
                     SINEIFLPLVRGGRLVVLRPGGERDPQHLLSVLSEQRVTFTYLVSSMLDVLLEMTGDS
                     GRLDSLRHVWCGGEVLTPELYERFRTRLDIPMYHGYGPAETTIGVSHVIYRGEAERLS
                     TSIGKANPNTQLYVLDDELRPVPVGVGGELYVGGFLLGRGYVNAPGLTASRFVANPFA
                     GDGSRLYRTGDLARFAPDGSLDFLGRADNQTKIRGMRLETEDVEAGLGEHPSVRHTCV
                     VAKKNTAGGTYLVGYVIPVTGSEALRGDEVTAWAAEHMVDYMVPTHIVVLKEFPLTAN
                     GKIDRAALPEPRVGAGPFVPPSTENERAVCEAVATVLRLDEVGVDQDFFRLGGDSILA
                     ISLLSALRAAGLHVTARQIFTHSVVGALAAVVSREDVSTQGHDDVATGPVVGSPVVQW
                     LGETTDAVDGFVQSVVLNTPADLTADALDAILGAVTARHDMLRARLVRGDRWSFDIPQ
                     AGRAAVGWQESDLPLDACVALATDGLDPENGTMLRAVWRREARELVVVVHHVVVDGVS
                     WRILMEDLATAWQQFASGTPIELPPVGTSFRRWTQVLAGADFEADRAVFERPLPGADH
                     PVGRRALSAADTVARERTRTVTVGPEATAALLGEIPAKFHAGVNDVLLTGLAVALARW
                     RRDLGQDQTFAHVELEGHGREARFVADGAGFEPELSRTFGWFTTLFPVVVDPGATADP
                     TDPAYLAAALKAVKDDLARVPGNGLPYGVLRYLTDTGLDTPAPQVLFNYLGRFDSGTA
                     GDWQFAGAAGQLGEKRDPMMRLPRALEFNAIAEPASDGAYELVTTVSWPDGMFTHEDT
                     AAICSYLYEALTGLAALEQGGHSAGDFPLVPLTQGDVDALDGPALLDILPLTPLQEGL
                     YFHSVFDDDSAGSYVEQQLLTLEGEVDADRLAAAATRLLTLYPNLAARFVVLADGRVV
                     SVLESGVEAPFTTLDRPGITEAGIREHAERDRRAGFDLATGPLMRYTLIRGGSGASGR
                     AVLVQTVHHIVADGWSVPPMLRALLAEYHAPGSRYPLGGFPDHVRRLAGIDDEESDRV
                     WREQLAGLPGPSLVADGHTPSDRFADTAVVPEDDIDAAVRSAGVPLSVAVHSAWAVTL
                     GGILQGRDVVFGSTVSGRDAELPGIEDMVGLFINTIPLRARWDATTRARDLFTSVREH
                     QSAVLAHQHVSLARTGRQAGGGALFDTLVVFDVATDVDALRRPGDEFAVTRIVNEGAP
                     HYPLTLVVERTPDGRARFNLIYDEELLREAGARSVLDTFARTLTGLLAWPDALVDDLA
                     PDAGRSPAPFAPTTLGALFDAAAGRDPAATAVTHCTLDGGTRSLTYGELASAKNELAS
                     ALRAAGVGPGSRVAVAVPRSLDQVVALVAIVSAGGAYVPLDLAYPDQRLEYILTDAAP
                     QVVLVDRDQRDRFTALLDREAGPSARVLVLGEELPQEDGTPTGTPVAGWHDPAYVIYT
                     SGSTGRPKGVVVPHAAVVSLLRNTQPDMGFGPHDVWVQFHSYSFDFAVWELWGALAHG
                     GELLVPDYALTRSPVDFHRLVRERGVTVLNQTPSAFYRFVEADRHAGEPVGTLRRIIF
                     GGEALDLARLRGWVERHGAASPELVNMYGITETTVHVTHRVLTDEDFAGDASPIGGPV
                     PGLTTYVLDDRLRPVPPGRAGAIYVAGDQVSLGYLGRPGLTAGRFVANPFTADGSRMY
                     HTGDLARRTLDGELEFVGRADDQVQLKGFRIELGEVESAIREFDGVVDAAVTVADSED
                     HLVAHVVGRVPDDLPDRLSRKLPVHMVPGRVIEAEALPLTVNGKLDREALTERAARES
                     APVGTDDSALPVLVDIFAGTLPGDIAVDADTDFFMAGGDSIVAITVINRARALGLSIA
                     PRDVFLHRTPRALAEHLASRAPRSVTPASAPATREDGPLAPTPIMLRQRELGGSLIGF
                     AQARTVEVPEGTGFAEAGRAARAVVAAHPALRLRLGVEHGVWSLRTEPAREVTVVRTD
                     SADATAVANDAAGRLDPESGDVIAFSWLEPSRTLVVTVHHLAVDSVSWLILLDDLDTL
                     LRGGTLPAPTTSYAEYAEALTVRATQVTDDLDHWVTTLRAPGLLPAIGGIRETTVVVT
                     PEVSDRLTRTAPAALGIGPTELLCGALRTALTHVQASPTDLAVELERHGRVPALDHHD
                     YSRTVGWFTSIAPLRLTAHTDPLAAAREVAERRPDEAGHVAYGQLRHLNPQTAPLLTV
                     RPQVLFNYLGRGSESQALHLTGPDQDSPYAVEVNAWTDDAGSLRAVFSLADGIPDAIT
                     EHWRDALHRLAEVSAAAERTAPVTPLQRGLFFQAQMAGTAGHYVAQSYFTFDRPLDTD
                     ALAEAMAYVIARHPVVGAGFATDDDGNPVQLLAAGRRVDVRTVEASTEADVEALRARD
                     RDTGFDPGEPPLVRMTVVRLPGGQDGLLLSYHLLLWDGWSREILLRDLFGAYHAVLAG
                     ETPDPVPATPGFEDYARALDARDPAVSERFWAEHLAGLTGPTLLAGPEPSLTQQLPRA
                     LVHTLSAEGSDLLRAAARTHGVTLNTVLTGAFGLLLGAHTGRTDAVFGVTVSGREGEG
                     LSDIVGVLLNTVPMWTRARPADTVREYLSSVQAARVEAMEHEHLGLGEIQRAAGHGNL
                     FDNLFVLQNFLDMDAFAEMNARHGITSVKADDSTHYPFTWVVTPGERLTVKLEHRDDD
                     SANARRLLDDYLRVLDDLARSTGPVGALSGLGPEPELSARTDSARTPWSTGSTGRPTW
                     TRSGSLSSPGDRP"
     misc_feature    complement(356701..358140)
                     /locus_tag="Sfla_0308"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(356899..358101)
                     /locus_tag="Sfla_0308"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(357712..357717,357721..357738,
                     357745..357747))
                     /locus_tag="Sfla_0308"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(356719..356721,356995..356997,
                     357004..357006,357040..357042,357238..357240,
                     357304..357321,357379..357384,357733..357738))
                     /locus_tag="Sfla_0308"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(356455..356646)
                     /locus_tag="Sfla_0308"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(355525..356349)
                     /locus_tag="Sfla_0308"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    complement(355039..355491)
                     /locus_tag="Sfla_0308"
                     /note="non-ribosomal peptide synthase domain TIGR01720;
                     Region: NRPS-para261"
                     /db_xref="CDD:233545"
     misc_feature    complement(354172..355020)
                     /locus_tag="Sfla_0308"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    complement(352225..353688)
                     /locus_tag="Sfla_0308"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(352396..353634)
                     /locus_tag="Sfla_0308"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(353221..353226,353230..353247,
                     353254..353256))
                     /locus_tag="Sfla_0308"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(352243..352245,352492..352494,
                     352501..352503,352537..352539,352735..352737,
                     352804..352821,352888..352893,353242..353247))
                     /locus_tag="Sfla_0308"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(351976..352164)
                     /locus_tag="Sfla_0308"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    complement(351109..351771)
                     /locus_tag="Sfla_0308"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    complement(350773..351039)
                     /locus_tag="Sfla_0308"
                     /note="non-ribosomal peptide synthase domain TIGR01720;
                     Region: NRPS-para261"
                     /db_xref="CDD:233545"
     misc_feature    complement(349888..350757)
                     /locus_tag="Sfla_0308"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     gene            complement(358656..360446)
                     /locus_tag="Sfla_0309"
                     /db_xref="GeneID:11369874"
     CDS             complement(358656..360446)
                     /locus_tag="Sfla_0309"
                     /inference="protein motif:PFAM:PF00664"
                     /note="KEGG: sco:SCO0493 ABC-transporter transmembrane
                     protein;
                     PFAM: ABC transporter transmembrane region; ABC
                     transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004921293.1"
                     /db_xref="GI:357409557"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:11369874"
                     /translation="MSGTDTRVAPAATLRTAAGGESTRWVAARCREVPWLTAATVFTT
                     VAGAALQVLPVLLLGRVVDGVVEGDGRSVLVTTGILMAAAALLGAAATAVSTYLIGRL
                     GADLLAQLREAAVRAVLGMPSARIEQVGRGDVLSRVGDDVAVLSRGIRTAIPTVFSAG
                     VLVAIATVGMFGLDWRLGLAGAGALPAYALALRWYLPRSAPLYQQQRVAQADRAQALI
                     SGLNGIDTVRAYRLEGAFREQVTDKSWRVRELGIQVFRIFGRFVGRENRAEFIGLVLI
                     LVVGYVLLETGAATLGDVSAAPLMFHRLFTPLGAIMFTFDEAQKSGASLTRLVGVLGE
                     SSERRLVGDAPVASGGPVPHAVTVEGLTFGYPGAEEPVLRDVSLSIPAGGSLALVGAT
                     GAGKSTLAALIAGIGTPQAGSVRIGPHDLAGLDEAGARALVSILTQETHVFSGPLAED
                     LRLSAPAATDTELMDALRVVGARPWAEELPDGLDTTVGEGGERLDVTKVAQIALARLV
                     LNQAGVVVLDESTAEAGSEGAAELEKSVRAACSGRTTLFVAHRLTQAMAADRIAVLDA
                     GRVVEQGTHEELVALGGRYARLWRAWREGS"
     misc_feature    complement(358662..360344)
                     /locus_tag="Sfla_0309"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    complement(359523..360341)
                     /locus_tag="Sfla_0309"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(358680..359381)
                     /locus_tag="Sfla_0309"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(359256..359279)
                     /locus_tag="Sfla_0309"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(358797..358799,358890..358895,
                     359133..359135,359253..359261,359265..359270))
                     /locus_tag="Sfla_0309"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(359133..359144)
                     /locus_tag="Sfla_0309"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(358938..358967)
                     /locus_tag="Sfla_0309"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(358890..358907)
                     /locus_tag="Sfla_0309"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(358872..358883)
                     /locus_tag="Sfla_0309"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(358791..358811)
                     /locus_tag="Sfla_0309"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(360490..361542)
                     /locus_tag="Sfla_0310"
                     /db_xref="GeneID:11369875"
     CDS             complement(360490..361542)
                     /locus_tag="Sfla_0310"
                     /inference="protein motif:PFAM:PF01497"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: sro:Sros_0853 ABC transporter, periplasmic
                     solute-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_004921294.1"
                     /db_xref="GI:357409558"
                     /db_xref="GO:0005381"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:11369875"
                     /translation="MLFHRSTFPKPGRRLAAALAAVTLGVGLLAGCGSDSEDGTSDKA
                     PAAASGAFPVTVEHAFGSTEVTKAPERVVSVGYTDDQAVLALGIKPVGMVDQYPNPAG
                     TSPDINTQWPWVKDKWGDTRPEVVMSNGDSGPNYEKIAALRPDLIIAVYSEIDRAAYD
                     KLSKIAPTVGRTKAEKELFSAPWQDNAVHIAKALGKEDEGTALVKGIQEKLDAASEAH
                     PEFADQTAVALSWYEDSVAPFTTTDVRGRLVTGIGFKGATKIDEIAGDSFYTKLSPER
                     MDLVDVDRLFVINDKADQDALKKFELFSNLSAVKAGKVSYMLDSEGPAVGAAMSQGTL
                     LSLPYAIDELVKSVEQ"
     misc_feature    complement(360505..361461)
                     /locus_tag="Sfla_0310"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    complement(360553..361344)
                     /locus_tag="Sfla_0310"
                     /note="Fe3+-siderophore binding domain FhuD.  These
                     proteins have been shown to function as initial receptors
                     in ABC transport of Fe3+-siderophores in many eubacterial
                     species. They belong to the TroA-like superfamily of
                     helical backbone metal receptor proteins...; Region: FhuD;
                     cd01146"
                     /db_xref="CDD:238566"
     misc_feature    complement(order(360832..360834,361084..361086,
                     361147..361152,361204..361206))
                     /locus_tag="Sfla_0310"
                     /note="siderophore binding site; other site"
                     /db_xref="CDD:238566"
     gene            complement(361659..362498)
                     /locus_tag="Sfla_0311"
                     /db_xref="GeneID:11369876"
     CDS             complement(361659..362498)
                     /locus_tag="Sfla_0311"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: sgr:SGR_6713  ABC-type Fe3+-siderophore
                     transporter ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe+3-siderophore ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_004921295.1"
                     /db_xref="GI:357409559"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11369876"
                     /translation="MGAQHGTTKHSAASDEARLAARGVTVGYGGRTVIDGLDVTVPSG
                     LITTIIGPNGCGKSTLLRTLTRLLKPASGAVVLDGEDIAGLRTRDVAKKLGLLPQAPV
                     APEGLTVADLVARGRHPHQSWLRQWSSDDASVVERALAMTGVSELADRPVDSLSGGQR
                     QRVWISMTLAQGTDLLLLDEPTTYLDLAHAIDVLDLVDDLHESGRTVVMVLHDLNLAT
                     RYSDNLVVMRAGSILAQGHPRDVITVELLHEAFGLNAKVIDDPVGDRPLIVPIGRTHV
                     QLN"
     misc_feature    complement(361680..362450)
                     /locus_tag="Sfla_0311"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    complement(361791..362441)
                     /locus_tag="Sfla_0311"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    complement(362325..362348)
                     /locus_tag="Sfla_0311"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(order(361863..361865,361959..361964,
                     362202..362204,362322..362330,362334..362339))
                     /locus_tag="Sfla_0311"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(362202..362213)
                     /locus_tag="Sfla_0311"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(362007..362036)
                     /locus_tag="Sfla_0311"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(361959..361976)
                     /locus_tag="Sfla_0311"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(361941..361952)
                     /locus_tag="Sfla_0311"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(361857..361877)
                     /locus_tag="Sfla_0311"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(362551..363615)
                     /locus_tag="Sfla_0312"
                     /db_xref="GeneID:11369877"
     CDS             complement(362551..363615)
                     /locus_tag="Sfla_0312"
                     /inference="protein motif:PFAM:PF01032"
                     /note="PFAM: transport system permease;
                     KEGG: sro:Sros_0852 iron-enterobactin transporter
                     permease"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_004921296.1"
                     /db_xref="GI:357409560"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:11369877"
                     /translation="MNGTDVKRPVVPGVRLGGMSFVWRPWLVSVTVLLAGATFLVFCV
                     SVGVGDFPIGVPRVVATIFGHGEQVDEFVIMDLRMPRALAGLLVGLALGVSGALTQSI
                     ARNPLASPDILGITGGAGVVAVFLVTASGGAAAAVVSTVGLSAAALAGGLGAGLLVYF
                     LAWRRGIDGFRLILIGISVTAVTEALTTWLLATADIRDVARAQAWLVGSLDNRSWDEV
                     RVVFWCSLVLLAVVTAAAFQFRPLHLGDEVAAGLGVRFSRVRAVLLLCAVLLAAAAVG
                     AAGPVPFVALVAPQVAMRLARHPTPPLVASGLVGALLLLGADLVARAALPITLPVGVV
                     TAAIGGPFLVYLLVRSNLRQ"
     misc_feature    complement(362575..363333)
                     /locus_tag="Sfla_0312"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(362719..362721,362740..362742,
                     362860..362868,362872..362889,362893..362898,
                     362902..362910,362914..362919,363298..363306,
                     363316..363318))
                     /locus_tag="Sfla_0312"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(362575..362577,362584..362589,
                     362596..362598,362605..362610,362617..362619,
                     362767..362769,362995..362997,363004..363009,
                     363043..363045,363049..363054,363061..363063,
                     363070..363075,363082..363087,363094..363099,
                     363103..363105,363280..363282,363295..363297,
                     363301..363303))
                     /locus_tag="Sfla_0312"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(362626..362628,362650..362652,
                     362779..362781,362791..362793,362965..362967,
                     363043..363045))
                     /locus_tag="Sfla_0312"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(363612..364745)
                     /locus_tag="Sfla_0313"
                     /db_xref="GeneID:11369878"
     CDS             complement(363612..364745)
                     /locus_tag="Sfla_0313"
                     /inference="protein motif:PFAM:PF01032"
                     /note="PFAM: transport system permease;
                     KEGG: sco:SCO0497 iron-siderophore permease transmembrane
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_004921297.1"
                     /db_xref="GI:357409561"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:11369878"
                     /translation="MLPDRSRIPQLPLKHQMIKGISYVDMSTSAVERPVLRGAAEARR
                     RRAVGLGALVAVLVAGVVASLAVGARALSPAEVWHGLFAAPDSDQRLTEIRLIVQTVR
                     VPRTVLAVVAGIALGVGGALIQGYTRNPIADTGLLGVNSGASFAVVTVIAVFGLTSPF
                     QYVWFAFLGAGAAGVVVFGLSSIGRGAGNPLTLALAGQGVTVFLAAMTMAIALSDLKA
                     LDALRFWNAGSVAGVGFDVIGPVGAFIAVGVLLALTTLPSLNLLNLGDDVARGLGVNI
                     ALSRTVGIVAITLLAGAATAACGPIAFLGLMVAHVARYLTGPDYRWLVPYAGLLGAVV
                     LLVCDIVGRLVVRPGELDAGVVVALLGAPFFAALVWRGKFRSA"
     misc_feature    complement(363639..364430)
                     /locus_tag="Sfla_0313"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(363786..363788,363807..363809,
                     363930..363938,363942..363959,363963..363968,
                     363972..363980,363984..363989,364356..364364,
                     364374..364376))
                     /locus_tag="Sfla_0313"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(363639..363641,363648..363653,
                     363660..363662,363669..363674,363681..363683,
                     363837..363839,364065..364067,364074..364079,
                     364110..364112,364116..364121,364128..364130,
                     364137..364142,364149..364154,364161..364166,
                     364170..364172,364338..364340,364353..364355,
                     364359..364361))
                     /locus_tag="Sfla_0313"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(363690..363692,363717..363719,
                     363849..363851,363861..363863,364035..364037,
                     364110..364112))
                     /locus_tag="Sfla_0313"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(364852..366195)
                     /locus_tag="Sfla_0314"
                     /db_xref="GeneID:11369879"
     CDS             complement(364852..366195)
                     /locus_tag="Sfla_0314"
                     /inference="protein motif:PRIAM:1.14.13.59"
                     /note="KEGG: sgr:SGR_6710  peptide monooxygenase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lysine 6-monooxygenase"
                     /protein_id="YP_004921298.1"
                     /db_xref="GI:357409562"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:11369879"
                     /translation="MSQVQPGDAPQVLDLIGIGFGPSNVAMAIAISEHNTDAAAQQPV
                     SAHFFEQQPRFGWHRGMLIDDATMQVSFLKDLVTLRNPTSEFSFLCYLKSRGRLVDFI
                     NHKNLFPLRVEFHDYFEWAAAKVGDMVSYRQEVVGVTPVLNDGGAVEYLDVTVRSDEG
                     LTVHRARNVVIGTGLRPLMPEGVERGDRVWHNSELLAKVEGLEGASPSRFVVVGAGQS
                     AAENVAYLHRRFPEAEVCAVFSRYGYSPADDSSFANRIFDPGAVDEYFAAPGDVKRRL
                     MDYHGNTNYSVVDIDLIDDLYRQMYQEKVLGTERLRFLNVSRLAAVEEKPDTVHATVT
                     NLVTGEEAVLDADIVVFATGYSPVDPLGLLGEAAGSCLRDEEGRVRVERDYRIATEAG
                     LSCGIYLQGGTEHTHGITSALLSNTAIRVGEILDSLLARGVKATSDEARPLADAS"
     misc_feature    complement(365125..366165)
                     /locus_tag="Sfla_0314"
                     /note="L-lysine 6-monooxygenase (NADPH-requiring); Region:
                     K_oxygenase; pfam13434"
                     /db_xref="CDD:257759"
     misc_feature    complement(365674..366144)
                     /locus_tag="Sfla_0314"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            366442..367389
                     /locus_tag="Sfla_0315"
                     /db_xref="GeneID:11369880"
     CDS             366442..367389
                     /locus_tag="Sfla_0315"
                     /inference="protein motif:PFAM:PF00551"
                     /note="PFAM: formyl transferase domain protein;
                     KEGG: sgr:SGR_6709  formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl transferase domain-containing protein"
                     /protein_id="YP_004921299.1"
                     /db_xref="GI:357409563"
                     /db_xref="GO:0005381"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="GeneID:11369880"
                     /translation="MRVVMFGYQTWGHRTLQALLDSEHDVVLVVTHPRSEHAYEKIWS
                     DSVADLAEARDVPVLIRNRPDDDELFARLQEADADIIVANNWRTWIPPRIFGLPRHGT
                     LNIHDSLLPKYAGFSPLIWALINGESEVGVTAHMMNDELDAGDIVRQEAVAVGPTDTA
                     TDLFHKTVDLIGPVTIGALDLIAAGQTEFTRQDRSQATFFHKRAAEDIRIDWNWPAED
                     LERLVRAQSEPYPSAFTFHRGRRIEILAAVVSQGRYGGTPGRVFYREGEGVVIVAGSD
                     ARTGRNHGLAVTRVRTEDGRELPATEYFTSMGGYLTGRP"
     misc_feature    366442..367350
                     /locus_tag="Sfla_0315"
                     /note="Methionyl-tRNA formyltransferase [Translation,
                     ribosomal structure and biogenesis]; Region: Fmt; COG0223"
                     /db_xref="CDD:223301"
     misc_feature    366448..366984
                     /locus_tag="Sfla_0315"
                     /note="Formyltransferase, catalytic core domain; Region:
                     FMT_core; cd08369"
                     /db_xref="CDD:187712"
     misc_feature    order(366460..366462,366469..366477,366688..366711,
                     366724..366726,366751..366762,366784..366786,
                     366844..366846,366850..366855,366862..366867)
                     /locus_tag="Sfla_0315"
                     /note="active site"
                     /db_xref="CDD:187712"
     misc_feature    order(366469..366474,366691..366696,366754..366756,
                     366760..366762,366952..366954)
                     /locus_tag="Sfla_0315"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187712"
     misc_feature    order(366688..366690,366697..366699,366703..366711,
                     366724..366726,366751..366753,366850..366855,
                     366862..366867)
                     /locus_tag="Sfla_0315"
                     /note="cosubstrate binding site; other site"
                     /db_xref="CDD:187712"
     misc_feature    order(366751..366753,366757..366759,366865..366867)
                     /locus_tag="Sfla_0315"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187712"
     misc_feature    367057..367365
                     /locus_tag="Sfla_0315"
                     /note="Formyl transferase, C-terminal domain; Region:
                     Formyl_trans_C; pfam02911"
                     /db_xref="CDD:251614"
     gene            367611..368516
                     /locus_tag="Sfla_0316"
                     /db_xref="GeneID:11369881"
     CDS             367611..368516
                     /locus_tag="Sfla_0316"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: sco:SCO7400 ABC transporter ATP-binding
                     protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004921300.1"
                     /db_xref="GI:357409564"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11369881"
                     /translation="MPMRAGESTSTAVGTPVSAVGPPRRGHGLSADGVTVAYGRVDVV
                     HGAALTLRPAEVTALVGPNGSGKSTLLRTLARLQSARTGSLTVDAGTDAAEDGFALGA
                     REFARRVALLTQSRSTPGGLTVRDVVDFGRYPHRGRWGRPDPRGTAAVDRALRLTGVE
                     DLAARGVDQLSGGQLQRVWLASCLAQETGVLLLDEPTTYLDLRYQVELLDLIRDLADD
                     HGIAVGVVLHDLDQAAAVADRVALLHAGRVVADGVPEDVFTPGLLSDVYGIRIDVDTD
                     PATGSLRTRAIGRHHSRSERLSTTS"
     misc_feature    367689..368450
                     /locus_tag="Sfla_0316"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    367698..368366
                     /locus_tag="Sfla_0316"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    367791..367814
                     /locus_tag="Sfla_0316"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(367800..367805,367809..367817,367950..367952,
                     368190..368195,368292..368294)
                     /locus_tag="Sfla_0316"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    367941..367952
                     /locus_tag="Sfla_0316"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    368118..368147
                     /locus_tag="Sfla_0316"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    368178..368195
                     /locus_tag="Sfla_0316"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    368202..368213
                     /locus_tag="Sfla_0316"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    368280..368300
                     /locus_tag="Sfla_0316"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            368513..369496
                     /locus_tag="Sfla_0317"
                     /db_xref="GeneID:11369882"
     CDS             368513..369496
                     /locus_tag="Sfla_0317"
                     /inference="protein motif:PFAM:PF01497"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: sco:SCO7399 binding-protein-dependent transport
                     lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_004921301.1"
                     /db_xref="GI:357409565"
                     /db_xref="GO:0005381"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:11369882"
                     /translation="MRRHLLTTAAVAVAALSLAACGTTEPSSDDASAASGKPAEKITL
                     TDAKGTKVTLDGPATKVVATEWNVVEDLVALGVDPVGVADVKGYTAWNTAAPLTGSPK
                     DIGTRGEPSIDTVAALAPDLVVATSDLSPAVVKQLRKVAPVIEITSADAADQIGTMTE
                     GLDLIAKATGKESESAALKKDFDTSVAEGKKALADAGLGGAEIASADGYVASNQVSVR
                     AYTGGSLLGAVNEKLGLKNAWTVKGDESYGLATTDVEGLTGLGDVQFTYVANDADGDA
                     FAGPLAKNAVWKSLPFVKAGDVHRLPDGVWMFGGPRSMEAYIDSLVDALTK"
     misc_feature    368591..369487
                     /locus_tag="Sfla_0317"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    368678..369469
                     /locus_tag="Sfla_0317"
                     /note="Fe3+-siderophore binding domain FhuD.  These
                     proteins have been shown to function as initial receptors
                     in ABC transport of Fe3+-siderophores in many eubacterial
                     species. They belong to the TroA-like superfamily of
                     helical backbone metal receptor proteins...; Region: FhuD;
                     cd01146"
                     /db_xref="CDD:238566"
     misc_feature    order(368783..368785,368831..368836,368897..368899,
                     369164..369166)
                     /locus_tag="Sfla_0317"
                     /note="siderophore binding site; other site"
                     /db_xref="CDD:238566"
     gene            369503..371569
                     /locus_tag="Sfla_0318"
                     /db_xref="GeneID:11369964"
     CDS             369503..371569
                     /locus_tag="Sfla_0318"
                     /inference="protein motif:PFAM:PF01032"
                     /note="PFAM: transport system permease;
                     KEGG: sco:SCO7398 iron-hydroxamate transporter permease
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_004921302.1"
                     /db_xref="GI:357409566"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:11369964"
                     /translation="MAVIEKTVAGRDRSVAATTGAVAVTATLVLLVVVLAAVDITQGT
                     ADVGGSEVWDALTGNAAAGDSSVVIASRLPRMVAAVLVGVALGTAGAALQAVSRNVLA
                     SPDTLAVNAGSYLALGIVAVTGVSLPLLASSGAAFVGGLAAAAVVLGLSGLGKGTVRL
                     VLAGTALALGLSAVTEALLLLFPQETEGLYSWNQGSVGQNGFDAVVRMAPVVVAGLAG
                     LMLLARRIDALALGDDAARGLGVPVRGTRVTTVVVATLLSAAAVTLAGPIGFVGLCAP
                     ALVRPLTRRFRGLVRSRVSLPVTGLVGAALVLGSDVLLRAVVPADTAVEVPTGVVTTV
                     VGGVFLVVMALRLRDTASAEPPDRLRIPGRTAFLVTVAVLAVVLVGVLFAAVLLGDSK
                     LLLGDVMNWAQGRSGRVVTFVLDTRVPRVSAALLAGGALALSGTLVQAVTRNPLAEPG
                     VLGVSGGAGLGAVLLVTTVQSPGSWEIAGAAFGGAAVTATFVFGLAARGGFQQNRLVL
                     LGVGVSAAAAALISLVIVLSDPFDTTKALTWLSGSTYGRNMPDVVPVAVVLAVGIVLA
                     VVRRRELDLVALDEDTPRLLGMGLPRARLGLLVMAVLLAATAVAAAGTIAFVGLVAPH
                     AARALVGRRHVRVVPVALLLGAALVCLADLAGRTVIAPAQLGAGLMTAVIGAPYFLYL
                     LVRTRR"
     misc_feature    369620..371566
                     /locus_tag="Sfla_0318"
                     /note="iron-hydroxamate transporter permease subunit;
                     Provisional; Region: PRK10577"
                     /db_xref="CDD:236720"
     misc_feature    369728..370471
                     /locus_tag="Sfla_0318"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(369782..369784,369794..369802,370160..370165,
                     370169..370177,370181..370186,370190..370207,
                     370211..370219,370340..370342,370358..370360)
                     /locus_tag="Sfla_0318"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(369797..369799,369803..369805,369818..369820,
                     369977..369979,369983..369988,369995..370000,
                     370007..370012,370019..370021,370028..370033,
                     370037..370039,370070..370075,370082..370084,
                     370310..370312)
                     /locus_tag="Sfla_0318"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(370037..370039,370112..370114,370286..370288,
                     370298..370300,370445..370447,370469..370471)
                     /locus_tag="Sfla_0318"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     misc_feature    370811..371551
                     /locus_tag="Sfla_0318"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(370817..370819,370829..370837,371201..371206,
                     371210..371218,371222..371227,371231..371248,
                     371252..371260,371381..371383,371402..371404)
                     /locus_tag="Sfla_0318"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(370832..370834,370838..370840,370853..370855,
                     371015..371017,371021..371026,371033..371038,
                     371045..371050,371057..371059,371066..371071,
                     371075..371077,371111..371116,371123..371125,
                     371351..371353,371507..371509,371516..371521,
                     371528..371530,371537..371542,371549..371551)
                     /locus_tag="Sfla_0318"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(371075..371077,371153..371155,371327..371329,
                     371339..371341,371471..371473,371498..371500)
                     /locus_tag="Sfla_0318"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(371657..372094)
                     /locus_tag="Sfla_0319"
                     /db_xref="GeneID:11369965"
     CDS             complement(371657..372094)
                     /locus_tag="Sfla_0319"
                     /inference="protein motif:PFAM:PF00462"
                     /note="PFAM: glutaredoxin;
                     KEGG: sco:SCO2989 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_004921303.1"
                     /db_xref="GI:357409567"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0015035"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="GeneID:11369965"
                     /translation="MTRAWILPMSLVLSGVLVATAQVRDGSPVLAVVLLLVFAVLAWL
                     YSPLAFPRSIGAVEAQRRSAADGRPVVYWRAGCVYCLRLRIRLGRDARRSHWVDIRRD
                     PAGAAEVRAANGGDETVPTVVVAGRPHVNPDPAWVRGQLPPSA"
     misc_feature    complement(371672..371884)
                     /locus_tag="Sfla_0319"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            372199..372546
                     /locus_tag="Sfla_0320"
                     /db_xref="GeneID:11369966"
     CDS             372199..372546
                     /locus_tag="Sfla_0320"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: nda:Ndas_4296 glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004921304.1"
                     /db_xref="GI:357409568"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:11369966"
                     /translation="MPVRRVVPDIRSEAMEESRDFYGLLGFEEVMNQGWVMTLASSSC
                     PTAQVTLTSHDRSAPVVPDISIEVDDVDAAYAVMRESGADIVYPLRDEEWGVRRFFVL
                     DPNGTVVNVLSHR"
     misc_feature    372211..372543
                     /locus_tag="Sfla_0320"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(372217..372219,372229..372231,372304..372306,
                     372346..372348,372352..372354,372385..372387,
                     372496..372498,372520..372522,372526..372528)
                     /locus_tag="Sfla_0320"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(372217..372219,372385..372387,372526..372528)
                     /locus_tag="Sfla_0320"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            373075..374946
                     /locus_tag="Sfla_0321"
                     /db_xref="GeneID:11369967"
     CDS             373075..374946
                     /locus_tag="Sfla_0321"
                     /inference="protein motif:TFAM:TIGR00976"
                     /note="KEGG: sco:SCO0501 hypothetical protein;
                     TIGRFAM: hydrolase CocE/NonD family protein;
                     PFAM: X-Pro dipeptidyl-peptidase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_004921305.1"
                     /db_xref="GI:357409569"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR005674"
                     /db_xref="InterPro:IPR013736"
                     /db_xref="GeneID:11369967"
                     /translation="MRARRTAGWAASALVTVLASAGLLAAPAAASGPAAARGPQVATA
                     TDPVTHEENDRVPEGSLWTQHYFPSSDRSGTELHADVLLPEGLPRKAEVPVILSVGPY
                     FGHSGQSGAEGWSHTGPSARFQDFIEGTDLFDQGYAFVMVDLRGFGGSTGCLDWGGPG
                     EQADVKAAIDWAAKQPWSTGAVGLYGKSYDAVTGLIGNNLDQRALKAVVAQEPLWDMY
                     QYIYSNGVPRPNVTGTANAYNSIATLDQLPDDDARYLANSRYEEAHPECLTENSAGYR
                     IADQHDPFWTSRDLAKAARGTDTPLFVTQGFIENNTKPEEMQEYLDNHKGPERGWVGQ
                     WEHVRGGDRTGDGRLAMGREGWYDETLSFYDQYLKGVRPTVRYPAYSVEDSTGAWRAQ
                     KTWPAVERSVSISLGGGSYVDDGGLSSIAGLVGPDGQAPRERVEPSGDWDLENAPAID
                     PAAPKGLAEKQARLPRPGAVTSSFFVWSEALEKAVRVTGTPRVSLTARGEGNVMLKLY
                     DVAPDGTAVMFDEQVSLLRTGKLSVDLKATDWTLAAGHVLAVEIGSIRTGSWRDTPSG
                     GTIRVEGARLGLALDDPADDIATGGARSPYLDTYLLRYTVPLPAGPGTFTVVPGGRL"
     misc_feature    373285..374913
                     /locus_tag="Sfla_0321"
                     /note="putative hydrolase, CocE/NonD family; Region:
                     /NonD; TIGR00976"
                     /db_xref="CDD:233219"
     misc_feature    373294..>373530
                     /locus_tag="Sfla_0321"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    373468..373977
                     /locus_tag="Sfla_0321"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    374191..374802
                     /locus_tag="Sfla_0321"
                     /note="X-Pro dipeptidyl-peptidase C-terminal non-catalytic
                     domain; Region: PepX_C; cl08482"
                     /db_xref="CDD:263680"
     gene            complement(375069..375729)
                     /locus_tag="Sfla_0322"
                     /pseudo
                     /db_xref="GeneID:11369968"
     gene            complement(375764..376879)
                     /locus_tag="Sfla_0323"
                     /db_xref="GeneID:11369969"
     CDS             complement(375764..376879)
                     /locus_tag="Sfla_0323"
                     /inference="protein motif:PFAM:PF01594"
                     /note="PFAM: protein of unknown function UPF0118;
                     KEGG: sco:SCO0513 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921306.1"
                     /db_xref="GI:357409570"
                     /db_xref="InterPro:IPR002549"
                     /db_xref="GeneID:11369969"
                     /translation="MSVTMSSTKTRAALRVSARVSGELLLVLVMTAVALWLLGRMWSV
                     VWPLVVGLLLTTLTWPLTRFLRRRGWPPALAASTVTVLFLLVAGGAVALIAVPVASQS
                     GELADGVVEGIQRLREWASGPPLNIGDDQITGAFDSATARVQDSVGSMVTTVVTGVST
                     VVNGVVTAVLAVFLMFFMLKDGPRFLPWLARQLPGRLATDVPTVAARGWDTLGEFVRS
                     QAYVGLLDAVLIGLGLWIVGVPLVLPLAVLTFVSAFVPIVGALFAGFVAVLIALVSNG
                     LTDALIVLAIIVVVQQLEGNVFQPMIQSRGLGLHAAVVLLAVTLGGSLAGIVGSLLAV
                     PAAALIAVVWNYVREQLVEPGEEPEVQTSPSPVGTPS"
     misc_feature    complement(375800..376810)
                     /locus_tag="Sfla_0323"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     gene            377045..377743
                     /locus_tag="Sfla_0324"
                     /db_xref="GeneID:11369970"
     CDS             377045..377743
                     /locus_tag="Sfla_0324"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11;
                     KEGG: nda:Ndas_1878 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_004921307.1"
                     /db_xref="GI:357409571"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:11369970"
                     /translation="MTSQRQNEQTWTLYGQRQLDHGFQPPVPQRIDWGFWPGVGPGAE
                     LLGDIRGRRVLDIGSGPGHHAVHLARGHGALVCGVDISPTQHRRATRAHRDEPGVRFL
                     CADIAAHLRGSELYEAAYGVRTFGCIDPHHLLPALRDGLTGGSPLVFSALHTDSDGHG
                     PSGSVESRPEVIRLRDEEPIATHMWVLDPGLWEELLAAHHFTVTATHLLQAPEAGSPV
                     VMQVIQARRQAGRG"
     misc_feature    377201..>377362
                     /locus_tag="Sfla_0324"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(377213..377233,377282..377287,377354..377362)
                     /locus_tag="Sfla_0324"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            377998..378843
                     /locus_tag="Sfla_0325"
                     /db_xref="GeneID:11369971"
     CDS             377998..378843
                     /locus_tag="Sfla_0325"
                     /inference="protein motif:TFAM:TIGR00861"
                     /note="KEGG: sgr:SGR_6421  glycerol uptake facilitator
                     protein;
                     TIGRFAM: MIP family channel protein;
                     PFAM: major intrinsic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MIP family channel protein"
                     /protein_id="YP_004921308.1"
                     /db_xref="GI:357409572"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR012269"
                     /db_xref="GeneID:11369971"
                     /translation="MAKRSTRSGLLGELSAEFAGTMILILFGCGVVAQVVAGGALTDP
                     PGGLGDHDSIAWAWGLGVTLGVYVAARLSGAHLNPAVTLALATFRGFPWSKVAPYFLA
                     QTAGAFVAALLVRWNYTEALAKADPGHTTKTQTVFSTLPANGNPALPVHEWGAFRDQV
                     IGTAILLLLIMAITDMLNTPPGANLAPFIIGLVVVAIGMAWGTNAGYAINPARDFGPR
                     LASFITGYNGAWRDQYGNLYFWVPIVGPLVGGLLGAGLYKAFVGRFLPSAEPEPPGRV
                     PAPED"
     misc_feature    378043..378726
                     /locus_tag="Sfla_0325"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:238204"
     misc_feature    order(378169..378171,378223..378231,378613..378618,
                     378625..378627,378634..378636)
                     /locus_tag="Sfla_0325"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    order(378229..378237,378625..378633)
                     /locus_tag="Sfla_0325"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            378871..380388
                     /locus_tag="Sfla_0326"
                     /db_xref="GeneID:11369972"
     CDS             378871..380388
                     /locus_tag="Sfla_0326"
                     /inference="protein motif:TFAM:TIGR01311"
                     /note="KEGG: sgr:SGR_6420 glycerol kinase;
                     TIGRFAM: glycerol kinase;
                     PFAM: Carbohydrate kinase, FGGY-like"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_004921309.1"
                     /db_xref="GI:357409573"
                     /db_xref="GO:0004370"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="GeneID:11369972"
                     /translation="MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHAQILPRSGWV
                     EHDPVEIWERTNSVMQNALRFGGIAPGDLAAIGITNQRETTVIWDPRNGRPYYNAIVW
                     QDTRTDAIAAELERSGRGDVIRRKAGLPPATYFSAGKIQWILENVDGVREAAEAGHAI
                     FGNTDAWVLWNLTGGPDGGIHATDVTNASRTMLMDLETLDWDEELLSFFNIPRSMLPT
                     INPSSHAEAYGTTRTSRPLRAAVPIGGVLGDQQAATVGQVCFSPGEAKNTYGTGNFLV
                     LNTGTELVRSQHGLLTTVAYQFGDSPVVYALEGSIAVTGSAVQWLRDQMKIIKTAAES
                     EVLARSVDDNGGMYFVPAFSGLFAPYWRSDARGAIVGLARYNDNAHLARATLESICYQ
                     SRDVVEAMEQDSGVHLDVLKVDGGVTANDLCMQIQADVLGVPVSRPVVAETTALGAAY
                     AAGLATGFWQNTDELRAQWHESERWAPQWSEEQREEGYAGWKKAVERTLDWVKVS"
     misc_feature    378871..380376
                     /locus_tag="Sfla_0326"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    378880..380373
                     /locus_tag="Sfla_0326"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    order(378895..378906,378910..378912,378916..378918,
                     379615..379617,379672..379683,380113..380115)
                     /locus_tag="Sfla_0326"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            complement(380502..381467)
                     /locus_tag="Sfla_0327"
                     /db_xref="GeneID:11369973"
     CDS             complement(380502..381467)
                     /locus_tag="Sfla_0327"
                     /inference="protein motif:PFAM:PF05726"
                     /note="PFAM: Pirin domain protein;
                     KEGG: sgr:SGR_657  pirin-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="YP_004921310.1"
                     /db_xref="GI:357409574"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="GeneID:11369973"
                     /translation="MSNLDRQATPSVCGGRGFVVAEPVRELLTPRHVQLGESTEVRRL
                     LPNLGRRMVGAWAFVDHYGPDDIADEPGMQVPPHPHMGLQTVSWLHEGEVLHRDSLGS
                     LQQIRPRELGLMTSGRAISHSEESPKPHARFLHGAQLWVALPGSDRHVEPRFEHHTGL
                     PAVTAPGLTATVILGELDGAASPGTAYTPIVGADLTLTAGAEARLPLDPDFEYAVLSM
                     SGEAEIDGVPVLPGSMLYLGCGRTELPLRAASDAGLMLLGGEPFAEEIVMWWNFVGRS
                     HEEIEQARQDWMEGPRFGEVKGYDGGRLPAPELPPVALKPRGRVR"
     misc_feature    complement(380586..381350)
                     /locus_tag="Sfla_0327"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    complement(381045..381347)
                     /locus_tag="Sfla_0327"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    complement(380586..380891)
                     /locus_tag="Sfla_0327"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            381588..381965
                     /locus_tag="Sfla_0328"
                     /db_xref="GeneID:11369974"
     CDS             381588..381965
                     /locus_tag="Sfla_0328"
                     /inference="similar to AA sequence:KEGG:SGR_658"
                     /note="KEGG: sgr:SGR_658 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921311.1"
                     /db_xref="GI:357409575"
                     /db_xref="GeneID:11369974"
                     /translation="MEDTYYEFGTPADRWDRAQMFFEAKEYLTAARILGGLVQEVPEQ
                     VAPRLLLARAYYHSARLGKAETELREVLERNPVEDYARLMLGRTLERQGRQSEADTHL
                     RMVQAMAGDLGPELHAQEQRIQG"
     misc_feature    381648..381848
                     /locus_tag="Sfla_0328"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     gene            complement(382038..382733)
                     /locus_tag="Sfla_0329"
                     /db_xref="GeneID:11369975"
     CDS             complement(382038..382733)
                     /locus_tag="Sfla_0329"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: sgr:SGR_660 TetR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein TetR"
                     /protein_id="YP_004921312.1"
                     /db_xref="GI:357409576"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:11369975"
                     /translation="MSTRARILEVAARLVAESPDGEISTRAVCEAAQVGAPALYRHFG
                     DKEGLLSAVVDHGFDAYLATKRERGDTTDPVEDLRNGWDSHVDFALRNPNLYRLMNSP
                     AMRTPPGSAIEAHRILTHDLERAAAQGKLRVAPELAAQMIMSATTGVALMLVSRPVTF
                     PDVGMSARVRDAVHAAVFTADVSPGAPVETAVPSAAATLGALLRRSHGSGLSTAESAL
                     MTEWLDRVSNAER"
     misc_feature    complement(382266..382727)
                     /locus_tag="Sfla_0329"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(382575..382715)
                     /locus_tag="Sfla_0329"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(382269..382478)
                     /locus_tag="Sfla_0329"
                     /note="WHG domain; Region: WHG; pfam13305"
                     /db_xref="CDD:257642"
     gene            complement(382851..383600)
                     /locus_tag="Sfla_0330"
                     /db_xref="GeneID:11369976"
     CDS             complement(382851..383600)
                     /locus_tag="Sfla_0330"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: sgr:SGR_661  short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004921313.1"
                     /db_xref="GI:357409577"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11369976"
                     /translation="MTEQHTTSTRRVALVTGGSRGIGRESAERLASDGFAVVINYAGN
                     KTEAEAAVAAVVAAGGQAVAHQADVADEAAVAALFDAAEEAFGGVDVVVHAAGIMSLS
                     PLVDLDLDALDGMYRTNVRGTFVVDQQAARRLRGGGAIINFSSSVLALAIPGYTAYAA
                     TKGAVEAMTLILARELRGRDITVNAVAPGPTATALFLDGKDEETIARMAAQPPLERLG
                     APEDIAEVVSFLAGPARWVNGQVLRANGGII"
     misc_feature    complement(382854..383585)
                     /locus_tag="Sfla_0330"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK12937"
                     /db_xref="CDD:171821"
     misc_feature    complement(382854..383570)
                     /locus_tag="Sfla_0330"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(383028..383039,383115..383117,
                     383127..383129,383166..383174,383310..383318,
                     383472..383480,383535..383537,383541..383546,
                     383550..383552))
                     /locus_tag="Sfla_0330"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(383115..383117,383127..383129,
                     383166..383168,383244..383246))
                     /locus_tag="Sfla_0330"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(384046..384717)
                     /locus_tag="Sfla_0331"
                     /db_xref="GeneID:11369977"
     CDS             complement(384046..384717)
                     /locus_tag="Sfla_0331"
                     /inference="protein motif:PFAM:PF01648"
                     /note="PFAM: 4'-phosphopantetheinyl transferase;
                     KEGG: sgr:SGR_665  phosphopantetheinyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="YP_004921314.1"
                     /db_xref="GI:357409578"
                     /db_xref="GO:0000287"
                     /db_xref="GO:0008897"
                     /db_xref="InterPro:IPR003542"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="GeneID:11369977"
                     /translation="MIERLLPAYVACSDTHETDAPEGSLYPEEVRQVASSVDRRRHEF
                     AAVRACARKAMADLGLPPAPVLSGHRGMPRWPEGTVGSMTHCEGYRAAVLARTSDARA
                     VGIDAEPNAPLPPDVWEVISLPSERARRPLGADSGTVHWDRLLFSAKESVFKTWFPLT
                     RIELDFSEADIVFRASPDSATEGTFTAELLRVAPGMPSAYEGRWLVDDGFAVTAIVLP
                     ATPFV"
     misc_feature    complement(384070..384414)
                     /locus_tag="Sfla_0331"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:250768"
     gene            complement(384714..385619)
                     /locus_tag="Sfla_0332"
                     /db_xref="GeneID:11369978"
     CDS             complement(384714..385619)
                     /locus_tag="Sfla_0332"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: metallophosphoesterase;
                     KEGG: sgr:SGR_666  phosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_004921315.1"
                     /db_xref="GI:357409579"
                     /db_xref="GO:0016787"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:11369978"
                     /translation="MSSPAGPAPHTSNGGGRLLAVSDLHVGIADNRPVADRLHPSGDE
                     DWLIVAGDVAEEAEEVERALELLAGRFAHVVWTPGNHELWTVDKDPVRLRGQERYEHL
                     VKVCRELGVTTPEDPYPHWQGDDGPVAVAPVFLLYDYSFRVPGVTSKEESLARAHDAG
                     VVCTDEYLLHPDPYATRDDWCRARVALTEQRLAAHDPDVPLVIAGHWPLLREPTSVMW
                     YPEFAQWCGTELTADWHRRFNVAAVVYGHLHIPRTTWHDGVRFEEVSIGYPREWRKRG
                     HPRGLLRQILPYGGQEPPATKGEGS"
     misc_feature    complement(384792..385571)
                     /locus_tag="Sfla_0332"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    complement(384867..385571)
                     /locus_tag="Sfla_0332"
                     /note="Calcineurin-like phosphoesterase; Region:
                     Metallophos; pfam00149"
                     /db_xref="CDD:249630"
     misc_feature    complement(order(385377..385382,385464..385466,
                     385545..385547,385551..385553))
                     /locus_tag="Sfla_0332"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(385380..385382,385464..385466,
                     385545..385547,385551..385553))
                     /locus_tag="Sfla_0332"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            385772..386659
                     /locus_tag="Sfla_0333"
                     /db_xref="GeneID:11369979"
     CDS             385772..386659
                     /locus_tag="Sfla_0333"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: sma:SAV_7197 ribitol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004921316.1"
                     /db_xref="GI:357409580"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11369979"
                     /translation="MPDAERPQDPTQLHPRPEFPQQEQEHPGRTGPMDPPPDHGEDSY
                     RGHELLLDRKAVVTGGDSGIGRAVALAFAREGADVLLTFLPEEESEAEETARLVEQAG
                     RRAVPVECDIREEGACLALVERAVSEFGRIDVLVNNAAYQMSQPDGIAAISTAQFDRV
                     VRTNLYGMFWLCKAALPHIPSGGSIINTTSVQAYKPSPHLLDYAMTKGAIVTFTQGLA
                     QMLASDGIRVNAVAPGPVWTPLIPATMPDTTEFGKQSPLGRPAQPAEMAPAYVFLASS
                     NASFITGEIMNATGGTPLP"
     misc_feature    385772..386656
                     /locus_tag="Sfla_0333"
                     /note="oxidoreductase; Provisional; Region: PRK06128"
                     /db_xref="CDD:180413"
     misc_feature    385850..386656
                     /locus_tag="Sfla_0333"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(385946..385948,385952..385957,385961..385963,
                     386018..386026,386183..386191,386333..386341,
                     386378..386380,386390..386392,386468..386479)
                     /locus_tag="Sfla_0333"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(386261..386263,386339..386341,386378..386380,
                     386390..386392)
                     /locus_tag="Sfla_0333"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            386699..388186
                     /locus_tag="Sfla_0334"
                     /db_xref="GeneID:11369980"
     CDS             386699..388186
                     /locus_tag="Sfla_0334"
                     /inference="protein motif:PFAM:PF01276"
                     /note="PFAM: Orn/Lys/Arg decarboxylase major region;
                     Orn/Lys/Arg decarboxylase domain protein;
                     KEGG: sco:SCO7311 amino acid decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Orn/Lys/Arg decarboxylase major region"
                     /protein_id="YP_004921317.1"
                     /db_xref="GI:357409581"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000310"
                     /db_xref="InterPro:IPR008286"
                     /db_xref="GeneID:11369980"
                     /translation="MRADHREAPVLDALAAYKGKGELAFTPPGHKQARGADPAVRAVL
                     GDAVFFGDLLAIGGLDDRRQTSGALRRAEALMAEAVHAEHTFFSTCGSSLSVKAAMLS
                     VAAPGRKLLMGRDAHKSVVAGLILCGVDPVWVEPQWDTERHLAHPPSAEAYERAFDQH
                     PDACGALVTSPTPYGSAADLCAIAEVCHRRSRPLVVDEAWGAHLPFHPDLPSWAMDAG
                     ADVCVTSIHKMGSGLEQGSVFHLQGDLVDHDTLASRADLLGTTSPSVLLYAGIDGWRR
                     QMVMEGHTLLSGALDLAAEVRQRIEEIDGMHVNGSEGFCGPGKAAEFDPLPVIIDVSD
                     LGTSGYRAADWLRAHHHLDMHIVDHRRISAQFTHADDRKTADRLLDALRDLSGRAPGL
                     GPGPEVMVPGPDELRPDQACAPRDAYFAATEDIPAERAAGRVAAEMMTPYPPGIPAVL
                     PGERLTEPLLRYLRTGVAAGMNVPDAADPTLRTVRVCKEGEGTEA"
     misc_feature    386723..388165
                     /locus_tag="Sfla_0334"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    386723..387604
                     /locus_tag="Sfla_0334"
                     /note="Ornithine decarboxylase family. This family belongs
                     to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). The major groups in
                     this CD corresponds to ornithine decarboxylase (ODC),
                     arginine decarboxylase (ADC) and lysine...; Region:
                     Orn_deC_like; cd00615"
                     /db_xref="CDD:99739"
     misc_feature    order(386852..386854,386864..386866,386888..386890,
                     386963..386971,386975..386980,386987..386989,
                     386999..387007,387011..387016,387047..387052,
                     387377..387382,387389..387403,387455..387460,
                     387464..387472,387476..387478,387497..387499,
                     387506..387508,387515..387517,387551..387556)
                     /locus_tag="Sfla_0334"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99739"
     misc_feature    order(386969..386977,387047..387049,387053..387055,
                     387203..387205,387287..387289,387293..387298,
                     387371..387373,387377..387382)
                     /locus_tag="Sfla_0334"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99739"
     misc_feature    387380..387382
                     /locus_tag="Sfla_0334"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99739"
     misc_feature    <387920..>388090
                     /locus_tag="Sfla_0334"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            388262..388633
                     /locus_tag="Sfla_0335"
                     /db_xref="GeneID:11369981"
     CDS             388262..388633
                     /locus_tag="Sfla_0335"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: sma:SAV_5024 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004921318.1"
                     /db_xref="GI:357409582"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:11369981"
                     /translation="MPVATYGLVALDCPDPRSLAEFYRGVLGGEVRNDYPDWYDLYAP
                     GGARIAFQKAPDHRPPEWPRGDRNSQQEHLDLDVTDIERAQQEVLTLGATPLDLDDRG
                     GERPFRVYADPAGHPFCLCWH"
     misc_feature    388286..388621
                     /locus_tag="Sfla_0335"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(388295..388297,388376..388378,388409..388411,
                     388415..388417,388478..388480,388583..388585,
                     388610..388612,388616..388618)
                     /locus_tag="Sfla_0335"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            388752..389288
                     /locus_tag="Sfla_0336"
                     /db_xref="GeneID:11369982"
     CDS             388752..389288
                     /locus_tag="Sfla_0336"
                     /inference="protein motif:PFAM:PF00857"
                     /note="PFAM: isochorismatase hydrolase;
                     KEGG: sco:SCO7455 isochorismatase"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_004921319.1"
                     /db_xref="GI:357409583"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="GeneID:11369982"
                     /translation="MSRSALVVIDMLNTYSHPDAEILIPSVREALPHIVGLIERARAD
                     GVPVIYANDNFGEWRSHHGEIIEATLAGPHRDLVEPLLPDGDSLFVVKARHSIFYETP
                     LTYLLSQLDVSRVVLCGQVTEQCVLYSALDAHIRHLAVTVADDAVAHIHQDLARAALR
                     MMERNMDASIRKASAVDF"
     misc_feature    388764..389240
                     /locus_tag="Sfla_0336"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cd00431"
                     /db_xref="CDD:238245"
     misc_feature    order(388779..388781,389025..389027,389124..389126)
                     /locus_tag="Sfla_0336"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    389109..389114
                     /locus_tag="Sfla_0336"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            complement(389315..390025)
                     /locus_tag="Sfla_0337"
                     /db_xref="GeneID:11369983"
     CDS             complement(389315..390025)
                     /locus_tag="Sfla_0337"
                     /inference="protein motif:PFAM:PF04029"
                     /note="PFAM: 2-phosphosulfolactate phosphatase;
                     KEGG: sco:SCO7611 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="2-phosphosulfolactate phosphatase"
                     /protein_id="YP_004921320.1"
                     /db_xref="GI:357409584"
                     /db_xref="GO:0000287"
                     /db_xref="GO:0050532"
                     /db_xref="InterPro:IPR005238"
                     /db_xref="GeneID:11369983"
                     /translation="MTRMDSRFVGIAELAETPSVAVVVDVMRAFTVAAWAFARGAEKI
                     VLAGSLDEALALKARHPDRLALKDGASAPGFDLVNSPGLLRSVDLGGRTVVQKTTAGT
                     VGALAVEDASLVLCAGFVVAEATARVLRARECDEVTFVVTGEDGQADEDLACAQYIAR
                     RAAGEGRDTAEFLRRAAGSRAAAELAEGVRQGVHPDDVALCLELDRFPFAMVAASEDS
                     HMVLRPCTVPRPPDEGAV"
     misc_feature    complement(389390..389980)
                     /locus_tag="Sfla_0337"
                     /note="2-phosphosulpholactate phosphatase; Region:
                     2-ph_phosp; cl00895"
                     /db_xref="CDD:260686"
     gene            390163..390771
                     /locus_tag="Sfla_0338"
                     /db_xref="GeneID:11369984"
     CDS             390163..390771
                     /locus_tag="Sfla_0338"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: nda:Ndas_1896 transcriptional regulator, TetR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein TetR"
                     /protein_id="YP_004921321.1"
                     /db_xref="GI:357409585"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:11369984"
                     /translation="MTGPVQAAPQPRKRQGAARRKLLDAAARRFYADGVSATGIDTIT
                     AEAGVAKMSLYNNFSSKADLVLAYLDARHEEWLDLYRCRMESARDGRDGVLAVFDAYA
                     DHARFAYERGFRGCGLLNAAAELPAGDEGRAVVRRHKEHVEALLSAHVAQLLAGRPEE
                     VGPVAEHLSFLLEGAMARAGLEGSAARVEHARTMASDLLERL"
     misc_feature    390178..390768
                     /locus_tag="Sfla_0338"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    390226..390363
                     /locus_tag="Sfla_0338"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            390768..391814
                     /locus_tag="Sfla_0339"
                     /db_xref="GeneID:11369985"
     CDS             390768..391814
                     /locus_tag="Sfla_0339"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: ach:Achl_0475 protein of unknown function DUF6
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921322.1"
                     /db_xref="GI:357409586"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:11369985"
                     /translation="MTGTAGRGAAPVGAASACVLLASVLWGTTGTAATLAPDVGPLAI
                     GAVAMGLGGLLQAVVAAPRIRREAPLLRAERGVVLLGALAVAAYPPAFYSSMHLAGVA
                     TGTVVSIGSAPLASALIERVVDGRRLTRRWITGAVLGLSGTVLLCAAEATAGASSGPG
                     ARSAGSTVLGVALGLTAGLTYAVYSWAAHRLIGRGLTSGAAMGTVFGIGGLLLVPVLA
                     ATGAPLLDSWSAAAVGAYMALVPMFLGYVLFGWGLARVRASTATTLTLLEPAVAAVLA
                     VLVVGERLRPAGWVGVALIVCCLGVLTVPFPGTAGRRAATTPPRPLPALEEDADVSVP
                     HRAPAGEHVRAVGH"
     misc_feature    390837..391205
                     /locus_tag="Sfla_0339"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    390843..391655
                     /locus_tag="Sfla_0339"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    391320..391658
                     /locus_tag="Sfla_0339"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(391832..392599)
                     /locus_tag="Sfla_0340"
                     /db_xref="GeneID:11369986"
     CDS             complement(391832..392599)
                     /locus_tag="Sfla_0340"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="KEGG: sma:SAV_898 ECF subfamily RNA polymerase
                     sigma factor;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
                     type 2"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_004921323.1"
                     /db_xref="GI:357409587"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0016987"
                     /db_xref="InterPro:IPR000838"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:11369986"
                     /translation="MTHVQDPSAGGTPAPTQPTRASDATVTRYTAASDAAATRLALAA
                     RDGDPVKADRFVRALHSDVWRYVAHLSGETQAADDLTQDVFLRALTGLPGFEGRSSAR
                     TWLLSIARRTVADSFRRAAARPRLADRDDWQRAAEQAQPCGTPGFDEGVALAELLSSI
                     QADRREAFVLTQLLGIPYKEAATVIGCPVGTVRSRVARARITLMELLTDGPPTPDDLT
                     SDPASTGTQRPVRPLPVARISSQPEQRPAPDMLEIPG"
     misc_feature    complement(391988..392512)
                     /locus_tag="Sfla_0340"
                     /note="RNA polymerase sigma factor SigC; Reviewed; Region:
                     PRK09649"
                     /db_xref="CDD:137458"
     misc_feature    complement(392249..392437)
                     /locus_tag="Sfla_0340"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(392000..392149)
                     /locus_tag="Sfla_0340"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(392000..392002,392006..392011,
                     392015..392023,392027..392032,392036..392038,
                     392066..392071,392087..392089,392117..392119))
                     /locus_tag="Sfla_0340"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(392817..393617)
                     /locus_tag="Sfla_0341"
                     /db_xref="GeneID:11369987"
     CDS             complement(392817..393617)
                     /locus_tag="Sfla_0341"
                     /inference="similar to AA sequence:KEGG:SCAB_41561"
                     /note="KEGG: scb:SCAB_41561  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921324.1"
                     /db_xref="GI:357409588"
                     /db_xref="GeneID:11369987"
                     /translation="MKPGRYSRAVRAVLFATVCVPLAATGHVLMSGTPVSGPVIFAAL
                     GGTAAAAWALAGRERGLLAVTAAAVAAQAALHQGFAFAQSLSAQPPPLPTQSFARQWA
                     ERLLCGDGATVLSERDAVAVVTDAGLGSVISRPPPGTFAPAVGPAGHGLHAMHGMPTD
                     AAGTVQAAHGGQGMVAAAPTGMLAAHLLAAVLCGLWLAYGERALFRVLRALAWRLRTP
                     LHLLLRLAAPPERPSPRVRWRRTPQSLTRLLLVHSITSRGPPRGTTVA"
     gene            complement(393763..394296)
                     /locus_tag="Sfla_0342"
                     /db_xref="GeneID:11369988"
     CDS             complement(393763..394296)
                     /locus_tag="Sfla_0342"
                     /inference="similar to AA sequence:KEGG:ROP_29820"
                     /note="KEGG: rop:ROP_29820 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921325.1"
                     /db_xref="GI:357409589"
                     /db_xref="GeneID:11369988"
                     /translation="MPTDSDRIELSDNELREIAGYAADCARTVLPIYEGGLPADTRPR
                     DAVDAARTFAEGGPRTNRLRQSAWAAYKAAAGAESPGAADAARSASHAAAAAFLHPKA
                     SAHQVKHVLGAAAHALRARELAATEGRPGVAESLDRVRRDAPAAVTAVLGRLPGAPSG
                     GGRVGEIIRELDALLRD"
     gene            complement(394430..395842)
                     /locus_tag="Sfla_0343"
                     /db_xref="GeneID:11369989"
     CDS             complement(394430..395842)
                     /locus_tag="Sfla_0343"
                     /inference="similar to AA sequence:KEGG:SAV_7350"
                     /note="KEGG: sma:SAV_7350 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921326.1"
                     /db_xref="GI:357409590"
                     /db_xref="GeneID:11369989"
                     /translation="MSVEPAVRTPGDPQEGGRPDPPGTRSVWAPLRPLVRRLHFYAGV
                     LIAPFLLVAATTGLLYAASYQVEKIVYAEELRVPVGGSELPVSRQVTAAREAHPEGEV
                     AAVRPSPEDGATTRVLLSGVPGVDPDHTLAVFVDPYTGGVTGALEQYGSTGALPLRTW
                     IDELHRDLQLGQPGRLYSELAASWLWVTAGGGVVLWFGRRRARRRIRGATGRRRALSL
                     HGTVGVWAAAGLFFVSATGLTWSTYAGQNVTELREAVGQTTPALDAGSSSGGEHAEHM
                     GAGAPAGAPGEDIGLDAALSTARAERLSNPVEIVPPADSSGYVVRQIQRSWPEKQDAV
                     AIDPATGEVTDVVRFADYPVLAKLTRWGIDAHTGVLFGLLNQLVLVALCSGLILLIVL
                     GYRMWWQRGRGSAFGRPLPRGAWQKVPPQVLVPLMAAVAVLGYFVPLLGIPLAAFLAL
                     DIVLGEYAYRRGRRSYATAD"
     misc_feature    complement(395663..395752)
                     /locus_tag="Sfla_0343"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_1;
                     pfam13172"
                     /db_xref="CDD:257540"
     misc_feature    complement(394481..395749)
                     /locus_tag="Sfla_0343"
                     /note="Uncharacterized iron-regulated membrane protein
                     [Function unknown]; Region: PiuB; COG3182"
                     /db_xref="CDD:225723"
     misc_feature    complement(395123..395365)
                     /locus_tag="Sfla_0343"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_2;
                     pfam13703"
                     /db_xref="CDD:258001"
     gene            complement(395973..397145)
                     /locus_tag="Sfla_0344"
                     /db_xref="GeneID:11369990"
     CDS             complement(395973..397145)
                     /locus_tag="Sfla_0344"
                     /inference="protein motif:PFAM:PF06441"
                     /note="PFAM: Epoxide hydrolase domain protein; alpha/beta
                     hydrolase fold;
                     KEGG: nml:Namu_2381 epoxide hydrolase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="epoxide hydrolase"
                     /protein_id="YP_004921327.1"
                     /db_xref="GI:357409591"
                     /db_xref="GO:0004301"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR010497"
                     /db_xref="InterPro:IPR016292"
                     /db_xref="GeneID:11369990"
                     /translation="MPDPLPRPEPFIQQAAPAVLEDLRTRLRATRWPDAPEDAGWSLG
                     TDLDYLRELVDHWAESFDWPAQEAALARLPRFRVPVGGLGIHFVHARAVDPVGPVLPL
                     VLSHGWPDSFWRYSKVVPLLTDPGAHGGDPADAFDVVVPDMPGFGYSDRPTGRPLDSI
                     DVAGLWAELMTVLGYEKFGAAGGDVGSHVSRYLGLDHPDRVVAVHRTDGGLPVFTGDP
                     AELSPEERSWIDGTTAWGASEGAYAAIHRTKPQTAAFGLSDSPAGLASWIVEKLRSWS
                     ACGGDIERSFTKDEILTNVTLYWVTETIGSSMRMYRANAAIPPAQHARRVEVPSGFSL
                     FSGDVVRPPRQWLERTTNMVRLTEPARGGHFAAFEEPELYAEEIRAFFRPYRAAAG"
     misc_feature    complement(396789..397121)
                     /locus_tag="Sfla_0344"
                     /note="Epoxide hydrolase N terminus; Region: EHN;
                     pfam06441"
                     /db_xref="CDD:253733"
     misc_feature    complement(395997..396884)
                     /locus_tag="Sfla_0344"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            397284..398498
                     /locus_tag="Sfla_0345"
                     /db_xref="GeneID:11369991"
     CDS             397284..398498
                     /locus_tag="Sfla_0345"
                     /inference="protein motif:SMART:SM00155"
                     /note="SMART: phospholipase D/Transphosphatidylase;
                     KEGG: sgr:SGR_4175  phospholipase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D/transphosphatidylase"
                     /protein_id="YP_004921328.1"
                     /db_xref="GI:357409592"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="GeneID:11369991"
                     /translation="MSSHIDQQIEHSRPDDASLYADRAQRLRRRLERLIGIAATEGNK
                     LVPLRNGDQIFSSMLESIRAAEHTVDMMTFVYWRGEIACDFAEALSERARAGVRVRLL
                     LDGFGSRLIEKDQLAMMEEAGVEVAWFRKPLYLSPLKQNHRCHRKVLITDEETAFTGG
                     VGIAEEWCGDARDETEWRDTHVRVRGPAVDGLAAAFAQNWAECHDELFTDRDRFVDAT
                     QHGDAVVQVVRGSAGFGWQDMQTLLRVVLESAEERIRLTTAYFAPDAYFVELLCAAAR
                     RGVSVEILLPGPYTDKRVCQLAGQNFYEDLTACGVKIYQYQPTMLHTKVLTVDGVASL
                     IGSTNFNRRSLEHDEEVMLAVLDRDFTVTLDGHFEEDVKKSTLIDGARWKRRSPVQRL
                     REVAVLPIRRFL"
     misc_feature    397296..398459
                     /locus_tag="Sfla_0345"
                     /note="Phosphatidylserine/phosphatidylglycerophosphate/car
                     diolipin synthases and related enzymes [Lipid metabolism];
                     Region: Cls; COG1502"
                     /db_xref="CDD:224419"
     misc_feature    397431..397886
                     /locus_tag="Sfla_0345"
                     /note="Catalytic domain, repeat 1, of bacterial
                     cardiolipin synthase and similar proteins; Region:
                     PLDc_CLS_1; cd09110"
                     /db_xref="CDD:197209"
     misc_feature    order(397716..397718,397722..397724,397761..397763,
                     397767..397769,397818..397820)
                     /locus_tag="Sfla_0345"
                     /note="putative active site [active]"
                     /db_xref="CDD:197209"
     misc_feature    397716..397718
                     /locus_tag="Sfla_0345"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197209"
     misc_feature    397965..398465
                     /locus_tag="Sfla_0345"
                     /note="Catalytic domain, repeat 2, of Escherichia coli
                     cardiolipin synthase ybhO and similar proteins; Region:
                     PLDc_ybhO_like_2; cd09159"
                     /db_xref="CDD:197256"
     misc_feature    order(398247..398249,398253..398255,398292..398294,
                     398298..398300,398331..398333)
                     /locus_tag="Sfla_0345"
                     /note="putative active site [active]"
                     /db_xref="CDD:197256"
     misc_feature    398247..398249
                     /locus_tag="Sfla_0345"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197256"
     gene            398640..399068
                     /locus_tag="Sfla_0346"
                     /db_xref="GeneID:11369992"
     CDS             398640..399068
                     /locus_tag="Sfla_0346"
                     /inference="similar to AA sequence:KEGG:SGR_4176"
                     /note="KEGG: sgr:SGR_4176 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921329.1"
                     /db_xref="GI:357409593"
                     /db_xref="GeneID:11369992"
                     /translation="MSESVETRLEATPVVTEPVPDLQLQLLIQLLDREQRSSLPITLA
                     LAGGVLHGDVIGHEAWKADWARSLRQVEGEGANLIAEFPETVDQGIRELGGGDVSSQL
                     PRWIHLRDATLMSGGAGALRLPLWRGRLADVSGWALGRPQ"
     gene            complement(399141..400112)
                     /locus_tag="Sfla_0347"
                     /db_xref="GeneID:11369993"
     CDS             complement(399141..400112)
                     /locus_tag="Sfla_0347"
                     /inference="protein motif:PFAM:PF00376"
                     /note="KEGG: sgr:SGR_6915 MerR family transcriptional
                     regulator;
                     PFAM: regulatory protein MerR; Transcription regulator
                     MerR DNA binding;
                     SMART: regulatory protein MerR"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004921330.1"
                     /db_xref="GI:357409594"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR015358"
                     /db_xref="GeneID:11369993"
                     /translation="MFSSDDGLCGIGELAERARVSVKTVRFYSDNGLLPEASRSAGGH
                     RRYGPDSLERLRMIRSLRTLDLPVPTVRRILDEGDTPGRAGGALEDAVAGQLRVLGSQ
                     LTAMRWREAALRSVQECPTAERPGRLALIGALTTPPDTAPLARFWRAWLPARMPAHAV
                     TAFLEAAVPQPPADPEPVQVIAFAGLCALVSRPCEGNEVTQPHAHEAAGARESAVLYA
                     GLAEAYDLAGAEMRRGREPYAGDALDGFVDAYASVHRTADTGAFRSGLALRLAADPRI
                     DRYWELTSELVGRPSGRPEPTPGSAHDWLLAALDAQLAKEPPVRHAP"
     misc_feature    complement(399756..400082)
                     /locus_tag="Sfla_0347"
                     /note="Cd(II)/Pb(II)-responsive transcriptional regulator;
                     Region: CadR-PbrR; TIGR02047"
                     /db_xref="CDD:131102"
     misc_feature    complement(399756..400082)
                     /locus_tag="Sfla_0347"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    complement(order(399978..399986,400035..400037,
                     400077..400082))
                     /locus_tag="Sfla_0347"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            400205..401722
                     /locus_tag="Sfla_0348"
                     /db_xref="GeneID:11369994"
     CDS             400205..401722
                     /locus_tag="Sfla_0348"
                     /inference="similar to AA sequence:KEGG:SGR_6916"
                     /note="KEGG: sgr:SGR_6916 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921331.1"
                     /db_xref="GI:357409595"
                     /db_xref="GeneID:11369994"
                     /translation="MTVFILVSGVFTGPHVWDDTASRLTAAGAEVRAVALSGLGGGHP
                     ADGGDIDLETHIADVLRVVDRTVGPDGREVVLVGHDYGIHPVLGAADRRAGSVARVVY
                     LDSGLPQDGVPALAAVADQGMREEVLRLAGGGAHGAGAALPPPARDAWHLWGSTAGIP
                     DAALDRLTALASPQPLGTLLLPLELTGAAASVPMAGVLCTGGGASIAMVQARVDFGEP
                     ALQALTDPRVTFFELPTGHWPMLSDPDALAVTLLRAAAGKGHRLTPAGAVRPEPFLLD
                     VPELPRERTGTIDLYLPPSAGGPRPALLFVHGGPVPPDARPTPRDWPVLTGYARYAAD
                     HGVVGVTLDHRLHAVTDYAVAADDLADAVERVRADPRVDADRVALWFFSGAGPLTADW
                     LGKPPPWLRCLAADYPVMAPLPSWGRLADRFQPVDAVAHAGSLPLVLVRAGLESDGIA
                     ATVERFLGAARACGAAVEVIDVPNGHHSFETVDRTDESREAVHRAMGAVLRHLTA"
     misc_feature    400214..400948
                     /locus_tag="Sfla_0348"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            401876..403141
                     /locus_tag="Sfla_0349"
                     /db_xref="GeneID:11369995"
     CDS             401876..403141
                     /locus_tag="Sfla_0349"
                     /inference="protein motif:PFAM:PF01593"
                     /note="PFAM: amine oxidase;
                     KEGG: sco:SCO0192 oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="YP_004921332.1"
                     /db_xref="GI:357409596"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="GeneID:11369995"
                     /translation="MTNRQHPRPPDAVVVGAGLAGLACALDLIRAGLRVELLEASDGV
                     GGRMRTDRRDGFLLDRGFQVFNTSYPQVKRRLDLRALRLRPFTPGLVARTASGRVRLT
                     DPTRRPGDAGALLPGRVLPARDLAALAALTARDVLLPAKRVGRMTDRTAAEALVRAGL
                     SPLAIEDLLRPFLSGVFLEEGLETSARFLHLVWRSMARGTLCLPAHGIGAVPAQLAAG
                     LPEGALRLDSAVTGVTDSGVLLADGGERPGGAVVVATDSATAARLLPGLPVPDGRTVT
                     TYYHAADRSPLTEPTLVVDSGLAVLNSCVLTEVAPSYAPRGTALVSTSVLGSGPPGGE
                     RTVRARLAELYDADTSTWETVAAYTVEGALPAMRPPWPLSRTTRFAPGRYVCGDHRAT
                     GSVQGALASGSRAAREVLADRAAARTTGT"
     misc_feature    401915..402082
                     /locus_tag="Sfla_0349"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    401930..403105
                     /locus_tag="Sfla_0349"
                     /note="Flavin containing amine oxidoreductase; Region:
                     Amino_oxidase; pfam01593"
                     /db_xref="CDD:250729"
     gene            403138..404343
                     /locus_tag="Sfla_0350"
                     /db_xref="GeneID:11369996"
     CDS             403138..404343
                     /locus_tag="Sfla_0350"
                     /inference="protein motif:PFAM:PF05834"
                     /note="PFAM: Lycopene beta and epsilon cyclase;
                     KEGG: sco:SCO0191 lycopene cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="Lycopene beta and epsilon cyclase"
                     /protein_id="YP_004921333.1"
                     /db_xref="GI:357409597"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR008671"
                     /db_xref="GeneID:11369996"
                     /translation="MTGHPQERVDDAVVVGGGAAGLCLAHWLTRTGTGVTLVEAPDGP
                     LRPAERTWCYWEAGTGEFEEAVVASWRRLRVRGPDGAVVESDPAPLRYRMVRSGPFER
                     LVHARLAAAPAARVVRATAHEVRDAPYGAEVRCTAADGRPLVLRGRHVFDSRPVRDTP
                     PHRTLLLQHFRGWFVRTAVPRFDPGVADLMDFRVPQPGHGLAFGYVLPLAADRALVEY
                     TEFSRAPLPTAAYEASLRQYTGDVLGLGRFTVESAEQGVIPMTDARFPRRAGRAVFRI
                     GAAGGATRPATGYTFAAVQRQGRAVASALGRGRPDVPPPHGRRALAMDAVLLRALDTG
                     RVDGPRFFTDLFRRVPMERLLRFLDGGSTPWEEFGIGLRTPVGPMLRTAAELPFLVRR
                     ATGRSEESL"
     misc_feature    403186..404256
                     /locus_tag="Sfla_0350"
                     /note="lycopene cyclase family protein; Region:
                     carotene-cycl; TIGR01790"
                     /db_xref="CDD:130850"
     misc_feature    403201..404289
                     /locus_tag="Sfla_0350"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            404343..405077
                     /locus_tag="Sfla_0351"
                     /db_xref="GeneID:11369997"
     CDS             404343..405077
                     /locus_tag="Sfla_0351"
                     /inference="protein motif:PFAM:PF01209"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     KEGG: sco:SCO0190 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UbiE/COQ5 methyltransferase"
                     /protein_id="YP_004921334.1"
                     /db_xref="GI:357409598"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="GeneID:11369997"
                     /translation="MTLLRDHDLARAFDHASLTYDRLTALNPGYRSDLLRSAHRLRLP
                     RGGRGLRLLDLGCGTGASTRALLRAAPYARITAVDASAGMLERARAKRWPANVRFLHR
                     SAEELPTTDDDGSYDAVFAAYLFRNVAEPGEVLRAVRALLRPGGRLLAHEYSLSGSRV
                     HRAVWNTVCRGVIVPAGTLTGDRELYHHLWRSVLAFDTAPAFARRVARAGFPFVRTVP
                     VGGWQTGIVHAFLARNGADPVRTDAA"
     misc_feature    404493..404795
                     /locus_tag="Sfla_0351"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(404505..404525,404577..404582,404646..404654,
                     404706..404708)
                     /locus_tag="Sfla_0351"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            405140..406636
                     /locus_tag="Sfla_0352"
                     /db_xref="GeneID:11369998"
     CDS             405140..406636
                     /locus_tag="Sfla_0352"
                     /inference="protein motif:PFAM:PF01593"
                     /note="PFAM: amine oxidase;
                     KEGG: sgr:SGR_6826  beta-carotene desaturase/methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="YP_004921335.1"
                     /db_xref="GI:357409599"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="GeneID:11369998"
                     /translation="MPEPGRERFTGDAPSAAVIGGGVAGLAAATALAERGVRVTLYEQ
                     GESLGGRLAGWPVRLGDGSSATMSRGFHAFFRQYYNLRGLLRRTDPALSMLTSLPDYP
                     LLHRNGMADGFARVPRTPPWSALGFVALSPSFGLRDLAAMNPREALPLLDVRVPEVYE
                     RFDGVGAEDFLRRIGFPEAARHLAFEVFSRSFFADPRELSAAELLLMFHIYFLGSSEG
                     LLFDVPREPFPQALWEPLGGHLRGLGAQVRTGTPVHRVRPATGGDLTVETEGAVDRHQ
                     AVVLALDTQGLRHVVGASEQLGDASWRAGVESLRTAPPFLVSRLWLDRPVREDRPGFL
                     GTSGFDGLDNISVLDRWEGESARWAARTGGSVVELHAYAVDGGTEREKVQRRMLDRLN
                     EIYPETAAARIVDVRHEWRDDCPVFSVGGYRHRPAVRTPHPRVTLAGDMVRTGLPVAL
                     MERAATSGFLAANALLAGWGIRGQVLWTVPRAGRSRVLRTLAGRFAAP"
     misc_feature    405227..406537
                     /locus_tag="Sfla_0352"
                     /note="Flavin containing amine oxidoreductase; Region:
                     Amino_oxidase; pfam01593"
                     /db_xref="CDD:250729"
     gene            complement(406640..407647)
                     /locus_tag="Sfla_0353"
                     /db_xref="GeneID:11369999"
     CDS             complement(406640..407647)
                     /locus_tag="Sfla_0353"
                     /inference="protein motif:PFAM:PF00355"
                     /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain;
                     KEGG: sco:SCO0188 methylesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske (2Fe-2S) iron-sulfur domain-containing
                     protein"
                     /protein_id="YP_004921336.1"
                     /db_xref="GI:357409600"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="GeneID:11369999"
                     /translation="MNGPRARTMWTSPLRVRRVPRWDRQAPTWREAKPAVIAEALKRS
                     AARPSGNWYVVGASRELEARDRPYGRTIAGTEVVLWRTGDGELRAGPGECPHLGAPLR
                     EGRVACGTLLCRWHGLGLDGGPFVGWEPYPLHDDGVLVWVRLDRAGGETPLDRPVVPA
                     RPLPGAAVDAVYTAVGRCEPEDVVANRLDPWHGSWFHPYAFVGLRVAGTPEDGEDDAF
                     AVDVSFKVAGRLVVPVRAEFTAPGPRTVVMHITDGEGTGSVVETHATPLTAPGAAEPR
                     TAVVEAVVAASDRRGFALARAAAPVLRPLMRRTAGRLWRDDLAYAERRWSLRSTGRFP
                     G"
     misc_feature    complement(407222..407494)
                     /locus_tag="Sfla_0353"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(order(407288..407290,407294..407296,
                     407300..407305,407309..407311,407357..407362,
                     407366..407368))
                     /locus_tag="Sfla_0353"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    complement(order(407294..407296,407300..407302,
                     407309..407311,407357..407362,407366..407368))
                     /locus_tag="Sfla_0353"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            complement(407644..408630)
                     /locus_tag="Sfla_0354"
                     /db_xref="GeneID:11370000"
     CDS             complement(407644..408630)
                     /locus_tag="Sfla_0354"
                     /inference="protein motif:PRIAM:2.5.1.32"
                     /note="KEGG: sco:SCO0187 phytoene synthase;
                     PFAM: Squalene/phytoene synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene synthase"
                     /protein_id="YP_004921337.1"
                     /db_xref="GI:357409601"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="GeneID:11370000"
                     /translation="MSRRELDAAGISGPDLRDAYARCRKLNARHGRTYFLATRLLPVE
                     RRCAVHALYGFARWADDIVDDLDRGQSPEERDRLLRLLESDLVHGLRTGGGGQPVVRA
                     VADTAGRYAIDHGLFADFLASMRSDLTVTDYPTYADLRAYMHGSAAVIGLQMLPVLGT
                     VVPREEAAPHAAALGVAFQLTNFLRDVGEDLDRGRVYLPADLLAAHGVDRPLLEWSRR
                     TGRHDPRIRNAFVEADAVIRTVYREAEPGIAMLEPRVRPCIRTAFVLYRGILDAVAAD
                     DYRVVHRRSVVPRRRRAVVAAAGLARILGARVRTRTTAPEPGVVAGAEGSLR"
     misc_feature    complement(407797..408570)
                     /locus_tag="Sfla_0354"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-head; Region: Trans_IPPS_HH; cd00683"
                     /db_xref="CDD:173831"
     misc_feature    complement(408529..408543)
                     /locus_tag="Sfla_0354"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(407857..407862,408046..408048,
                     408061..408066,408073..408078,408097..408099,
                     408106..408108,408178..408180,408190..408192,
                     408205..408207,408439..408441,408451..408453,
                     408460..408462,408472..408474,408529..408531,
                     408535..408537))
                     /locus_tag="Sfla_0354"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(407845..407847,407857..407862,
                     408046..408048,408061..408063,408073..408078,
                     408097..408099,408169..408171,408181..408183,
                     408205..408207,408439..408441,408451..408453,
                     408472..408474,408529..408531))
                     /locus_tag="Sfla_0354"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    complement(order(408061..408075,408439..408453))
                     /locus_tag="Sfla_0354"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173831"
     misc_feature    complement(408439..408453)
                     /locus_tag="Sfla_0354"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173831"
     misc_feature    complement(408061..408075)
                     /locus_tag="Sfla_0354"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173831"
     gene            complement(408627..410165)
                     /locus_tag="Sfla_0355"
                     /db_xref="GeneID:11370001"
     CDS             complement(408627..410165)
                     /locus_tag="Sfla_0355"
                     /inference="protein motif:TFAM:TIGR02734"
                     /note="KEGG: sco:SCO0186 phytoene dehydrogenase (phytoene
                     desaturase) (hypothetical protein);
                     TIGRFAM: phytoene desaturase;
                     PFAM: amine oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene desaturase"
                     /protein_id="YP_004921338.1"
                     /db_xref="GI:357409602"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR008150"
                     /db_xref="InterPro:IPR014105"
                     /db_xref="GeneID:11370001"
                     /translation="MRTVPGATDHVVVVGAGLSGLAAALHLLGAGRRVTLVERDAGPG
                     GRAGRLELGGYRVDTGPTVLTMPHLADEAFAAVGDSLHRRVELIPLHPAYRARFADGT
                     GIDVHTDGDAMEAEVRSFAGDAEAAGYRRLRRWLERLYRAQMSRFIDTNFDSPFQLLH
                     PDLARLAALGGFGRLDPQIGRFLSDPRLRRVFSFQALYAGVAPARALAAYAVIAYMDT
                     VAGVWFPKGGMNALPRAMADAAADAGGEFRWSAEVEALERSGGRVRAVRLATGERIAC
                     DAVVLTPDLPVVHRLLGRAPRRPVPLRHAPSAVVLHAGTDRTWPELAHHTLSFGAAWE
                     HTFDELTRTGRLMSDPSLLITRPTTHDPSLAPPGRHLHYVLAPCPNTTTGPSAGTWRG
                     GLGERYRDSLLAVLERRGLHGFASSLDRELLVTPADWTAQGHAAGTPFSVSHTFAQTG
                     PFRPRNLVRGYDNVVLAGCGTTPGVGVPTVLLSGKLAAARITGLARTTAARRRPPVLE
                     GQSR"
     misc_feature    complement(408651..410135)
                     /locus_tag="Sfla_0355"
                     /note="phytoene desaturase; Region: crtI_fam; TIGR02734"
                     /db_xref="CDD:233988"
     misc_feature    complement(408693..410135)
                     /locus_tag="Sfla_0355"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(410162..411340)
                     /locus_tag="Sfla_0356"
                     /db_xref="GeneID:11370002"
     CDS             complement(410162..411340)
                     /locus_tag="Sfla_0356"
                     /inference="protein motif:PFAM:PF00348"
                     /note="PFAM: Polyprenyl synthetase;
                     KEGG: sco:SCO0185 geranylgeranyl pyrophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="YP_004921339.1"
                     /db_xref="GI:357409603"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="GeneID:11370002"
                     /translation="MLGPGAMRAGTGGGAGPEPGTRGHRVPGTVGGTAAAVDAVLAEH
                     LRTRLGEARRTDAVFADEVASRVAAFVLQGGKRLRTAFVRCGWLAAGGSGDPGTPLRV
                     GAALELLQACALVHDDVMDESPVRRGAPAVHAQFARLHREGRMRGSATSYSATAAVLA
                     GDLALVWADDLLTETALSSPYGGHLHREWQAMRGEMVAGQYLDMRAQATGSSDETQAR
                     NIATLKSALYTVERPLALGACLAGAGAPVMDALRSAGRCAGLAFQLHDDLLGAFGDPA
                     VTGKPADEDLRTRKLTGLLAAALRLAGESGDTDALAVLGHQGPEPGGGTADRMRAALE
                     RTGARAAVEEEIARLSASSLRHFADTGADDRAQEEFAALVARAAGTAAPLPVPGGEGA
                     "
     misc_feature    complement(410465..411133)
                     /locus_tag="Sfla_0356"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410471..410473,410486..410488,
                     410501..410503,410531..410533,410540..410545,
                     410657..410659,410666..410671,410732..410734,
                     410741..410743,410960..410965,410978..410983,
                     410987..410995,410999..411007,411014..411016))
                     /locus_tag="Sfla_0356"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    complement(410978..411007)
                     /locus_tag="Sfla_0356"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410471..410473,410486..410488,
                     410501..410503,410531..410533,410540..410545,
                     410669..410671,410732..410734,410960..410965,
                     410978..410980,410987..410992))
                     /locus_tag="Sfla_0356"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410540..410545,410669..410671,
                     410960..410965,410978..410980,410987..410992))
                     /locus_tag="Sfla_0356"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410669..410671,410732..410734,
                     410960..410965,410978..410980,410987..410992))
                     /locus_tag="Sfla_0356"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410465..410479,410486..410503,
                     410519..410524,410930..410974))
                     /locus_tag="Sfla_0356"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(410471..410473,410486..410488,
                     410501..410503,410531..410533,410540..410545))
                     /locus_tag="Sfla_0356"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            complement(411503..411991)
                     /locus_tag="Sfla_0357"
                     /db_xref="GeneID:11370003"
     CDS             complement(411503..411991)
                     /locus_tag="Sfla_0357"
                     /inference="protein motif:TFAM:TIGR00778"
                     /note="KEGG: sma:SAV_1546 hypothetical protein;
                     TIGRFAM: alkylhydroperoxidase like protein, AhpD family;
                     PFAM: Carboxymuconolactone decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="YP_004921340.1"
                     /db_xref="GI:357409604"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR004675"
                     /db_xref="GeneID:11370003"
                     /translation="MNGTEADRAHKRVYVDKRSPKAYHALTATAEAVRAVAQEAGLER
                     TLVELVNLRVSQMNGCAYCLDVHTRAALREGETTRRLGVLAAWRDTEVFTTQERAALA
                     LAEATTHPADAALQEDAYATARRTLSEDEISAVIWVAVTINAFNRVSIMSKHPVRGVP
                     RQ"
     misc_feature    complement(411521..>411925)
                     /locus_tag="Sfla_0357"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2128"
                     /db_xref="CDD:225039"
     misc_feature    complement(411725..411874)
                     /locus_tag="Sfla_0357"
                     /note="alkylhydroperoxidase AhpD family core domain;
                     Region: ahpD_dom; TIGR00778"
                     /db_xref="CDD:213559"
     gene            412115..413092
                     /locus_tag="Sfla_0358"
                     /db_xref="GeneID:11370004"
     CDS             412115..413092
                     /locus_tag="Sfla_0358"
                     /inference="protein motif:PFAM:PF05726"
                     /note="PFAM: Pirin domain protein;
                     KEGG: sco:SCO0468 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="YP_004921341.1"
                     /db_xref="GI:357409605"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="GeneID:11370004"
                     /translation="MSGVDTDRVAPQTDPGPGVEVLTPRDVPLGGPRAMTVRRTLPQR
                     ARTLIGAWCFIDHYGPDDVAETGGMDVAPHPHIGLQTVSWLFSGEIEHRDSLGSHAFV
                     RPGELNLMTGGHGISHTEVSTPGTALLHGVQLWVALPDAHRHTGRDFRHHVPAPVHLD
                     GAVIRVFLGSLAGDTSPVPAFTPLLGAEIVLEPRTTTTLDIDPAFEHGLLVDQGSVRL
                     DGTLLRGAELGYTATGNRTMTLANETDVPARAVLVGGTPFEERIVMWWNFVGRTHEDI
                     VEARQDWEASSDRFGHVDGYPGARIPAPALPNATIAPRGNPTRPKGSTR"
     misc_feature    412202..412969
                     /locus_tag="Sfla_0358"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    412223..412522
                     /locus_tag="Sfla_0358"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    412673..412987
                     /locus_tag="Sfla_0358"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            413089..413427
                     /locus_tag="Sfla_0359"
                     /db_xref="GeneID:11370005"
     CDS             413089..413427
                     /locus_tag="Sfla_0359"
                     /inference="similar to AA sequence:KEGG:SCO7730"
                     /note="KEGG: sco:SCO7730 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921342.1"
                     /db_xref="GI:357409606"
                     /db_xref="GeneID:11370005"
                     /translation="MTQADAPLVRNVDARHRYEILAGEVTAGFTAYRDRDGQRVFFHT
                     EIDDAFAGQGLASVLVQEALSHVRDTGRRIVPVCPYVAKFLKKHEEFADITDPVTPEI
                     LQWLDTALAR"
     misc_feature    413137..413370
                     /locus_tag="Sfla_0359"
                     /note="GCN5-related N-acetyl-transferase; Region:
                     Acetyltransf_CG; pfam14542"
                     /db_xref="CDD:258682"
     gene            complement(413449..414987)
                     /locus_tag="Sfla_0360"
                     /db_xref="GeneID:11370006"
     CDS             complement(413449..414987)
                     /locus_tag="Sfla_0360"
                     /inference="protein motif:PRIAM:3.2.1.37"
                     /note="KEGG: sco:SCO0118 xylosidase/arabinosidase;
                     PFAM: glycoside hydrolase 43"
                     /codon_start=1
                     /transl_table=11
                     /product="xylan 1,4-beta-xylosidase"
                     /protein_id="YP_004921343.1"
                     /db_xref="GI:357409607"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="GeneID:11370006"
                     /translation="MAFFDNPVIPGFSPDPSMCRVGEDYYVATSSFEYVPGVPLWHSR
                     DLVHWRLIGHALDRPSQLTLPDDAPSSCGVYAPTLRYHDGRFWMITTVVAGAGNILVT
                     AEDPAGPWSEPVPVGIPGIDPDLAWDDEGNCWCVFSHDGIRGVRIDPETGELLGEPVE
                     MWSGSGLQYPEGPHLYRIGDWWYLLLSEGGTERGHAMSVARARSLPGPFEPHPDNPVL
                     SHRSTGHPVQNTGHGDLVRAHDDTWWMVLLGTRPRGDTPKFHGMGRETFLVPVRWEDE
                     WPLPGPLELRAEAPRLAPHAWPAEPHRDDFDAPALAPCWVSLRRQDPDAVRLGERPGH
                     LVLRARADGMDRPGALFVGRRQRDADCVARTRIDVGDEGRGGIAVRLDEAHHYQVEVE
                     GGTVRAVARIGPSRTTVAERRVPAGPLTLRVDVTTEDVLPPTVTVRPADPDAEAPSGL
                     RVGGPDTLRLGYETEDGHVEVLAELDGRYLTTEVAGGFTGRVIGMYATRGEAAFDWFE
                     LRPA"
     misc_feature    complement(413455..414972)
                     /locus_tag="Sfla_0360"
                     /note="Beta-xylosidase [Carbohydrate transport and
                     metabolism]; Region: XynB; COG3507"
                     /db_xref="CDD:226038"
     misc_feature    complement(414154..414972)
                     /locus_tag="Sfla_0360"
                     /note="Glycosyl hydrolase family 43, beta-D-xylosidase;
                     Region: GH43_XYL_1; cd09000"
                     /db_xref="CDD:185741"
     misc_feature    complement(order(414196..414198,414292..414294,
                     414415..414420,414475..414477,414622..414627,
                     414760..414765,414892..414894,414943..414945))
                     /locus_tag="Sfla_0360"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:185741"
     misc_feature    complement(order(414475..414477,414622..414624,
                     414943..414945))
                     /locus_tag="Sfla_0360"
                     /note="active site"
                     /db_xref="CDD:185741"
     gene            415447..417336
                     /locus_tag="Sfla_0361"
                     /db_xref="GeneID:11370007"
     CDS             415447..417336
                     /locus_tag="Sfla_0361"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: scb:SCAB_21631  ABC transporter;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004921344.1"
                     /db_xref="GI:357409608"
                     /db_xref="GO:0005524"
                     /db_xref="GO:0016887"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:11370007"
                     /translation="MTVTDSPAAGVETPPPPPPATITFEGKHGKNPLAEASFGALCMR
                     LPSILAHTARRAWAVDRTGSVLLLVCQLLTGTAAALVLAFTARAMTHLLATGPVSERL
                     HSALPALAVVATAAGFGRVSAALSSYADARITPLLTTEADLSLVSAVCRVEASAYGED
                     GFADRQEAAEVGVTRTRTMVQDAQRFMAALIRMVAATGVITALHWMMLPLLLLAVLPA
                     GLGAVLSARVDYETHYHNVGDRNVRSMMRWWATYSRYGDEVRANGMTGYLIHWYRALS
                     DRIDRRTLTAAPRMLRIVLATSALGGVFLLGTWAVLAWLAVSGRVALPVAATAVVAVQ
                     TALAALSQFVVHGAAMFHTSLYLADMRSFLDMADERAPKRGTATVPDRVDEIRLDEVV
                     HRYPGRDEPAVAGVSLTLRRGEILAVVGENGSGKSTLAKLITGILLADKGRVLWDGTD
                     LADADPEAVWRRTALVPQNFACWPLRARENVTLGQPRTYDDGPVWEAVDAVGMRETVE
                     KLPHGLDTLLARELWGGAELSGGQWQRLACARALYRRTPLLILDEPTSQMDPRGEHRI
                     FLEVRRIAAERMTVVVTHQLENTRLADRIVVMRAGRVVEQGTYEELAHAGGLFAELVA
                     LAQDR"
     misc_feature    415606..417327
                     /locus_tag="Sfla_0361"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    416602..417252
                     /locus_tag="Sfla_0361"
                     /note="ATP-binding cassette domain of multidrug resistance
                     protein-like transporters; Region: ABCC_MRP_Like; cd03228"
                     /db_xref="CDD:213195"
     misc_feature    416704..416727
                     /locus_tag="Sfla_0361"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213195"
     misc_feature    order(416713..416718,416722..416730,416848..416850,
                     417100..417105,417196..417198)
                     /locus_tag="Sfla_0361"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213195"
     misc_feature    416839..416850
                     /locus_tag="Sfla_0361"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213195"
     misc_feature    417028..417057
                     /locus_tag="Sfla_0361"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213195"
     misc_feature    417088..417105
                     /locus_tag="Sfla_0361"
                     /note="Walker B; other site"
                     /db_xref="CDD:213195"
     misc_feature    417112..417123
                     /locus_tag="Sfla_0361"
                     /note="D-loop; other site"
                     /db_xref="CDD:213195"
     misc_feature    417184..417204
                     /locus_tag="Sfla_0361"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213195"
     gene            417436..418332
                     /locus_tag="Sfla_0362"
                     /db_xref="GeneID:11370008"
     CDS             417436..418332
                     /locus_tag="Sfla_0362"
                     /inference="protein motif:PFAM:PF04794"
                     /note="PFAM: YdjC family protein;
                     KEGG: scb:SCAB_52761 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921345.1"
                     /db_xref="GI:357409609"
                     /db_xref="InterPro:IPR006879"
                     /db_xref="GeneID:11370008"
                     /translation="MDGIPVEHPDTAPPPWPNQVLGFPPGARLLLVNCDDFGMHPAIN
                     AAVVESIEEGIAASCSLMTVCPAAADAMRLLRRHSAIPFGVHLTLVCESSHLRWGPLS
                     PANTVPSLLDPSGTFFEPTPAGRAALLGRARTDEIETEFRAQIDAVADAGLSPTHLDF
                     HCLADGGRADILDLTVGLAAEYGLAVRVWLDPGRREMRRRGRPVVDHDFLDSFSLPTE
                     GKAEHYRRLLHDLPAGLSEWAVHPAAGRGAETLDGGRPVRRTDHAFLTSPEAREAVAR
                     EGVTVIDYRALQRVWARNTDRG"
     misc_feature    417517..418242
                     /locus_tag="Sfla_0362"
                     /note="Thermus thermophiles TTHB029 and similar proteins;
                     Region: YdjC_TTHB029_like; cd10802"
                     /db_xref="CDD:212113"
     misc_feature    order(417538..417549,417685..417693,417901..417918,
                     418156..418158,418207..418209)
                     /locus_tag="Sfla_0362"
                     /note="YdjC motif; other site"
                     /db_xref="CDD:212113"
     misc_feature    order(417538..417543,417547..417549,417685..417687,
                     417691..417693,417904..417906,417910..417912,
                     417916..417918,418156..418158,418207..418209)
                     /locus_tag="Sfla_0362"
                     /note="putative active site [active]"
                     /db_xref="CDD:212113"
     misc_feature    order(417538..417543,417691..417693,417916..417918)
                     /locus_tag="Sfla_0362"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212113"
     misc_feature    order(417556..417558,417622..417624,417631..417645,
                     417772..417777,417781..417783,417850..417852,
                     417874..417876,417883..417885)
                     /locus_tag="Sfla_0362"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212113"
     misc_binding    418406..418627
                     /note="Cobalamin riboswitch as predicted by Rfam
                     (RF00174), score 80.02"
                     /bound_moiety="adenosylcobalamin"
     gene            418786..421104
                     /locus_tag="Sfla_0363"
                     /db_xref="GeneID:11370009"
     CDS             418786..421104
                     /locus_tag="Sfla_0363"
                     /inference="protein motif:TFAM:TIGR01371"
                     /note="KEGG: sma:SAV_2046
                     5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase;
                     TIGRFAM:
                     5-methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase;
                     PFAM: Methionine synthase vitamin-B12 independent;
                     Cobalamin-independent synthase MetE domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="YP_004921346.1"
                     /db_xref="GI:357409610"
                     /db_xref="GO:0003871"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="GeneID:11370009"
                     /translation="MTTEHTTAATRSTVYGYPRQGQNRELKKAVEGYWKGRVTADALR
                     ATAAGLRRDTWRQLSEAGIDEVPTGDFSYYDHVLDTSVMVGAVPDRHREAVAADPLDG
                     YFAMARGTQDAAPLEMTKWFDTNYHYLVPELGPDTVFAANSAKQVAELDEAVALGLTA
                     RPVLVGPVTYLLLAKPAPGVAADFEPLTLLDRLLPVYAEVLADLRAAGAEWVQLDEPA
                     LVQDRTPADLDAVARAYTQLGGLADRPGLLVASYFDRLGDALPVLARTPIDGLALDFT
                     DAAAANLDDLAAAGGLPGRRLVAGVVDGRNIWINDYEKSLATLTTLLGLAGRVDVATS
                     CSLLHVPLDTAAEEEIDPEILRWLAFARQKTAEVATLARGLAEGTDAIAAEIAANRAD
                     LTSRADSPVTYDPAVQARADAVTDADGRRSQPYEVRAAAQRAHLGLPLLPTTTVGSFP
                     QTDELRAARADLRTGRTDSAGYDERIRKEIAEVISYQERTGIDVLVHGEPERNDMVQY
                     FAERLSGYLATRHGWVQSYGTRYVRPPVLAGDISRPEPMTVGWTTYAQSLTDRPVKGM
                     LTGPVTMLAWSFVRDDQPLGDTARQVALALRDEVDDLESAGISVIQVDEPALRETLPL
                     RAAGRPAYLAWATEAFRLSTSGVRPDTQIHTHMCYAEFGDIVQAIDDLDADVISLEAA
                     RSHMQVAHELADHGYPREAGPGVYDIHSPRVPSVRETASLLRTGLAAIPSERLWVNPD
                     CGLKTRGWPETRASLENLVAAARTVRDELSAH"
     misc_feature    418810..421098
                     /locus_tag="Sfla_0363"
                     /note="5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase; Provisional; Region: PRK05222"
                     /db_xref="CDD:235367"
     misc_feature    418816..419907
                     /locus_tag="Sfla_0363"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, N-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_N_terminal_like;
                     cd03312"
                     /db_xref="CDD:239428"
     misc_feature    order(418855..418857,418864..418866,419143..419145,
                     419158..419160,419164..419166)
                     /locus_tag="Sfla_0363"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239428"
     misc_feature    420109..421074
                     /locus_tag="Sfla_0363"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, C-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_C_terminal_like;
                     cd03311"
                     /db_xref="CDD:239427"
     misc_feature    order(420121..420129,420280..420282,420298..420300,
                     420619..420621,420625..420627,420751..420753,
                     420757..420759,421006..421011)
                     /locus_tag="Sfla_0363"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(420373..420381,420511..420513,420631..420633)
                     /locus_tag="Sfla_0363"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(420751..420753,420757..420759,420823..420825,
                     421006..421008)
                     /locus_tag="Sfla_0363"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            421438..422265
                     /locus_tag="Sfla_0364"
                     /db_xref="GeneID:11370010"
     CDS             421438..422265
                     /locus_tag="Sfla_0364"
                     /inference="protein motif:PRIAM:1.1.1.274"
                     /note="KEGG: gbr:Gbro_3547 2,5-didehydrogluconate
                     reductase;
                     PFAM: aldo/keto reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-didehydrogluconate reductase"
                     /protein_id="YP_004921347.1"
                     /db_xref="GI:357409611"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="GeneID:11370010"
                     /translation="MASVPAITLNNGVEIPQLGFGTFQIPPQETRETTLAALKAGYRH
                     IDTAQMYGNEKEVGEAVRDSGLDRGDVFVTSKLDNGAHAYDDALHAFEGTMEKIRLDY
                     LDLFLIHWPLPDRGDFVETWKALEEIYRSGRVKSIGVSNFQPHHLRRLLDGSVVVPAV
                     NQIEVHPYLTQDAVRSFGAEHGIATEAWSPIAQGKVLDDPTLVRIAERVGKSTAQVTL
                     RWHLQRGDIVFPKSVTRRRIEENFDLFDFELTEGDIGEINALNRDERTGLDPDRFNG"
     misc_feature    421456..422217
                     /locus_tag="Sfla_0364"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(421498..421506,421573..421575,421588..421590,
                     421663..421665,421762..421767,421855..421860,
                     421921..421923,421999..422016,422077..422079,
                     422122..422133,422146..422148,422155..422160)
                     /locus_tag="Sfla_0364"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(421573..421575,421588..421590,421663..421665,
                     421762..421764)
                     /locus_tag="Sfla_0364"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(422343..424691)
                     /locus_tag="Sfla_0365"
                     /db_xref="GeneID:11370011"
     CDS             complement(422343..424691)
                     /locus_tag="Sfla_0365"
                     /inference="protein motif:TFAM:TIGR01180"
                     /note="KEGG: sco:SCO0959 hypothetical protein;
                     TIGRFAM: alpha-1,2-mannosidase;
                     PFAM: glycosyl hydrolase 92"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-1,2-mannosidase"
                     /protein_id="YP_004921348.1"
                     /db_xref="GI:357409612"
                     /db_xref="InterPro:IPR005887"
                     /db_xref="InterPro:IPR012939"
                     /db_xref="GeneID:11370011"
                     /translation="MRWTQWIRGAGTAAAAAALLGGAVAAPASADGAGHAGRGRLTDL
                     VNPFIGTENEGNTYPGAAVPFGMVQFSPDTGHNTGYDYSETHIRGFSTVHISGVGCGL
                     GGDLPVLPTTGDITSTDNAVYAAGFSHDDEKAGPGTYQVGLDTGIKAELSATERTGVQ
                     RYTFPATDKANVLINAGQSLHRTVNTEVEILDDRTVRTAITGSGFCQDTKPYTVYTVT
                     RFDRPFTVSGTWKGETVTEGSTASSAGAERNGAFVRFDTSKDRTVEATTAISYVDAKG
                     AALNLRAEGGRSYDRVARAAQAAWEDRLDDVRAKGGSETLRRTFYSSLYRSFLAPNIG
                     SDVDGRYTGWDQRIHKAKGFTYYQNWSLWDTYRTQAQLLSLLAPHESRDMAISVIKID
                     EDSGWLPKWGYGTVETNIMTGDPVTPFLTNAYQQGLLKGYEEQAYRALRKNADGVPPA
                     DSAPVGREANKEYLADGFAPYIKGRAHVKPGDSDYDHGASATLEYALSDAMLGRMAKE
                     LGHDQDAARYAERAQNYRKIFDSSTGFFRARDANGDFTGPADPARSEGFHEGTSWQYQ
                     WLVPQDLPGMVSLIGGTDAANGRLDSFFAYEQLLQDPSKTAREVWVNGPYDYYNADKY
                     NPQNEPDLIAPYTYLSTGQPWKTTDVVHAALTLFTDTPIGMTGNDDLGTMSAWNVLSS
                     IGVFPVQPGTDTWGLSTPVFERVDLTLDRRYYPEGALTVKAPGTSDSARYIRSARTDG
                     AAYGKTYLTTEDIRRTRELSFEVGTMPSGWGTSADAAPPALK"
     misc_feature    complement(422349..424610)
                     /locus_tag="Sfla_0365"
                     /note="Putative alpha-1,2-mannosidase [Carbohydrate
                     transport and metabolism]; Region: COG3537"
                     /db_xref="CDD:226067"
     misc_feature    complement(422391..423956)
                     /locus_tag="Sfla_0365"
                     /note="Glycosyl hydrolase family 92; Region:
                     Glyco_hydro_92; pfam07971"
                     /db_xref="CDD:254554"
     gene            424888..426054
                     /locus_tag="Sfla_0366"
                     /db_xref="GeneID:11370012"
     CDS             424888..426054
                     /locus_tag="Sfla_0366"
                     /inference="protein motif:PFAM:PF07228"
                     /note="KEGG: scb:SCAB_49011  integral membrane protein;
                     PFAM: Stage II sporulation protein E;
                     SMART: protein phosphatase 2C domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ser/Thr phosphatase"
                     /protein_id="YP_004921349.1"
                     /db_xref="GI:357409613"
                     /db_xref="GO:0004721"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="GeneID:11370012"
                     /translation="MSPYRTTTGLTSHAPQNESELLPWWARIAPLALVVLALAVDLPT
                     PGAFSGDVFLILSSMIAACVYALRAVVRVAVLNSLAGLVLLFGKHLSSDGRHAVVDYI
                     AMVVLAWATVPLSRLRLSLRRRLQGAERVAESAQRAVLPPVRAWWGKTWIAVRYEAAS
                     AAASVGGDLYAAEHTPYGVRLLIGDVRGKGLNAIPGVAALVGSFHEAAHHTPTLPELA
                     RHLDEAVSRHTRETASVSGGSDVDGEHFITAAIAQIPDDGTEVRLISRGHCPAFLVSE
                     DALRVWEPEHAGLPLGLGELDTGPWQDESRPFGPGHLLLLCTDGLLEARDADGRFYTP
                     GEDLRQCWRDGPPAVVERLAGAVHTHTDGVLADDLALVAVTRVEHAPSGGKASP"
     misc_feature    425419..426015
                     /locus_tag="Sfla_0366"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     gene            complement(426092..426691)
                     /locus_tag="Sfla_0367"
                     /db_xref="GeneID:11370013"
     CDS             complement(426092..426691)
                     /locus_tag="Sfla_0367"
                     /inference="protein motif:PFAM:PF04203"
                     /note="PFAM: peptidase C60 sortase A and B;
                     KEGG: sgr:SGR_1090 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C60 sortase A and B"
                     /protein_id="YP_004921350.1"
                     /db_xref="GI:357409614"
                     /db_xref="InterPro:IPR005754"
                     /db_xref="GeneID:11370013"
                     /translation="MPFTPNSSWRTALSAAAAGLLITLAGCSAPDAPEPSTGAKASPA
                     ARDADVPKAPAPTRLSVPSLGIDSGLLRLGLNEDGTVEVPPAEKGMTAGWYAGGAVPG
                     EPGAAVLIGHNDTRFGKAVFHDLHSITKGADIAVAGGGGKETHFTVTGTETVRKDEFP
                     TDKVYGATGERVLRLITCDGEFDAAGHPVDNLIVYATLR"
     misc_feature    complement(426098..426532)
                     /locus_tag="Sfla_0367"
                     /note="Sortase E (SrtE) is a membrane transpeptidase found
                     in gram-positive bacteria that cleaves surface proteins at
                     a cell sorting motif and catalyzes a transpeptidation
                     reaction in which the surface protein substrate is
                     covalently linked to peptidoglycan for...; Region:
                     Sortase_E; cd05829"
                     /db_xref="CDD:99712"
     misc_feature    complement(order(426119..426121,426128..426130,
                     426158..426163,426356..426358,426362..426364,
                     426368..426370,426404..426406,426461..426463))
                     /locus_tag="Sfla_0367"
                     /note="active site"
                     /db_xref="CDD:99712"
     misc_feature    complement(order(426119..426121,426158..426160,
                     426356..426358))
                     /locus_tag="Sfla_0367"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:99712"
     gene            complement(426779..427165)
                     /locus_tag="Sfla_0368"
                     /db_xref="GeneID:11370014"
     CDS             complement(426779..427165)
                     /locus_tag="Sfla_0368"
                     /inference="similar to AA sequence:KEGG:SGR_1089"
                     /note="KEGG: sgr:SGR_1089 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921351.1"
                     /db_xref="GI:357409615"
                     /db_xref="GeneID:11370014"
                     /translation="MSLRPTLRTAVLAAATMGAVLFPSMAAVADSSPTAVPAERPTEP
                     PAASEPSRATPVPEPTDAAESATPAPAEPVPARTVPRGGVDAGERPAGEAGGTALHGS
                     AAGAVLLAGAGVLVMRRRTAAQRDHG"
     misc_feature    complement(<426884..>427138)
                     /locus_tag="Sfla_0368"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14950"
                     /db_xref="CDD:237864"
     gene            complement(427267..429288)
                     /locus_tag="Sfla_0369"
                     /db_xref="GeneID:11370015"
     CDS             complement(427267..429288)
                     /locus_tag="Sfla_0369"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: sgr:SGR_1088  two-component system sensor
                     kinase;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; histidine kinase HAMP region
                     domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; histidine kinase HAMP region
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_004921352.1"
                     /db_xref="GI:357409616"
                     /db_xref="GO:0000155"
                     /db_xref="GO:0004871"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:11370015"
                     /translation="MARRADKGGQRLRPPLRKSLLGRFLAVSALVAACSVAATAWLAV
                     QTTSGAIEQEQGRNLAADTRVLDTLLAYAARHPTWDGVGATVDELADASDRRITLTTQ
                     SRQILADSAGSSPPPPSLPPQASAVVDPLSVADVSSGSGSGAGSVTIAAPGTDGTQRP
                     GTDRVDPRAVGPFELSEAERTSLRRTADEAVQCLSRTGIASDVVEGPSGRPRIQVVGN
                     DPDRLDGSRCSTDALDRPTGTEAKALVALNELVNACLDRQGREAVELDLDLSWRTGEE
                     PLPATAVPVPTPAPSLSVPREAMPTEVATPAPLDSDNDRDIASCVGIARQEQLSSYVA
                     SPALLFISDPGGGEVPGFDLSPGNTAKITGVAALVLALTVGASVFAGVRLVRPLHALT
                     GAAQRMRDGEAPSQVVVAADNEIGRLATAFNDMSAHRARMEEQRKVMVSDVAHELRTP
                     LSNIRGWLEGAQDGVADADATFVSSLLEEAVQLQHIIDDLQDLSAADAGALRLHPEPV
                     RIGDLLAHVVAAHQAQADAAGVDLTVTVAEEHGAVPVVEADPVRLRQAIGNLVSNAVR
                     HTPAGGRVTLRAHATGPGGPDDEVLLEVADTGSGIAPEDLPYVFDRFWRAEKSRSRRT
                     GGSGLGLAIVRKLVEAHGGTAGVVSTVGRGSVFTLRLPCSGPDPMNTAA"
     misc_feature    complement(427285..428205)
                     /locus_tag="Sfla_0369"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(428005..428139)
                     /locus_tag="Sfla_0369"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(428005..428007,428014..428019,
                     428023..428028,428035..428040,428044..428049,
                     428095..428097,428101..428106,428113..428118,
                     428122..428127,428134..428139))
                     /locus_tag="Sfla_0369"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(427807..427992)
                     /locus_tag="Sfla_0369"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(427819..427821,427831..427833,
                     427840..427842,427852..427854,427861..427863,
                     427873..427875,427918..427920,427927..427929,
                     427939..427941,427948..427950,427960..427962,
                     427972..427974))
                     /locus_tag="Sfla_0369"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(427954..427956)
                     /locus_tag="Sfla_0369"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(427306..427632)
                     /locus_tag="Sfla_0369"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(427318..427320,427324..427329,
                     427342..427344,427348..427350,427396..427407,
                     427486..427491,427495..427497,427501..427503,
                     427507..427509,427591..427593,427600..427602,
                     427612..427614))
                     /locus_tag="Sfla_0369"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(427600..427602)
                     /locus_tag="Sfla_0369"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(427399..427401,427405..427407,
                     427489..427491,427495..427497))
                     /locus_tag="Sfla_0369"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(429269..430036)
                     /locus_tag="Sfla_0370"
                     /db_xref="GeneID:11370016"
     CDS             complement(429269..430036)
                     /locus_tag="Sfla_0370"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: sgr:SGR_1087  two-component system response
                     regulator;
                     PFAM: response regulator receiver; transcriptional
                     regulator domain-containing protein;
                     SMART: response regulator receiver; transcriptional
                     regulator domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix family two component
                     transcriptional regulator"
                     /protein_id="YP_004921353.1"
                     /db_xref="GI:357409617"
                     /db_xref="GO:0000156"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:11370016"
                     /translation="MAGGTRGSLTIVPVCANVIVAEDDAKQAELVRRYLEREGHAVTV
                     VSDGLSALEQARQGAPDLLVLDVMMPRADGLDVVRILRAEERELAVLMLTARATEDDL
                     LLGLDLGADDYMTKPYSPRELMARVRTLLRRTRRDGAREDGGQVLRVGTLAVDPVRHE
                     VSVDGVGVECTPGEFRLLATMAAEPERVFSREQLLAELHGFDRYISSRTVDVHIMNLR
                     KKIERAPRRPVRLLTVFGVGYKLMDPQKGATRGAARR"
     misc_feature    complement(429305..429988)
                     /locus_tag="Sfla_0370"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(429662..429982)
                     /locus_tag="Sfla_0370"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(429686..429691,429698..429700,
                     429755..429757,429815..429817,429839..429841,
                     429968..429973))
                     /locus_tag="Sfla_0370"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(429839..429841)
                     /locus_tag="Sfla_0370"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(429815..429823,429827..429832))
                     /locus_tag="Sfla_0370"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(429683..429691)
                     /locus_tag="Sfla_0370"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(429314..429598)
                     /locus_tag="Sfla_0370"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(429323..429325,429338..429340,
                     429374..429379,429401..429403,429410..429412,
                     429464..429469,429524..429526))
                     /locus_tag="Sfla_0370"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            430265..430543
                     /locus_tag="Sfla_0371"
                     /db_xref="GeneID:11370017"
     CDS             430265..430543
                     /locus_tag="Sfla_0371"
                     /inference="similar to AA sequence:KEGG:SCO0566"
                     /note="KEGG: sco:SCO0566 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921354.1"
                     /db_xref="GI:357409618"
                     /db_xref="GeneID:11370017"
                     /translation="MTRDAEWRTGPDGRAVLLVAGLADLAVTTAGSALGAVRGLLRRS
                     DTAELAAEAERDLIARGRLVLGRWSTAPPAHLEVLAREAVVRRAADDA"
     gene            430533..431588
                     /locus_tag="Sfla_0372"
                     /db_xref="GeneID:11370018"
     CDS             430533..431588
                     /locus_tag="Sfla_0372"
                     /inference="protein motif:PFAM:PF00348"
                     /note="PFAM: Polyprenyl synthetase;
                     KEGG: sgr:SGR_6931  polyprenyl synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="YP_004921355.1"
                     /db_xref="GI:357409619"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="GeneID:11370018"
                     /translation="MTHDRWDMAEFKERVDDVLRVFVAREAERFAAVDPVLDPVAGQL
                     ESSAAHGKRLRAAFCYWGWRATGQPDDESLVRAAASMELVHAAAVVHDDLIDDSPLRH
                     GLPTAHMALRGAARGRPRSVSAGRSLAMLVGDLLMGLAGQLFATSGLPAAYLARARPL
                     WSALARDLIAGECLEILRTGAAPDTADSLKVIRYKTAKYTVEQPLLIGGALAGAGERV
                     RSGYSAYGLPLGEAFQLRDDLVGLFGSPQDTGKAATDDLRGNRPTALLAETWRVADDG
                     ERRQLRALLGRGDPGPDGLRAARELMLRLDAPGRVEKMITERVEEALTALDALSLSTP
                     ATTALTTLAHSVAVRGA"
     misc_feature    430674..431384
                     /locus_tag="Sfla_0372"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    order(430782..430784,430791..430799,430803..430811,
                     430815..430820,430833..430838,431046..431048,
                     431055..431057,431115..431120,431127..431129,
                     431241..431246,431253..431255,431283..431285,
                     431298..431300,431313..431315)
                     /locus_tag="Sfla_0372"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    430791..430820
                     /locus_tag="Sfla_0372"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(430806..430811,430818..430820,430833..430838,
                     431055..431057,431115..431117,431241..431246,
                     431253..431255,431283..431285,431298..431300,
                     431313..431315)
                     /locus_tag="Sfla_0372"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(430806..430811,430818..430820,430833..430838,
                     431115..431117,431241..431246)
                     /locus_tag="Sfla_0372"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(430806..430811,430818..430820,430833..430838,
                     431055..431057,431115..431117)
                     /locus_tag="Sfla_0372"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(430824..430865,430905..430907,431262..431267,
                     431283..431300,431307..431321)
                     /locus_tag="Sfla_0372"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(431241..431246,431253..431255,431283..431285,
                     431298..431300,431313..431315)
                     /locus_tag="Sfla_0372"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            431715..432893
                     /locus_tag="Sfla_0373"
                     /db_xref="GeneID:11370019"
     CDS             431715..432893
                     /locus_tag="Sfla_0373"
                     /inference="similar to AA sequence:KEGG:SCO0564"
                     /note="KEGG: sco:SCO0564 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921356.1"
                     /db_xref="GI:357409620"
                     /db_xref="GeneID:11370019"
                     /translation="MRYTESSLDTMRRAGDELADATVATLFERGEVGKFNTLMRYVST
                     AGAPLPDGLPDVAREYLEVTGAPPAWVDWGEMERARLFFIDNNVHISTALSFASMPAC
                     YVVPHVAKLLSATHGLDYPSKRMAETGQFTVHLMQPDAFEAGGRFLPAAQKVRLLHAS
                     IRHHLEREGRWDTAALGTPICQEDMIGGQMFFSLLVLDSLHRLGVHMSEEGARSYYYA
                     WRVVGAMLGVDQDAVPGTLDEARHFLDLYMLRHMGPSPEGAHLTRQLIDLYEEVVPGT
                     FFDPVVSALVRHLVGDICGDWLGVPRTSWDTLVKAVPRLIGVLETVEDRSPLGAWALD
                     RLGHLTTVLELSSLTRGRVMHYAIPEHLKKDYGVAGSVPRTRRWVPPAPTVRGRAPGQ
                     "
     misc_feature    432030..432671
                     /locus_tag="Sfla_0373"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2236); Region: DUF2236; pfam09995"
                     /db_xref="CDD:255683"
     gene            complement(433050..434342)
                     /locus_tag="Sfla_0374"
                     /db_xref="GeneID:11370020"
     CDS             complement(433050..434342)
                     /locus_tag="Sfla_0374"
                     /inference="protein motif:PFAM:PF04143"
                     /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
                     KEGG: sco:SCO7517 integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921357.1"
                     /db_xref="GI:357409621"
                     /db_xref="InterPro:IPR007272"
                     /db_xref="GeneID:11370020"
                     /translation="MTTAPPAGPAAPPRALPALFAPSPTSAPRPEAPSLPPVRRTPLV
                     VSGLLAVALTVYVWSVHGAKPGVLLLLGLGLGVALFHSRFGFTSAWRQLIAVGNGTGL
                     RAHALLLGTTATLFALLIGSGTGLFGSQPAPSAGPIGVGLVVGSLLFAVGMQLGGACA
                     SGTLFAVGSGQTSVLLTLGGFIAGATLAAWQFDLWKDLPAWEPVVLSEHIGWAGSWAV
                     TIAALLLVVLVTRRVQARRNPPPLGPVPSARTAAVRALRGSWPLAAGALVLAVLGAGV
                     LAVSGGAWGVTSAFSLWGSELVGALGGHPENWTWWRQPGNAEMLAGPVLADKTSLTDI
                     GIMIGAAVAAALGGTWALHRGIPWRTAVASVLGGVLMGIGARLAGGCNIGAYLAGVAS
                     GSLSGWLWGAVALAGTWLGLRLRPLFGLGNPKPGDGVC"
     misc_feature    complement(433635..>434087)
                     /locus_tag="Sfla_0374"
                     /note="Sulphur transport; Region: Sulf_transp; cl19477"
                     /db_xref="CDD:267830"
     misc_feature    complement(<433101..433541)
                     /locus_tag="Sfla_0374"
                     /note="Sulphur transport; Region: Sulf_transp; cl19477"
                     /db_xref="CDD:267830"
     gene            434850..435737
                     /locus_tag="Sfla_0375"
                     /db_xref="GeneID:11370021"
     CDS             434850..435737
                     /locus_tag="Sfla_0375"
                     /inference="protein motif:PFAM:PF00106"
                     /note="KEGG: sma:SAV_1003 short chain dehydrogenase;
                     manually curated;
                     PFAM: short-chain dehydrogenase/reductase SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004921358.1"
                     /db_xref="GI:357409622"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11370021"
                     /translation="MSGSARPLQGRVAVVTGAARGVGAAMARELTRRGARVALLGREE
                     STLAQVRETLPGARCWEVDVTDDAGMGRVADEVRDRMGPASVVVANAGLAEGGPFAES
                     DPVTWRRVIEVNLIGSAISARAFLPHLRTTGGYYLQIASLASIGAAPMMSAYCASKAG
                     VESFAHSLRAEFAHEHVGVGIAYLNWTDTDMIRDADEHPVLRELRAHMPKPARKVYPV
                     ETVAESLARAVERRSASVYAPAWLRVTQLVRAAMPPVVTALSKREIPRLQRETSFEGT
                     GLLGAGGRADLGAGGRAGG"
     misc_feature    434853..435728
                     /locus_tag="Sfla_0375"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK05872"
                     /db_xref="CDD:235633"
     misc_feature    434886..435527
                     /locus_tag="Sfla_0375"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(434898..434900,434904..434915,434970..434978,
                     435033..435041,435117..435125,435186..435188,
                     435264..435272,435309..435311,435321..435323,
                     435399..435410,435414..435419)
                     /locus_tag="Sfla_0375"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(435189..435191,435270..435272,435309..435311,
                     435321..435323)
                     /locus_tag="Sfla_0375"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            435871..436509
                     /locus_tag="Sfla_0376"
                     /db_xref="GeneID:11370022"
     CDS             435871..436509
                     /locus_tag="Sfla_0376"
                     /inference="protein motif:PFAM:PF00210"
                     /note="PFAM: Ferritin Dps family protein;
                     KEGG: sco:SCO0596 DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="YP_004921359.1"
                     /db_xref="GI:357409623"
                     /db_xref="GO:0008199"
                     /db_xref="InterPro:IPR002177"
                     /db_xref="InterPro:IPR008331"
                     /db_xref="GeneID:11370022"
                     /translation="MPPQTSTPRYTVPGLSTKDGGRMIDVLRMRLHALNDLALTLKHI
                     HWNVTGPHFIAVHEMLDPQTLAVRDMADGTAERISALGGVPHGTAGVLVSERTWEDYS
                     VGRADAIAHLGALDLVYTGIIEDHRKAAAKAASLDPVTEDLLIEHLRSLEQFQWFVRA
                     HLENSAGVLATTDARSEKQAAAAAGTSRTIPAKQTASPRRTAKKSAVTKRGK"
     misc_feature    435940..436362
                     /locus_tag="Sfla_0376"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    435943..436356
                     /locus_tag="Sfla_0376"
                     /note="DPS protein, ferritin-like diiron-binding domain;
                     Region: DPS; cd01043"
                     /db_xref="CDD:153102"
     misc_feature    order(435982..435987,435997..435999,436003..436008,
                     436039..436041,436072..436074,436084..436086,
                     436093..436098)
                     /locus_tag="Sfla_0376"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(436003..436005,436039..436041,436051..436053,
                     436084..436086,436096..436098)
                     /locus_tag="Sfla_0376"
                     /note="DPS ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(436282..436284,436303..436308)
                     /locus_tag="Sfla_0376"
                     /note="ion pore; other site"
                     /db_xref="CDD:153102"
     gene            complement(436786..438144)
                     /locus_tag="Sfla_0377"
                     /db_xref="GeneID:11370023"
     CDS             complement(436786..438144)
                     /locus_tag="Sfla_0377"
                     /inference="protein motif:PFAM:PF00652"
                     /note="KEGG: sgr:SGR_6490  chitinase;
                     PFAM: Ricin B lectin;
                     SMART: Ricin B lectin"
                     /codon_start=1
                     /transl_table=11
                     /product="Ricin B lectin"
                     /protein_id="YP_004921360.1"
                     /db_xref="GI:357409624"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="GeneID:11370023"
                     /translation="MRGVLAALAVTATLLTGLSAAPASAAATATGPITGLAGKCVDVA
                     GGAVANGTAVQLYDCNGTAAQQWTVGADGTIRALGKCLDVASGGTADGTKVQLWDCNG
                     SAAQQWATPAARDIVNPQADKCLDVSGGSSANSTRLQIWTCTGAANQKWTAPSAGGET
                     PGPGAMAVAPYLYNGWGSPPSPTTVMNATGVKWFTLAFVLSNGYCNPQWDGNRPLTGG
                     VDQQTVNTVRAAGGDVIPSFGGWSGNKLESSCSSAGELAAAYQKVINAYGLKAIDIDI
                     EAAAYDSPVVQQRTVDALKTVKAANPGIKVYVTFGTGQNGPDSSLIGKAAASGLTVDS
                     WTIMPFNFGGAGQNMGTLTVRAAEGLKTAVQNAYGYSDDQAYRHTGISSMNGVTDNGE
                     TVTVADFRTILGYAQQRHLARLTFWSVNRDRPCTGGGADTCSGISQQPWDFTRVLASY
                     TG"
     misc_feature    complement(437689..438048)
                     /locus_tag="Sfla_0377"
                     /note="Ricin-type beta-trefoil; Carbohydrate-binding
                     domain formed from presumed gene triplication. The domain
                     is found in a variety of molecules serving diverse
                     functions such as enzymatic activity, inhibitory toxicity
                     and signal transduction. Highly specific...; Region:
                     RICIN; cd00161"
                     /db_xref="CDD:238092"
     misc_feature    complement(437692..438048)
                     /locus_tag="Sfla_0377"
                     /note="Ricin-type beta-trefoil lectin domain; Region:
                     Ricin_B_lectin; pfam00652"
                     /db_xref="CDD:250032"
     misc_feature    complement(order(437698..437700,437722..437724,
                     437728..437730,437767..437769,437827..437832,
                     437851..437853,437857..437859,437896..437898,
                     437950..437952,437974..437976,437980..437982,
                     438019..438021))
                     /locus_tag="Sfla_0377"
                     /note="putative sugar binding sites [chemical binding];
                     other site"
                     /db_xref="CDD:238092"
     misc_feature    complement(order(437692..437700,437821..437829,
                     437944..437952))
                     /locus_tag="Sfla_0377"
                     /note="Q-X-W motif; other site"
                     /db_xref="CDD:238092"
     misc_feature    complement(436801..437640)
                     /locus_tag="Sfla_0377"
                     /note="PF-ChiA is an uncharacterized chitinase found in
                     the hyperthermophilic archaeon Pyrococcus furiosus with a
                     glycosyl hydrolase family 18 (GH18) catalytic domain as
                     well as a cellulose-binding domain.  Members of this
                     domain family are found not only in...; Region:
                     GH18_PF-ChiA-like; cd06543"
                     /db_xref="CDD:119360"
     misc_feature    complement(order(436894..436896,436993..436995,
                     437122..437127,437314..437316,437320..437322,
                     437326..437328,437434..437436,437551..437553,
                     437632..437634))
                     /locus_tag="Sfla_0377"
                     /note="active site"
                     /db_xref="CDD:119360"
     gene            complement(438159..439439)
                     /locus_tag="Sfla_0378"
                     /db_xref="GeneID:11370024"
     CDS             complement(438159..439439)
                     /locus_tag="Sfla_0378"
                     /inference="protein motif:PFAM:PF00722"
                     /note="KEGG: sco:SCO0787  hydrolase;
                     PFAM: glycoside hydrolase 16; Ricin B lectin;
                     SMART: Ricin B lectin"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase 16"
                     /protein_id="YP_004921361.1"
                     /db_xref="GI:357409625"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="InterPro:IPR008263"
                     /db_xref="GeneID:11370024"
                     /translation="MRSPRLPRRLILSLAMALGLATMSTGLAQSAPTPVTTAAEQSAG
                     TTAAAAVTFSDEFDGAAGSAVNGAKWQIETGDNVNNHERQYYTAGNRNAVLDGQGHLV
                     ITARKENPGNYQCWYGRCEYTSARLNTSGKFSTTYGRVEARMKIPRGQGIWPAFWMLG
                     SDIGSVGWPNSGEIDIMENVGFEPGTVHGTLHGPGYSGSGGIGAGYSLPGGQAFADAF
                     HTFAVDWSPNAITWSVDGTVYQRRTPADLGGRQWVFDKPFFVILNLAVGGYWPGDPDG
                     STVFPQQLLVDYVRVSSDSGQPGGGGPITGLAGKCVDVAGGAVANGTAVQLYDCNGTA
                     AQQWTVGADGTIRALGKCLDVASGGTADGTKVQLWDCNGSAAQQWATPAARDIVNPQA
                     DKCLDVSGGSSANSTRLQIWTCTGAANQKWTVTR"
     misc_feature    complement(438567..439283)
                     /locus_tag="Sfla_0378"
                     /note="Laminarinase, member of the glycosyl hydrolase
                     family 16; Region: GH16_laminarinase_like; cd08023"
                     /db_xref="CDD:185693"
     misc_feature    complement(<438537..439238)
                     /locus_tag="Sfla_0378"
                     /note="Beta-glucanase/Beta-glucan synthetase [Carbohydrate
                     transport and metabolism]; Region: SKN1; COG2273"
                     /db_xref="CDD:225182"
     misc_feature    complement(order(438864..438866,438906..438908,
                     438915..438917,438921..438923,438969..438971,
                     438981..438983,439062..439064))
                     /locus_tag="Sfla_0378"
                     /note="active site"
                     /db_xref="CDD:185693"
     misc_feature    complement(order(438906..438908,438915..438917,
                     438921..438923))
                     /locus_tag="Sfla_0378"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185693"
     misc_feature    complement(438171..438530)
                     /locus_tag="Sfla_0378"
                     /note="Ricin-type beta-trefoil; Carbohydrate-binding
                     domain formed from presumed gene triplication. The domain
                     is found in a variety of molecules serving diverse
                     functions such as enzymatic activity, inhibitory toxicity
                     and signal transduction. Highly specific...; Region:
                     RICIN; cd00161"
                     /db_xref="CDD:238092"
     misc_feature    complement(438174..438530)
                     /locus_tag="Sfla_0378"
                     /note="Ricin-type beta-trefoil lectin domain; Region:
                     Ricin_B_lectin; pfam00652"
                     /db_xref="CDD:250032"
     misc_feature    complement(order(438180..438182,438204..438206,
                     438210..438212,438249..438251,438309..438314,
                     438333..438335,438339..438341,438378..438380,
                     438432..438434,438456..438458,438462..438464,
                     438501..438503))
                     /locus_tag="Sfla_0378"
                     /note="putative sugar binding sites [chemical binding];
                     other site"
                     /db_xref="CDD:238092"
     misc_feature    complement(order(438174..438182,438303..438311,
                     438426..438434))
                     /locus_tag="Sfla_0378"
                     /note="Q-X-W motif; other site"
                     /db_xref="CDD:238092"
     gene            439967..440668
                     /locus_tag="Sfla_0379"
                     /db_xref="GeneID:11370025"
     CDS             439967..440668
                     /locus_tag="Sfla_0379"
                     /inference="similar to AA sequence:KEGG:SCP1.128"
                     /note="KEGG: sco:SCP1.128 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921362.1"
                     /db_xref="GI:357409626"
                     /db_xref="GeneID:11370025"
                     /translation="MNAKRTVLELLGRAGMFPGEAEELVALVEAGAIAGAHHEIGKPR
                     DAPAGSGEAYGSGWRDGALATSDELGHAAERALERALGPALSGSSGAVARDRHPVGRV
                     DVERAKVAVIPLYLEFSDLSELDPEVSDEVLTAVLGTMNVVGRVGYAGQLEQFTASGR
                     ERLARLYAHYGPRGHIAVHGRYSLLHSPTSIAVLERLAAAGPALRAEWEHAELPPAWL
                     DGLATAWEASEAPPA"
     gene            complement(440719..442335)
                     /locus_tag="Sfla_0380"
                     /db_xref="GeneID:11370026"
     CDS             complement(440719..442335)
                     /locus_tag="Sfla_0380"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: sgr:SGR_6683  two-component system sensor
                     kinase;
                     PFAM: ATP-binding region ATPase domain protein; CHASE3
                     domain protein; histidine kinase HAMP region domain
                     protein; histidine kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; histidine kinase HAMP region
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_004921363.1"
                     /db_xref="GI:357409627"
                     /db_xref="GO:0000155"
                     /db_xref="GO:0004871"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR007891"
                     /db_xref="GeneID:11370026"
                     /translation="METDTVQQASATRAPGSAGGGWTTRGWLGAGSGAVLVLLLVLTA
                     GGGWVLAHATDVNKRLTDRWSPALIASVRMESALINQETGIRGYGMTGKREFLEPYQD
                     GVAQERAAARELARLTEGDERATADLTRVREDSERWQTTTARPVSEAAEPTASARQRT
                     ESGKSAFDALRASLTEQQNHIEAERDRARDDLQAARTLRNTAFTAIACVVLAVIALAF
                     AGLRRGVQLPLDRLRTDVRQVADGRFGHTITSSGPADLRALARDVDGMRRRLAGELEF
                     TDRARARLDEQATELRRSNEELEQFAYVASHDLQEPLRKVASFCQLLERRYANQLDDR
                     AKQYISFAVDGANRMQTLIGDLLDFSRVGRLHAEDTDVSIEAVLRRTTNSLGMVIEES
                     GAVITHDPLPAVHGDPTQLGVLLQNLISNAIKFRTPGEVPRIHLGAREQEDFADGAEG
                     AGPRWEFAVSDNGIGIGPEYAERIFVIFQRLHTRDTYPGNGIGLALCKKIVEYHGGTI
                     GLDTAHTPGTRFVFSLPSARQEASATGAVS"
     misc_feature    complement(441763..442140)
                     /locus_tag="Sfla_0380"
                     /note="CHASE3 domain; Region: CHASE3; pfam05227"
                     /db_xref="CDD:253104"
     misc_feature    complement(440737..441831)
                     /locus_tag="Sfla_0380"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(441526..441654)
                     /locus_tag="Sfla_0380"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(441526..441531,441538..441543,
                     441547..441552,441559..441564,441568..441573,
                     441619..441621,441625..441630,441637..441642,
                     441646..441651))
                     /locus_tag="Sfla_0380"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(441253..441453)
                     /locus_tag="Sfla_0380"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(441268..441270,441280..441282,
                     441289..441291,441301..441303,441310..441312,
                     441322..441324,441379..441381,441388..441390,
                     441400..441402,441409..441411,441421..441423,
                     441433..441435))
                     /locus_tag="Sfla_0380"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(441415..441417)
                     /locus_tag="Sfla_0380"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(440764..441105)
                     /locus_tag="Sfla_0380"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(440776..440778,440782..440787,
                     440800..440802,440806..440808,440854..440865,
                     440938..440943,440947..440949,440953..440955,
                     440959..440961,441064..441066,441073..441075,
                     441085..441087))
                     /locus_tag="Sfla_0380"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(441073..441075)
                     /locus_tag="Sfla_0380"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(440857..440859,440863..440865,
                     440941..440943,440947..440949))
                     /locus_tag="Sfla_0380"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            442438..443256
                     /locus_tag="Sfla_0381"
                     /db_xref="GeneID:11370027"
     CDS             442438..443256
                     /locus_tag="Sfla_0381"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: sgr:SGR_6682  two-component system response
                     regulator;
                     PFAM: response regulator receiver;
                     SMART: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_004921364.1"
                     /db_xref="GI:357409628"
                     /db_xref="GO:0000156"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:11370027"
                     /translation="MAVETPASSEQEELAERARQAVAEAARKLVLGAPGPRDGQEDPD
                     APRSDALASLRALAHLSRAVEECATLAARAAAQEGAGYPQLGRAWGVSRQGARKRWPG
                     LVFTARPASRPLPHDQTRSSLMNGLAPRTYTVLLVEDDMADAMLIEEALTEHGMARGI
                     QRADDGVAALEYLRDPHTDRPDLIVLDLNMPRMNGRELLNVLKKDTALSSIPIVVLTT
                     SAAPDDVEDAYRQHANAYVTKPVNLDEFMQTVQSIDSFFLDTATTLPPHPGDEA"
     misc_feature    442831..>443196
                     /locus_tag="Sfla_0381"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    442840..443196
                     /locus_tag="Sfla_0381"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(442849..442854,442996..442998,443020..443022,
                     443086..443088,443143..443145,443152..443157)
                     /locus_tag="Sfla_0381"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    442996..442998
                     /locus_tag="Sfla_0381"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(443005..443010,443014..443022)
                     /locus_tag="Sfla_0381"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    443152..443160
                     /locus_tag="Sfla_0381"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(443328..447272)
                     /locus_tag="Sfla_0382"
                     /db_xref="GeneID:11370028"
     CDS             complement(443328..447272)
                     /locus_tag="Sfla_0382"
                     /inference="protein motif:PRIAM:3.2.1.23"
                     /note="KEGG: sco:SCO6457 beta-galactosidase;
                     PFAM: glycoside hydrolase 42 domain 5 loop region;
                     glycoside hydrolase 2 sugar binding; glycoside hydrolase 2
                     immunoglobulin domain protein beta-sandwich; glycoside
                     hydrolase 2 TIM barrel"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="YP_004921365.1"
                     /db_xref="GI:357409629"
                     /db_xref="InterPro:IPR004199"
                     /db_xref="InterPro:IPR006101"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006103"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11370028"
                     /translation="MQHPSSPHQPVHPSRSVSRRRILEGGAAGFGALALSALPAVVSA
                     AATAHADPASAGWGPTANGHPEWNNNIAIFDIGSEPPHTTLMPYADVDAALTGDRTRS
                     PWRLDLDGTWKFAYADRPDGRDPDFHRTDLDDRSWDTVPVPSCWQLHGYDFPIYSNIT
                     YPWAGPNGLGEEAQPPYAPTRYNPVGQYRRTFTVPRSWDGRRVFLHFEGVKSAHYVWI
                     NGVPVGYREDSYTSAEYDITPHLRPGRNQIAVEVYRFSDGDWMEDQDMIRLSGIFRSV
                     HLFSTPTVHLRDFKLDTPLSDGWTAAELSVTASVRAYGDNPPGKGEYTVETQLYDAAG
                     HPVWSRPLRQTAGLGAARAGDDVTVRASKAVPKPALWSAEHPNLYTAVLRLRDPAGKV
                     TETLSHRVGFREFAIVDGLMRINGRPVSLRGTNRHEMHPDRGMSLTRADMVEDIGVVK
                     RLNMNTVRTSHYPNNPLWLELADEYGLYLVDETNLETHGIRDSYPGDHADWTEACVAR
                     ARNMVHRDKNHASAVIWSLGNEAGTGSAFVAMHDWIRAYDPTRVIQYEGDDRPALSDI
                     RSEMYTKPDQVEQRATDTGDTRPFVLIEYSHAMGNSSGNFKKYWDVIRAHDVLQGGWI
                     WDFADQALTWPTPTRTLFTETGPGEMTGELLAPSGRFDRDKGVSGGTVFRNDAGLDIT
                     GSLTLEAWITQKVTGRHQPILAKGDTQYALKQTDGSLEFFVHAAGRWTTASWALPQNW
                     TGTEHHVAGVFDAAAATLTLYVDGEAKATRTAAQRPDSNNAPVALATDADRPTREFSG
                     TVRRAHVYARALTAAELASGSRGPGDEGVRLWFDAATVGLEEVRPPEPTFRAYGGDFG
                     DNPNDGSFSADGIVLADRGHTGKAAEIKRILQAIDVTADGGGDPRRFTVTNEYLFTNL
                     RELDADWTVVADGKAVRRGRLTRAQLDIAPLSSKGITVPFTLPDRPAPGTEYFLELSF
                     TTREATKWAEPGFEVARQQLPLDAGSPAVKPRPLDSVRTLSRRDGDGSVTVTGHDFSV
                     QIDRRTGLITSWEAGGERLIISGPAPNYWRAPTENDIGNGQPARNGTWRHAGSDRKVT
                     GFEVRELRDRAVEIAVSGTLPTTTESAYTTTYTVFGNGEIKVDHTLHPGASGLPYIPE
                     IGSLLLLPGRLSHVHYYGRGPEENHWDRNNGTDVGLHSATVAEQWTPYVRPQENGNRT
                     DVRWVALTDGTGRGLLATGEPLLEVNASYFTPEDLSAGARHDYQLTPRKDVVLRLNHR
                     QMGVGGDDSWGAHTHDEYKLFADQDYAYTYRLRPLNGLDSATAASRRPTATE"
     misc_feature    complement(443355..447065)
                     /locus_tag="Sfla_0382"
                     /note="cryptic beta-D-galactosidase subunit alpha;
                     Reviewed; Region: ebgA; PRK10340"
                     /db_xref="CDD:236673"
     misc_feature    complement(446427..446969)
                     /locus_tag="Sfla_0382"
                     /note="Glycosyl hydrolases family 2, sugar binding domain;
                     Region: Glyco_hydro_2_N; pfam02837"
                     /db_xref="CDD:251564"
     misc_feature    complement(446064..446423)
                     /locus_tag="Sfla_0382"
                     /note="Glycosyl hydrolases family 2; Region:
                     Glyco_hydro_2; pfam00703"
                     /db_xref="CDD:250069"
     misc_feature    complement(445377..446060)
                     /locus_tag="Sfla_0382"
                     /note="Glycosyl hydrolases family 2, TIM barrel domain;
                     Region: Glyco_hydro_2_C; pfam02836"
                     /db_xref="CDD:251563"
     misc_feature    complement(444834..445226)
                     /locus_tag="Sfla_0382"
                     /note="LamG-like jellyroll fold domain; Region: LamGL;
                     smart00560"
                     /db_xref="CDD:214722"
     misc_feature    complement(443391..444203)
                     /locus_tag="Sfla_0382"
                     /note="Beta galactosidase small chain; Region:
                     Bgal_small_N; smart01038"
                     /db_xref="CDD:214988"
     gene            complement(447745..448785)
                     /locus_tag="Sfla_0383"
                     /db_xref="GeneID:11370029"
     CDS             complement(447745..448785)
                     /locus_tag="Sfla_0383"
                     /inference="protein motif:PFAM:PF08240"
                     /note="PFAM: Alcohol dehydrogenase GroES domain protein;
                     Alcohol dehydrogenase zinc-binding domain protein;
                     KEGG: sma:SAV_3314 NADP-dependent alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="YP_004921366.1"
                     /db_xref="GI:357409630"
                     /db_xref="GO:0008270"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:11370029"
                     /translation="MTTVAAYAAPSAKAPLERTTVERRAVGEFDVLIDIKFAGICHSD
                     IHQARDGWGEGIFPMVPGHEIAGVVTETGSGVTKFAVGDRVGVGCMVDSCRECDNCKA
                     GLEQYCAKGNTGTYNALDKNGDPTYGGYSTHIVVDEKYTLRIPDGLALDEAAPLLCAG
                     ITTYSPLKHWNAGPGKKVAVVGMGGLGHMGVKIAHALGAEVTVLSQSLRKQEDGLKLG
                     ADHYYATSDPKTFETLRGTFDIILSTVSAPLDFGAYLSLLKTDGALVNVGAPEEPISV
                     NLFSLIGGRKSLSGSGIGGIQETQDMLDFCAEHGFGAEIELIGASEINEAYERVLNSD
                     VRYRFVIDAATI"
     misc_feature    complement(447751..448743)
                     /locus_tag="Sfla_0383"
                     /note="Zn-dependent alcohol dehydrogenases [General
                     function prediction only]; Region: AdhP; COG1064"
                     /db_xref="CDD:223992"
     misc_feature    complement(447760..448743)
                     /locus_tag="Sfla_0383"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD1; cd05283"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(447907..447915,447982..447987,
                     448045..448047,448051..448056,448111..448113,
                     448156..448158,448168..448173,448225..448242,
                     448300..448302,448312..448314,448648..448650,
                     448657..448665))
                     /locus_tag="Sfla_0383"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(447907..447909,448312..448314,
                     448519..448521,448597..448599,448657..448659,
                     448663..448665))
                     /locus_tag="Sfla_0383"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(448312..448314,448597..448599,
                     448663..448665))
                     /locus_tag="Sfla_0383"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(448462..448464,448486..448488,
                     448495..448497,448504..448506))
                     /locus_tag="Sfla_0383"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(447910..447933,447940..447945,
                     447949..447951,447976..447978,447982..447990,
                     448003..448005,448279..448281,448291..448293,
                     448465..448467))
                     /locus_tag="Sfla_0383"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176186"
     gene            448971..449900
                     /locus_tag="Sfla_0384"
                     /db_xref="GeneID:11370030"
     CDS             448971..449900
                     /locus_tag="Sfla_0384"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: sma:SAV_3315 DNA-binding protein;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_004921367.1"
                     /db_xref="GI:357409631"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11370030"
                     /translation="MTEGHPVGDPRPGGNAGPALDRRAELSEFLRSRRARLKPEDVGL
                     PDFGRHRRVPGLRREELAQLAGVSVAYYTRLEQGNGQNVSGEVLAAIASALRLTDAEQ
                     AHLSHLAKPKRHRKKPSARQQRVREALSRLLDTMDGVPAYVVGRRSEILAWNRMAAAV
                     FGDWSQLQPPERNWARLVFLDPEYRELFVEWDQKASDIVSYLRMDAGCHPDDPRLSAL
                     VGELSVKSDEFRRLWARHDVKEKSHGVKRLHHPLVGELALGFETFTLPDDAEQSVVAY
                     HAEPGSASAEALRLLASWGTDATRAGTSASGRQ"
     misc_feature    449115..449273
                     /locus_tag="Sfla_0384"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(449121..449123,449196..449198)
                     /locus_tag="Sfla_0384"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(449124..449126,449199..449201)
                     /locus_tag="Sfla_0384"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    449133..449435
                     /locus_tag="Sfla_0384"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    order(449142..449147,449178..449180,449187..449189,
                     449199..449204)
                     /locus_tag="Sfla_0384"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    449349..449555
                     /locus_tag="Sfla_0384"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     gene            449979..450797
                     /locus_tag="Sfla_0385"
                     /db_xref="GeneID:11370031"
     CDS             449979..450797
                     /locus_tag="Sfla_0385"
                     /inference="protein motif:PFAM:PF07729"
                     /note="KEGG: sgr:SGR_805 GntR family transcriptional
                     regulator;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: GntR domain protein; regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004921368.1"
                     /db_xref="GI:357409632"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:11370031"
                     /translation="MQSPGSSPSSARSGPAAAPAQRGLLTERIARELEHDIRSGEIPV
                     GTKLPSERELAAQFGASRNVVREVLRRLEAQLLIEVAPGRGSFVREQTPGQARGYDAL
                     YRAGRPTVRQLIEARLPLEVETVRLATEHATDADIEVLRSARDTLESATDVVVKARAD
                     MAFHDAIAEASGNPVLRIMLSSISGMMFEMMLRSNSDPSIGEPGVPHHPEIFEAIEAR
                     DADLAGERMREHLMLGLRTYGKDLDIQVDVMARNHIEALLDETGNRYGAGGTGQ"
     misc_feature    450021..450704
                     /locus_tag="Sfla_0385"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    450051..450245
                     /locus_tag="Sfla_0385"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(450054..450056,450123..450125,450129..450134,
                     450156..450170,450174..450179,450186..450188,
                     450216..450221,450225..450236)
                     /locus_tag="Sfla_0385"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    450312..450671
                     /locus_tag="Sfla_0385"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            451000..452319
                     /locus_tag="Sfla_0386"
                     /db_xref="GeneID:11370032"
     CDS             451000..452319
                     /locus_tag="Sfla_0386"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: sgr:SGR_806  ABC transporter substrate-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_004921369.1"
                     /db_xref="GI:357409633"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11370032"
                     /translation="MSTSSQLLSRRSFGRLAAGVAGAVGTGALTACTTGGGKPSADTP
                     LRIMAINHVWSQAIRRRTEEFEELIGRRVSMTLLTADQLASSYNVKLNASGTDVDVMM
                     VRALQEQLLFAHNGWLADLSDRVAQDEEFAWPDFQKAPRDASVSGGRVLSVPVVTERP
                     ALYYRKDLVEDHGGPPPTLEQLMATAQELTDKRKGFYGFVGRGQRSGAVSQWSSFLYS
                     HGGDFVVGGKSGIGTPEALAAYEYYGRLLARTGPPGATNMSLEQAMPIFAQGKAAFYV
                     DADAIYSSFLDPQVSTVRETVGFAPFPAGPAGARPHNIPSWSLGISTFSLLRDDAWEF
                     IRWAAGPEMTAELQKDGIPGARTSVWSDPRSLASFPPDLAEAMRLNAERGLGYDRPRV
                     LQVGRARDIVGRPLVAGILGNDVRPVARDADAEFAGFLVRDNRHKES"
     misc_feature    451048..452202
                     /locus_tag="Sfla_0386"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    451252..452034
                     /locus_tag="Sfla_0386"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            452319..453278
                     /locus_tag="Sfla_0387"
                     /db_xref="GeneID:11370033"
     CDS             452319..453278
                     /locus_tag="Sfla_0387"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: sgr:SGR_807  ABC transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_004921370.1"
                     /db_xref="GI:357409634"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11370033"
                     /translation="MSTTEVSPARPAAASGGGPAPARRPRTFEQANRRLKWAMLTPAL
                     LFVGLMIVFPLVYTVDLSLTDAFGAVNAGKGYVGLQNFADALGDTRRFWPAARRTLVF
                     TVGAVILETVLGLALAMLMRKPFRGMRWVRTVLIIPLLTTPVAIGILWLLILDPTNGI
                     ANHLLAGIGLPRQEFLGSVGQSLPTLMLIDVWQWTPMMTLLLLAGLTTLPEEPEEAAR
                     VDGANGWQRFRHIVLPMLGPTLATALVLRAVDALKTFDILYATKGAGGGSDFEVETLN
                     VYAYGLTFDYQEYGLAAAVLVLFTLFIIGVVVLLRRRGGRKTA"
     misc_feature    452436..453266
                     /locus_tag="Sfla_0387"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    452604..453230
                     /locus_tag="Sfla_0387"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(452652..452657,452664..452669,452709..452720,
                     452724..452753,452760..452765,452769..452771,
                     452889..452894,452901..452903,452907..452909,
                     452916..452921,452925..452927,452937..452942,
                     452949..452951,453000..453002,453042..453047,
                     453054..453056,453075..453086,453093..453098,
                     453147..453152,453180..453185,453192..453197,
                     453201..453206,453213..453218,453225..453230)
                     /locus_tag="Sfla_0387"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(452727..452771,453075..453092)
                     /locus_tag="Sfla_0387"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(452769..452771,452874..452876,453093..453095,
                     453141..453143,453150..453152,453180..453182)
                     /locus_tag="Sfla_0387"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(452952..452990,453006..453011,453021..453023)
                     /locus_tag="Sfla_0387"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            453275..454129
                     /locus_tag="Sfla_0388"
                     /db_xref="GeneID:11370034"
     CDS             453275..454129
                     /locus_tag="Sfla_0388"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: sgr:SGR_808  ABC transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_004921371.1"
                     /db_xref="GI:357409635"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR018117"
                     /db_xref="GeneID:11370034"
                     /translation="MSATVSPVPAAARLRRRTAGSWLRGITIGVVTLVFALPLVWMFA
                     AAFKTNVQVTDPSVGLWFSPTLENFRNVVEAGQILRSMGNSLLVGVVSTVLSAVIAVP
                     AAWAVGRFGMHRTGSLILVARIVPAISLLVPWYYLFAQMGLVGSYTVLILSQMFVSVP
                     LIMWIMISFFAGLPVELEEAARTDGLSAFGAFRRIALPLAAPGTATASLLAFVFSWNN
                     FMFALIFADDRTQTVPVTLFNFISYASTDWGGLMAAATLITVPVVLAAVLGQKYLVAG
                     LTSGATKG"
     misc_feature    453332..454123
                     /locus_tag="Sfla_0388"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    453518..454066
                     /locus_tag="Sfla_0388"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(453566..453571,453578..453583,453596..453598,
                     453617..453628,453632..453661,453668..453673,
                     453677..453679,453740..453745,453749..453751,
                     453755..453757,453764..453769,453773..453775,
                     453785..453790,453797..453799,453848..453850,
                     453890..453895,453902..453904,453923..453934,
                     453941..453946,453983..453988,454016..454021,
                     454028..454033,454037..454042,454049..454054,
                     454061..454066)
                     /locus_tag="Sfla_0388"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(453635..453679,453923..453940)
                     /locus_tag="Sfla_0388"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(453677..453679,453941..453943,453977..453979,
                     453986..453988,454016..454018)
                     /locus_tag="Sfla_0388"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(453800..453838,453854..453859,453869..453871)
                     /locus_tag="Sfla_0388"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            454168..455382
                     /locus_tag="Sfla_0389"
                     /db_xref="GeneID:11370035"
     CDS             454168..455382
                     /locus_tag="Sfla_0389"
                     /inference="protein motif:PFAM:PF02746"
                     /note="PFAM: Mandelate racemase/muconate lactonizing
                     protein;
                     KEGG: sgr:SGR_809  starvation sensing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="YP_004921372.1"
                     /db_xref="GI:357409636"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR018110"
                     /db_xref="GeneID:11370035"
                     /translation="MKIVDAKVLVTSPGRNFVTLKLTTDEGLTGLGDATLNGRELAVV
                     SYLEDHVVPLLLGLDPHRIEDTWQSLYRGAYWRRGPVTMAAIAAVDVALWDIKAKAAG
                     LPLYQLLGGASRDRVGTYGHANGRDIPELLDSVRARLAEGYPAVRVQSGIPGLKAVYG
                     VSSTADDGSPVLHQQARPLVEDWDTDAYLRHMPDVLEAVRAEFGPELPLLHDAHHRLT
                     PVQAARLGKELEPYHLFWLEDCTPAENQEALRTVRRHTTTPLAVGEVFNTVYDYQGLI
                     TEQLIDYVRSAVTHFGGVTPLRKLFDFAAQYQIKSAIHGPEDISPVGMAAAVHLDLAV
                     HNFGIQEYSGHTPLTEEVFRHAYTFEDGHLHPGEAPGIGVDLDEELAAAHPYEAAYLP
                     VNRLHDGSVHDW"
     misc_feature    454168..455379
                     /locus_tag="Sfla_0389"
                     /note="bifunctional D-altronate/D-mannonate dehydratase;
                     Provisional; Region: PRK15072"
                     /db_xref="CDD:237901"
     misc_feature    454171..455379
                     /locus_tag="Sfla_0389"
                     /note="Enolase-superfamily, characterized by the presence
                     of an enolate anion intermediate which is generated by
                     abstraction of the alpha-proton of the carboxylate
                     substrate by an active site residue and is stabilized by
                     coordination to the essential Mg2+ ion; Region:
                     enolase_like; cl17188"
                     /db_xref="CDD:266540"
     misc_feature    order(454801..454803,454879..454881,454957..454959)
                     /locus_tag="Sfla_0389"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238188"
     misc_feature    order(455026..455028,455188..455190)
                     /locus_tag="Sfla_0389"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238188"
     gene            complement(455488..455991)
                     /locus_tag="Sfla_0390"
                     /db_xref="GeneID:11370036"
     CDS             complement(455488..455991)
                     /locus_tag="Sfla_0390"
                     /inference="protein motif:TFAM:TIGR00040"
                     /note="KEGG: sco:SCO0747 hypothetical protein;
                     TIGRFAM: phosphodiesterase, MJ0936 family;
                     PFAM: metallophosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="YP_004921373.1"
                     /db_xref="GI:357409637"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:11370036"
                     /translation="MRLLLTSDTHLPERARELPPSLIEEMDTADVVLHAGDWVDVATL
                     DLFETRARRLVGVYGNNDGPGLRSRLPEVARVECGGLRFGVVHETGATRGREKRCADR
                     FPDLDVLVFGHSHIPWDTTAPGGLRLLNPGSPTDRRRQPYRTYMTAEVADARLTDVRL
                     HRIPPRT"
     misc_feature    complement(455536..455988)
                     /locus_tag="Sfla_0390"
                     /note="Escherichia coli YfcE and related proteins,
                     metallophosphatase domain; Region: MPP_YfcE; cd00841"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(455647..455649,455653..455655,
                     455731..455733,455809..455814,455881..455883,
                     455962..455964,455968..455970))
                     /locus_tag="Sfla_0390"
                     /note="active site"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(455647..455649,455653..455655,
                     455731..455733,455812..455814,455881..455883,
                     455962..455964,455968..455970))
                     /locus_tag="Sfla_0390"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(455725..455727,455746..455781,
                     455806..455820,455827..455829,455899..455904))
                     /locus_tag="Sfla_0390"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163617"
     gene            456376..458787
                     /locus_tag="Sfla_0391"
                     /db_xref="GeneID:11370037"
     CDS             456376..458787
                     /locus_tag="Sfla_0391"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: Stage II sporulation protein E; PAS fold-4 domain
                     protein; PAS fold domain protein; ATP-binding region
                     ATPase domain protein;
                     KEGG: sgr:SGR_1537 hypothetical protein;
                     SMART: protein phosphatase 2C domain protein; PAS domain
                     containing protein; ATP-binding region ATPase domain
                     protein; GAF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor protein"
                     /protein_id="YP_004921374.1"
                     /db_xref="GI:357409638"
                     /db_xref="GO:0004871"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:11370037"
                     /translation="MTAGNTERSADFRGPLDVTWAATVVVDAQDTVIGWSPAATRLLG
                     HPAHEIVGRPLGMFLSPGPPGSTPPLTTPFRGNEVRVARHRDGHELIVAATVCPLPGA
                     GTAARVLVMTELQDLRQWESRLALLHGLTTRSPVGLAIYDNDLRLTWCNAAFEDEIGR
                     PLAEFRGTRADELYLDGHFVTQGHPPTLDAVLRHVLDTGESFLDLHFQGRPPSDPETD
                     HLWSCAYYRLQDPDGHVFGVCEDTFDISDRFKAQRRLALLVEAGRGIGTALDVLAAAE
                     TIPEVAVPEFATTVTVDLSEAVLEGEMPAPGDAAAMSLIRVARRSAADVGRRPAPAPV
                     ADRPPVRYPAGSPQDRCLSSGGLVLDETTLVVPLRAGNSSLGLVTFVRGVRSAVFDGG
                     EVALADELAARTAVSIDNARRFTRERAASLVLQRQLLPRHVPEQSAVDVAYRYLPTDA
                     MTGVGGDWFDVIPLSGTRVGLVVGDVVGHGLQAAATMGRLRTTVRAFAQMDLDPVELL
                     SRLDDLVRQSAEEQWGGAGSADGAHFDVTTGATCLYAVYDPVSRRCVMARAGHLPPAV
                     VPPRGEPSFPDLPAGPPLGLGGLPFEPLEMELPAGSLLALFTDGLVESRDRDIDHGLD
                     ILGHVLGDDRRTALGELCDRAVEELLPNGPAADDTALLLVRTRELGASQVAEWELDAE
                     MVAPGHARELTTAQLHRWGLDELSFATELVVSELVTNAVRYAEGPLHVRLIRDRTLLC
                     EIADTGHTSPHLRHSGEDDEGGRGLFIVAQLVQRWGTRYTRSGKTLWTEQALPADHRP
                     LTADR"
     misc_feature    456439..456726
                     /locus_tag="Sfla_0391"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    456439..>456663
                     /locus_tag="Sfla_0391"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(456478..456480,456490..456492,456508..456510,
                     456547..456558,456619..456621,456634..456636)
                     /locus_tag="Sfla_0391"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(456538..456540,456550..456552,456655..456657,
                     456661..456663)
                     /locus_tag="Sfla_0391"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    456775..457119
                     /locus_tag="Sfla_0391"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    456775..457110
                     /locus_tag="Sfla_0391"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(456823..456825,456835..456837,456853..456855,
                     456892..456903,457000..457002,457015..457017)
                     /locus_tag="Sfla_0391"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(456883..456885,456895..456897,456937..456939,
                     456946..456951,457042..457044,457048..457050)
                     /locus_tag="Sfla_0391"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    <457465..457638
                     /locus_tag="Sfla_0391"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    457813..458376
                     /locus_tag="Sfla_0391"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     misc_feature    458509..458703
                     /locus_tag="Sfla_0391"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    458530..458532
                     /locus_tag="Sfla_0391"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(458611..458613,458665..458667)
                     /locus_tag="Sfla_0391"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            459151..459636
                     /locus_tag="Sfla_0392"
                     /db_xref="GeneID:11370038"
     CDS             459151..459636
                     /locus_tag="Sfla_0392"
                     /inference="protein motif:PFAM:PF12277"
                     /note="PFAM: Protein of unknown function DUF3618;
                     KEGG: sgr:SGR_170 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921375.1"
                     /db_xref="GI:357409639"
                     /db_xref="InterPro:IPR022062"
                     /db_xref="GeneID:11370038"
                     /translation="MTMKEESRADIGTPVPDASSTDELREQAERTRDELGRTAEALGA
                     KADVKAQAKEKSAAARKQASEKASLVADQIREKAEQATELVKDRTPDPVLEKTAQAAA
                     QVRETASKAGQYAADKTPDPVLEKAGRATSIARANRKPLLAGGALLAVVLLVRRARGR
                     R"
     misc_feature    459208..459330
                     /locus_tag="Sfla_0392"
                     /note="Protein of unknown function (DUF3618); Region:
                     DUF3618; pfam12277"
                     /db_xref="CDD:256950"
     gene            459956..461287
                     /locus_tag="Sfla_0393"
                     /db_xref="GeneID:11370039"
     CDS             459956..461287
                     /locus_tag="Sfla_0393"
                     /inference="similar to AA sequence:KEGG:SAV_4418"
                     /note="KEGG: sma:SAV_4418 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921376.1"
                     /db_xref="GI:357409640"
                     /db_xref="GeneID:11370039"
                     /translation="MGTVLSMQINGAKQQRGHVLLIAGDSATRRRTVQVLPSKNLAAL
                     SMVPVSALLGSNVPSDTTYLDGIHDQNALQVRLRTAAATPGPLLVYLSGRLTTDRRGQ
                     QLYLALSRTTASTVRYTALPWEWLGTELRTRPQGLTTVVFDLAADKAAWPLLREYGTL
                     PASTAAEVYGVVTPPGFAGDEGVSSYTRHWIEQLRHAPERPSNSRLHALTVASAAPPP
                     GALVLPGIREITAPGYAFGHPATDRPQGRTDGPAPQPVVPRPAHEPGGGRGAGPAPRT
                     GTVVVPQTDAAPSPQPPPAHPVFVAQDPRPHIHALAQSGRHTEAAQMAQMWEQYILQT
                     DGFDSPKATEWVEIRADLAKMSGNFLLATQLWVGAGRTRLVHQSPDAPEVLSAARSAH
                     YCWTQLQDAARARECGPELISLLRALPSLDRRHLTVAQQRLEFLHDTPDGS"
     gene            complement(461339..462760)
                     /locus_tag="Sfla_0394"
                     /db_xref="GeneID:11370040"
     CDS             complement(461339..462760)
                     /locus_tag="Sfla_0394"
                     /inference="similar to AA sequence:KEGG:SCO5468"
                     /note="KEGG: sco:SCO5468 transmembrane transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane transport protein"
                     /protein_id="YP_004921377.1"
                     /db_xref="GI:357409641"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:11370040"
                     /translation="MYAPTTGPAQAPSHSQAAPGNSRSRVLIASLIGTTIEFYDFYVY
                     ATAAVLVFPKLFFPSSDPTTALLSSFAVFGAAMVARPIGAIVFGHLGDRLGRKGTLVA
                     SLLTMGIATFLIGVLPTYAQAGWVATALLVLMRLAQGFALGGEWSGAALVATENAPAG
                     KRALWGTFPQLGAPLGFIIGNGLFLVIGALLPSAAGADPSQPSDAFLSWGWRIPFLFS
                     AVMVAIGLWVRMRLVESQVFAKTQETGKVRKLPLATVFRHHWTQLVLGSFAMLATYVL
                     FYLMTTFSLSYGRTAEDADVPGLGYSYTTFVLMMIFGVVFFAAFTLISGPLADKYGRR
                     KTLAWVTVGIIVFGLVWVPLIDLGTLGVVLWLVLGFTLMGTTFGPMGAMLPELFPTSV
                     RYTGSGIAYNVSSILGAAVAPFVAVALWEAGDGSPWLVGVYLSVMGVLTLTALLIGKE
                     TKDVALDEGEVPAAPARTEAPSV"
     misc_feature    complement(461426..462682)
                     /locus_tag="Sfla_0394"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(461435..462664)
                     /locus_tag="Sfla_0394"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    complement(order(461537..461539,461546..461551,
                     461558..461563,461570..461575,461606..461608,
                     461615..461620,461630..461632,461639..461644,
                     461654..461656,461798..461800,461810..461812,
                     461819..461821,461831..461833,461843..461845,
                     461906..461908,461915..461920,461927..461932,
                     461939..461941,462230..462232,462248..462253,
                     462260..462265,462299..462301,462308..462313,
                     462320..462325,462332..462337,462497..462502,
                     462506..462511,462521..462523,462530..462535,
                     462542..462544,462614..462619,462623..462631,
                     462638..462640))
                     /locus_tag="Sfla_0394"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            463083..463727
                     /locus_tag="Sfla_0395"
                     /db_xref="GeneID:11370041"
     CDS             463083..463727
                     /locus_tag="Sfla_0395"
                     /inference="protein motif:PFAM:PF01872"
                     /note="PFAM: bifunctional deaminase-reductase domain
                     protein;
                     KEGG: fre:Franean1_6643 deaminase-reductase
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase/reductase domain-containing protein"
                     /protein_id="YP_004921378.1"
                     /db_xref="GI:357409642"
                     /db_xref="GO:0008703"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="GeneID:11370041"
                     /translation="MSRVRVHNFSVSVDGFATGEGQSPDAPFGHAGTRLHEWFFPTRT
                     FQRMLGKPGGSTGADDAIASTWEAGIGAEIMGRNKFGPLRGPWENDDWKGWWGPNPPF
                     HTPVFVLTHHPRPSVEMEGGTTFHFIDATPQEVLRQAREAAGGLDVRIGGGPSTVREF
                     LAEDLVDHLHVAVVPIVLGRGERLWDGLEGLEKRFRAESVTTPGGVTHMTFTRP"
     misc_feature    <463302..463715
                     /locus_tag="Sfla_0395"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cl17426"
                     /db_xref="CDD:266674"
     gene            463996..464718
                     /locus_tag="Sfla_0396"
                     /db_xref="GeneID:11370042"
     CDS             463996..464718
                     /locus_tag="Sfla_0396"
                     /inference="protein motif:PFAM:PF09339"
                     /note="manually curated;
                     PFAM: regulatory protein IclR; Transcriptional regulator
                     IclR;
                     KEGG: cai:Caci_5388 transcriptional regulator, IclR
                     family;
                     SMART: regulatory protein IclR"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_004921379.1"
                     /db_xref="GI:357409643"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR014757"
                     /db_xref="GeneID:11370042"
                     /translation="MSRHAGGEQERGTDRGRGVIEGAFALLEALRRCGGEAGLTEIAA
                     ACALPKGSAHRLLEQLLLVGAVERRGSRYRVGSQLYRLGQAWEPHPGLRVAARHPLHR
                     LRAATGASALLTVLHDGRALTVASVPGEAEPLVPVRNGMSFLLDTAAGQVLSGRGRAG
                     SGGRLPGAVLECAEVMDGVCCAALPVRGRDDRTLAAIAVMTLSAQGLQRAAQEAARAA
                     AAVTAALVRAGAPPRLPPVLHY"
     misc_feature    464047..464610
                     /locus_tag="Sfla_0396"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    464050..464307
                     /locus_tag="Sfla_0396"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     gene            464877..465344
                     /locus_tag="Sfla_0397"
                     /db_xref="GeneID:11370121"
     CDS             464877..465344
                     /locus_tag="Sfla_0397"
                     /inference="similar to AA sequence:KEGG:Sros_0988"
                     /note="KEGG: sro:Sros_0988 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921380.1"
                     /db_xref="GI:357409644"
                     /db_xref="GeneID:11370121"
                     /translation="MTVRRLTTLALAGALGLTSLVGAAGAAQADPVDYVQIQLVDLYC
                     GDESEGDHDEAYLNIAANGGKAVRLWPANASYQTMGTGYRRALDGSNGNALLVLGRTE
                     SRTLSLWDYDSTSSDDRLGSVTVTGNEVGAETQYRVLEGSGGVYTLAYRVVDI"
     misc_feature    <465192..465275
                     /locus_tag="Sfla_0397"
                     /note="C2 domain; Region: C2; cl14603"
                     /db_xref="CDD:265430"
     gene            complement(465516..466961)
                     /locus_tag="Sfla_0398"
                     /db_xref="GeneID:11370122"
     CDS             complement(465516..466961)
                     /locus_tag="Sfla_0398"
                     /inference="protein motif:PFAM:PF07992"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; pyridine nucleotide-disulphide
                     oxidoreductase dimerisation region;
                     KEGG: sgr:SGR_689  oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004921381.1"
                     /db_xref="GI:357409645"
                     /db_xref="GO:0016491"
                     /db_xref="GO:0050660"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:11370122"
                     /translation="MTDLDGVKSGEYDVVVIGAGPVGENVADRARAAGLSTAVIESEL
                     IGGECSYWACMPSKALLRPVVARADARRVAGLSDAVQGPLDVDAVLAHRDYETSHWKD
                     DGQVGWLESIGADIYRGKGRLTGVRQVSVTGADGTERHLTARHAVAVCTGSRAVVPSL
                     PGIADVRPWTSREATSAKEVPGRLVVVGGGVVGVEMATVWQGLGAEVTMVVRGGQLLP
                     RMEPFAGELVAEALTEAGARILTGVSTTAVSRAGHDGPVTVELDDGERLEADEILFAT
                     GRAPRTDDLGLDTVGLEPGSWLTVDDSCRVDGSDWLYAVGDVNHRALLTHQGKYQARI
                     AGAAIAARAQGTPPMETDPWGAHAATADHAAVPQVVFTDPEAASVGLTLAEAEAAGHR
                     VRAVDHDLAAVAGSGLYAKGYKGRARMVVDLDRRILLGVTFVGPGIGELLHSATIAVA
                     GEVPVERLWHAVPAYPTISEVWLRLLESFRG"
     misc_feature    complement(<466839..466952)
                     /locus_tag="Sfla_0398"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(465546..466931)
                     /locus_tag="Sfla_0398"
                     /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
                     dihydrolipoamide dehydrogenase (E3) component, and related
                     enzymes [Energy production and conversion]; Region: Lpd;
                     COG1249"
                     /db_xref="CDD:224169"
     misc_feature    complement(466170..466391)
                     /locus_tag="Sfla_0398"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(465546..465866)
                     /locus_tag="Sfla_0398"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            467077..467457
                     /locus_tag="Sfla_0399"
                     /db_xref="GeneID:11370123"
     CDS             467077..467457
                     /locus_tag="Sfla_0399"
                     /inference="protein motif:TFAM:TIGR01068"
                     /note="KEGG: sgr:SGR_690  thioredoxin;
                     TIGRFAM: thioredoxin;
                     PFAM: Thioredoxin domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_004921382.1"
                     /db_xref="GI:357409646"
                     /db_xref="GO:0009055"
                     /db_xref="GO:0015035"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="GeneID:11370123"
                     /translation="MSTVELTKENFDQVVSDNEFLLIDFWASWCGPCRQFAPVYDSAS
                     ERHPDLVFAKVDTEAQQELAAAFEIRSIPTLMIVRDNVAVFSQPGALPEAALEDVIGQ
                     ARNLDMDEVRKSVEEQKQAQQEPQ"
     misc_feature    467101..467376
                     /locus_tag="Sfla_0399"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(467164..467166,467173..467175)
                     /locus_tag="Sfla_0399"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            complement(467542..467916)
                     /locus_tag="Sfla_0400"
                     /db_xref="GeneID:11370124"
     CDS             complement(467542..467916)
                     /locus_tag="Sfla_0400"
                     /inference="similar to AA sequence:KEGG:SGR_691"
                     /note="KEGG: sgr:SGR_691 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921383.1"
                     /db_xref="GI:357409647"
                     /db_xref="GeneID:11370124"
                     /translation="MSSVVGMSHPQSYEILLFPEPEEPDAGGPEPGTAIRSAVVAATG
                     KTGASGYPRYEGGGMEADVDPATHTVEALLVDGAEIDYGLTVRIAERIRGTGGAQEYD
                     GSGEAPEPPEESATASGQQGNG"
     gene            complement(467948..468976)
                     /locus_tag="Sfla_0401"
                     /db_xref="GeneID:11370125"
     CDS             complement(467948..468976)
                     /locus_tag="Sfla_0401"
                     /inference="protein motif:PFAM:PF00356"
                     /note="KEGG: sgr:SGR_692 LacI family transcriptional
                     regulator;
                     PFAM: regulatory protein LacI;
                     SMART: regulatory protein LacI"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_004921384.1"
                     /db_xref="GI:357409648"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="GeneID:11370125"
                     /translation="MSQLSPQPAGTSLPTSADVARLAGVSRATVSYVLNNNTTVRISD
                     STRRRVREAAADLGYVPHAAARSLRAGHSRTVLLPAGQAPAGALYQRFLTQLELGLRR
                     LDYTVVRYGGVGQDADEAAMTWAELRPVAVVSPDDLALTPYGIGVLTRSGARAVITLG
                     SQPVDGAHALVVDQREVGAHAVRHLLARGRRSIGVVVPQEPGHALIARPRLAGALRAV
                     EESDADAGVRALPLRYQEDSAQDLASRWRTLGLDAVFAYDDEYAMLLTRALQDAGLVI
                     PGDTAVIGAGDLMLGRLLRPRLSSVAMELTCEQRPAEMIDRLVQNPGGPPERHHLLRP
                     AVVARESS"
     misc_feature    complement(467954..468937)
                     /locus_tag="Sfla_0401"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(468767..468928)
                     /locus_tag="Sfla_0401"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(468770..468775,468779..468784,
                     468791..468793,468800..468802,468839..468841,
                     468848..468853,468872..468874,468881..468886,
                     468890..468904,468926..468928))
                     /locus_tag="Sfla_0401"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(468773..468802)
                     /locus_tag="Sfla_0401"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(467966..>468490)
                     /locus_tag="Sfla_0401"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(468050..468052,468119..468121,
                     468275..468277,468347..468349,468461..468463))
                     /locus_tag="Sfla_0401"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     gene            469288..469752
                     /locus_tag="Sfla_0402"
                     /db_xref="GeneID:11370126"
     CDS             469288..469752
                     /locus_tag="Sfla_0402"
                     /inference="protein motif:PFAM:PF02452"
                     /note="PFAM: PemK family protein;
                     KEGG: sgr:SGR_693 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PemK family protein"
                     /protein_id="YP_004921385.1"
                     /db_xref="GI:357409649"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR003477"
                     /db_xref="GeneID:11370126"
                     /translation="MTFEHNHSSDSTTDFPGRSGPAATAEAEPREVGTVRTSYAPDRD
                     GDPDPGEIVWTWVPFEENDGRGKDRPVLVVAREDEGTLLAVQLSSKQHYGDHEWVALG
                     AGPWDSSGRPSWVDLDRVLRVHEDGMRREACALDRGRYDLVVGRLRERYGWS"
     misc_feature    469429..469734
                     /locus_tag="Sfla_0402"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:251304"
     gene            complement(469737..470573)
                     /locus_tag="Sfla_0403"
                     /db_xref="GeneID:11370127"
     CDS             complement(469737..470573)
                     /locus_tag="Sfla_0403"
                     /inference="protein motif:PFAM:PF10021"
                     /note="PFAM: Protein of unknown function DUF2263;
                     KEGG: sgr:SGR_694 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921386.1"
                     /db_xref="GI:357409650"
                     /db_xref="InterPro:IPR012664"
                     /db_xref="InterPro:IPR019261"
                     /db_xref="GeneID:11370127"
                     /translation="MSARLRGIAGETESIVLAGRYRTSEGREVSIGREVAAALSGTRL
                     HGPGPVPVAALDTDRTPVVEVTGETSLQAARRMTAGATGKVAVLNYASARNPGGGYLN
                     GAQAQEESLCRGSALHATLLRAPDFYAHHRAERSALYTDRVIHSPGVPVFRDDRGRLL
                     EAPYLAGFLTSPAPNAGVVRRRDPELVPLIRTALASRAERVLEVAAVSGYRRLVLGAW
                     GCGVFMNDPAEVAGAFRALLRGDGRFAGHFEQIVLGIPDRDPDSAVRAAFTREFGGQL
                     QP"
     misc_feature    complement(469764..470555)
                     /locus_tag="Sfla_0403"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2263); Region: DUF2263; cl19419"
                     /db_xref="CDD:267772"
     gene            470725..472023
                     /locus_tag="Sfla_0404"
                     /db_xref="GeneID:11370128"
     CDS             470725..472023
                     /locus_tag="Sfla_0404"
                     /inference="protein motif:TFAM:TIGR03444"
                     /note="KEGG: sgr:SGR_695  glutamylcysteine synthetase;
                     TIGRFAM: glutamate/cysteine ligase;
                     PFAM: glutamate--cysteine ligase GCS2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/cysteine ligase"
                     /protein_id="YP_004921387.1"
                     /db_xref="GI:357409651"
                     /db_xref="InterPro:IPR006336"
                     /db_xref="InterPro:IPR017809"
                     /db_xref="GeneID:11370128"
                     /translation="MPPDTLGQHGPPVDAAPLGEEEAEDLLRGICFKTGPPRTVGVEL
                     EWLVHDREHPEALVPEDRLRAAADAVRATPLDAALTFEPGGQLELSSQPKGSLMECVD
                     ATAADLAAVRDTLGRSGLTLAGIGVDPWNPPRRLLREPRYDAMEAALDRSGSAGRAMM
                     CTSASVQVCLDAGEEEPGPLGYGRRWQLGHLLGAVLVAAFAHSPFRQGRRTGWQSTRQ
                     ALWADLDPARTLAPQGRLDPRDAWAAHVLATPVMCVRNTEGPWDVPEALTFRDWIRGG
                     GPRPPVRADLDYHLTTLFPPVRPRGHLELRMIDAQSGTDGWLVPLAVTTALFDDPEAA
                     ETVYRTVKPLAETAGLPPAPRNPLWTAAARDGLRDPELAAAAAACFTTALEALPRMGA
                     SGHVLGTVAAFHERYVARGRCPADDLPDPAQEPHGKGLVR"
     misc_feature    470800..471975
                     /locus_tag="Sfla_0404"
                     /note="Glutamate-cysteine ligase family 2(GCS2); Region:
                     GCS2; cl00954"
                     /db_xref="CDD:260718"
     gene            472020..473360
                     /locus_tag="Sfla_0405"
                     /db_xref="GeneID:11370129"
     CDS             472020..473360
                     /locus_tag="Sfla_0405"
                     /inference="protein motif:PFAM:PF03781"
                     /note="PFAM: protein of unknown function DUF323;
                     KEGG: sgr:SGR_696 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921388.1"
                     /db_xref="GI:357409652"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="InterPro:IPR017806"
                     /db_xref="GeneID:11370129"
                     /translation="MTDTPAPHTVQETDAEALRERALAALLTARERTALLTDSVDDHE
                     LTAQHSPLMSPLVWDLAHIGNQEELWLLRAVGGREAMRPEIDGLYDAFEHSRASRPSL
                     PLLAPAEARTYAADVRGRALDILGGAPLHGGGRPLERAGFAFGMVAQHEQQHDETMLI
                     THQLRSGPAVLSAPEPPEPTGTVTLPAEVLVPGGPFTMGTSTEPWALDNERPAHRREV
                     DAFHIDTAPVTCGAYQAFIEDGGYTDARWWAPEGWAMVREHDLTAPLFWHRDAGQWLR
                     RRFGVTEPVRADEPVLHVSWYEADAYARWAGRRLPTEPEWEKAARHDPGSGRSLRYPW
                     GDEDPTPERANLGQRHLRPAAAGAYAAGRSPVGVGQMVGDVWEWTSSDFLPYPGFAAF
                     PYREYSEVFFGPGHKVLRGGSFAVDPVACRGTFRNWDLPVRRQIFSGFRTARDA"
     misc_feature    472083..473348
                     /locus_tag="Sfla_0405"
                     /note="ergothioneine biosynthesis protein EgtB; Region:
                     egtB_TIGR03440"
                     /db_xref="CDD:234211"
     misc_feature    472092..472493
                     /locus_tag="Sfla_0405"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     misc_feature    472569..473351
                     /locus_tag="Sfla_0405"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; pfam03781"
                     /db_xref="CDD:252159"
     gene            473360..474115
                     /locus_tag="Sfla_0406"
                     /db_xref="GeneID:11370130"
     CDS             473360..474115
                     /locus_tag="Sfla_0406"
                     /inference="similar to AA sequence:KEGG:SGR_697"
                     /note="KEGG: sgr:SGR_697 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921389.1"
                     /db_xref="GI:357409653"
                     /db_xref="InterPro:IPR017808"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="GeneID:11370130"
                     /translation="MCRHIAYLGPSVPLGELLVSPAHGLVRQSWEPRRQRNGTVNADG
                     FGVGWYAEGDPVPGRYRRSGPVWGDETFADLSRVVRSTALLAAVRDATFAGADGEAAA
                     APFAEGRLLFSHNGAVRGWPGSLAPLAAGLPPERLLALAARSDSALLWALVLHRTAQG
                     DEIGQAVADTVLDAGAAAPGSRLNLLLTDGSTIVATTWGDSLWYLHDPGRRTVVASEP
                     YDDDPYWREVPDRTLLAATRTDVLLTPLKEPTA"
     misc_feature    473360..474073
                     /locus_tag="Sfla_0406"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_YafJ-type.  YafJ is a glutamine
                     amidotransferase-like protein of unknown function found in
                     prokaryotes, eukaryotes and archaea.  YafJ has a conserved
                     structural fold similar to those of other class II...;
                     Region: YafJ; cd01908"
                     /db_xref="CDD:238889"
     misc_feature    order(473363..473365,473624..473626,473702..473710,
                     473792..473794)
                     /locus_tag="Sfla_0406"
                     /note="putative active site [active]"
                     /db_xref="CDD:238889"
     misc_feature    order(473525..473527,473534..473539,473678..473680,
                     473738..473743)
                     /locus_tag="Sfla_0406"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238889"
     gene            474112..475074
                     /locus_tag="Sfla_0407"
                     /db_xref="GeneID:11370131"
     CDS             474112..475074
                     /locus_tag="Sfla_0407"
                     /inference="protein motif:TFAM:TIGR03438"
                     /note="KEGG: sgr:SGR_698 hypothetical protein;
                     TIGRFAM: methyltransferase;
                     PFAM: Protein of unknown function DUF2260;
                     Methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_004921390.1"
                     /db_xref="GI:357409654"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR017804"
                     /db_xref="InterPro:IPR019257"
                     /db_xref="GeneID:11370131"
                     /translation="MSPFLLTRTLPADATDAALRADVLSGLTKQPKTLPPKWFYDARG
                     SDLFEEITRLDEYYPTRAEREILIARAGEIAALSGARTLIELGSGSSEKTRHLLDALP
                     ALHTYVPVDVSESALAGAAEALLAERPGLSVHALVADFTHALELPESPGPRLVVFLGG
                     TLGNLLPAERAEFLRSVRARLSPGDGLLLGTDLVKDEATLVAAYEDAAGVTAAFNKNV
                     LAVVNRELGADFPLDDFAHVALWDPEHEWMEMRLRARRALTVKIRELDLVVQFEQGEE
                     LRTEISAKFRERRVREELAAAGLRLDQWWTDEAGRFALSLATAD"
     misc_feature    474163..475062
                     /locus_tag="Sfla_0407"
                     /note="dimethylhistidine N-methyltransferase; Region:
                     egtD_ergothio; TIGR03438"
                     /db_xref="CDD:132479"
     misc_feature    474679..475059
                     /locus_tag="Sfla_0407"
                     /note="Histidine-specific methyltransferase,
                     SAM-dependent; Region: Methyltransf_33; pfam10017"
                     /db_xref="CDD:255699"
     gene            complement(475017..475856)
                     /locus_tag="Sfla_0408"
                     /db_xref="GeneID:11370132"
     CDS             complement(475017..475856)
                     /locus_tag="Sfla_0408"
                     /inference="protein motif:PFAM:PF01553"
                     /note="KEGG: sgr:SGR_699  acyltransferase;
                     PFAM: phospholipid/glycerol acyltransferase;
                     SMART: phospholipid/glycerol acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_004921391.1"
                     /db_xref="GI:357409655"
                     /db_xref="GO:0008415"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:11370132"
                     /translation="MNAWLPVAPCTPRDCARHEGARRAPLPAAALLLAGCVVTLLGVL
                     AVPAVLLLTPAHRDPLTRRWAYTVVRAFGVRIRVTGPAVESARPEAGELVVANHVSWL
                     DIPLVAAVLPARMVAKSEIRKWPLLGPFAALGGTLFIERDRLRALPGAVRTLAGALAS
                     GSRVAVFPQGSTWCGRGGGGRFRPAAFQAAIDAGAAVRPVRISYRTAGTNTAGAAAFV
                     GDDPLAASLWRVVTAAGLTAEIRILPPVPAGREPDRRALARAAQSAVASDRANLPASS
                     VHH"
     misc_feature    complement(475059..475655)
                     /locus_tag="Sfla_0408"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(475341..475349,475497..475508,
                     475548..475550,475554..475556,475563..475565))
                     /locus_tag="Sfla_0408"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(475853..476659)
                     /locus_tag="Sfla_0409"
                     /db_xref="GeneID:11370133"
     CDS             complement(475853..476659)
                     /locus_tag="Sfla_0409"
                     /inference="similar to AA sequence:KEGG:SGR_700"
                     /note="KEGG: sgr:SGR_700 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921392.1"
                     /db_xref="GI:357409656"
                     /db_xref="GeneID:11370133"
                     /translation="MTVLPLASPASAPAGVPAPRQAAPSGYRVALATCQDDVRAAQRL
                     RHLVFAGELGARLDSAEPGLDSDAFDTHCDHLLVREAATDEVVATYRLLPPEGARRAG
                     GLYAESEFDLGRLAPIRDDLVEVGRSCVHPAHRDGAVIALIWAGLARYMERTGHTWLA
                     GCCSVPLADGGALAARSWDTVRTHHLAPEEYWVTPHRLWDTTGHPGGGAGGRAALPPL
                     LRGYLRLGAWVCGAPAHDPDFGVADLYVLLSMRRTDPRYLRHFLSLAPLR"
     misc_feature    complement(475862..476659)
                     /locus_tag="Sfla_0409"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_5; cl17496"
                     /db_xref="CDD:266729"
     gene            complement(476827..478080)
                     /locus_tag="Sfla_0410"
                     /db_xref="GeneID:11370134"
     CDS             complement(476827..478080)
                     /locus_tag="Sfla_0410"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: sgr:SGR_701  sugar ABC transporter substrate-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_004921393.1"
                     /db_xref="GI:357409657"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:11370134"
                     /translation="MKIRILAGAVALVSSVALTGCGYLPGVDADSGTVTVWLMKGSAS
                     QGFLDRFKESYEAEHPSVELEFVLQEWGGIGPKVLKALDGDDAPDVIEVGNTQVAQYA
                     QSGQLRDLTLESLRDLGGEDWLPGLAEPGKVDGAQYGIPWYAANRVVIYNKDLFAQAG
                     ITELPTTRDEWVEVTERLNTTGQQGIYLAGQNWYVLAGFIWDEGGELADESGGDWQGA
                     LDSPAALRGMDFYKTLQALGDGPRDADEQTPPETDVFAEGTVAQIISVPGSAALIEQQ
                     NPELKGKLGYFPIPGKSAKKPGAVFTGGSDLIVPESADRRSEGVEVVKALAGEEWQTE
                     LARAMSYVPNKPALARVVEGQEGTSAMAQGATEGRATPNSPYWPAVEADNPIKPYMTA
                     VLEGGDPAEEAKKASDRISAKLVTG"
     misc_feature    complement(476872..478080)
                     /locus_tag="Sfla_0410"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    complement(477085..477918)
                     /locus_tag="Sfla_0410"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            478307..478522
                     /locus_tag="Sfla_0411"
                     /db_xref="GeneID:11370135"
     CDS             478307..478522
                     /locus_tag="Sfla_0411"
                     /inference="protein motif:PFAM:PF07311"
                     /note="PFAM: protein of unknown function DUF1458;
                     KEGG: scb:SCAB_11251 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921394.1"
                     /db_xref="GI:357409658"
                     /db_xref="InterPro:IPR009923"
                     /db_xref="GeneID:11370135"
                     /translation="MSNHTYRVTEIVGTSEEGLDAAIRNGVARASETLHHLDWFEMTQ
                     VRGHIEDGRIAHYQVGLKVGFRLDEKA"
     misc_feature    478316..478513
                     /locus_tag="Sfla_0411"
                     /note="Dodecin; Region: Dodecin; pfam07311"
                     /db_xref="CDD:254151"
     gene            complement(478623..478949)
                     /locus_tag="Sfla_0412"
                     /db_xref="GeneID:11370136"
     CDS             complement(478623..478949)
                     /locus_tag="Sfla_0412"
                     /inference="similar to AA sequence:KEGG:SGR_6448"
                     /note="KEGG: sgr:SGR_6448 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921395.1"
                     /db_xref="GI:357409659"
                     /db_xref="GeneID:11370136"
                     /translation="MPAGSSSKRERQYEHIKEGAEKRGTPTKRAKEIAARTVNKERAR
                     SGESGTASPASLRDPKSSSERGGLRSHRGAQGPTRDQLYEEARKRNVEGRSSMNKEQL
                     RKALGR"
     gene            479159..479350
                     /locus_tag="Sfla_0413"
                     /db_xref="GeneID:11370137"
     CDS             479159..479350
                     /locus_tag="Sfla_0413"
                     /inference="similar to AA sequence:KEGG:SAV_812"
                     /note="KEGG: sma:SAV_812 small hydrophilic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921396.1"
                     /db_xref="GI:357409660"
                     /db_xref="GeneID:11370137"
                     /translation="MSVAGESGGRVRQLRAKAQELNEAADRATDPEQRQRLQDKARRL
                     REQSEQESSMNDRGMDPMV"
     gene            479445..481871
                     /locus_tag="Sfla_0414"
                     /db_xref="GeneID:11370138"
     CDS             479445..481871
                     /locus_tag="Sfla_0414"
                     /inference="protein motif:TFAM:TIGR00630"
                     /note="TIGRFAM: excinuclease ABC, A subunit;
                     PFAM: ABC transporter related;
                     KEGG: sgr:SGR_704  excinuclease ABC subunit A;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_004921397.1"
                     /db_xref="GI:357409661"
                     /db_xref="GO:0009381"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004602"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11370138"
                     /translation="MSTPHDPYVRVRGAREHNLRDVDVDIPRDTLTVFTGVSGSGKSS
                     LAFGTIYAEAQRRYFESVAPYARRLIHQVGAPDVGEITGLPPAVSLEQRRSAPGARSS
                     VGTVTTLSNSLRMLLSRAGDYPPGAERLDSDAFSPNTAAGACPECHGLGLIHRTTEEL
                     LVPDPSLSIRDGAIAAWPGAWQGKNLRDVLDALGYDVERPWRELDTADREWILFTDEQ
                     PVVTVHPVRDAGRIQRPYQGTYMSARRHVMHTFADSRSRTLRAKAERFLTSAPCPVCG
                     GGRLRREALAVTFAGRTIAELVALPLTALTEVLLESGGGSDTARVLTADLLARIEPVT
                     ELGLGYLSLDRTAPTLSSGELQRLRLATQLRSGLFGVVYVLDEPSAGLHPADTESLLG
                     VLGRLREAGNSVFVVEHQMDVVRRADWLVDVGPLAGEHGGRVLHSGPPAGLAGVDGSA
                     TRRFLFDEDPAPAREPRVPTGWITLGGVDLHNVRGVDATFPLGVLTAVTGVSGSGKST
                     LVGQVLAGVLADRRPAESADGPAVPVTRGCASAEGLDAVDRLVQVDQRPIGRTPRSNL
                     ATYTGLFDVVRKLFAETETARARKYRAGRFSFNVAGGRCETCQGEGFVSVELLFLPST
                     YAPCPDCHGARYNPATLEVTLRGLTIAEVLDLTVEAAAGFLAGTPAAERSLRALLDVG
                     LGYLRLGQPATELSGGEAQRIKLATELQRARRGHTLYLLDEPTTGLHPADVEVLMRQL
                     HGLVDAGNSVVVVEHDMTVVAGADRVVDMGPGGGDGGGRIVATGTPREVARAAGSRTA
                     AYLAKALRPG"
     misc_feature    479466..481865
                     /locus_tag="Sfla_0414"
                     /note="Excinuclease ATPase subunit [DNA replication,
                     recombination, and repair]; Region: UvrA; COG0178"
                     /db_xref="CDD:223256"
     misc_feature    479469..480758
                     /locus_tag="Sfla_0414"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    <480279..480698
                     /locus_tag="Sfla_0414"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    480303..480311
                     /locus_tag="Sfla_0414"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    480492..480521
                     /locus_tag="Sfla_0414"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(480561..480569,480570..480575)
                     /locus_tag="Sfla_0414"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    480582..480593
                     /locus_tag="Sfla_0414"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    480657..480677
                     /locus_tag="Sfla_0414"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    480861..481802
                     /locus_tag="Sfla_0414"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    480942..480965
                     /locus_tag="Sfla_0414"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(480951..480956,480960..480968,481107..481109,
                     481608..481613,481707..481709)
                     /locus_tag="Sfla_0414"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    481098..481109
                     /locus_tag="Sfla_0414"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    481527..481556
                     /locus_tag="Sfla_0414"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    481596..481613
                     /locus_tag="Sfla_0414"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    481620..481631
                     /locus_tag="Sfla_0414"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    481695..481715
                     /locus_tag="Sfla_0414"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(481894..482640)
                     /locus_tag="Sfla_0415"
                     /db_xref="GeneID:11370139"
     CDS             complement(481894..482640)
                     /locus_tag="Sfla_0415"
                     /inference="protein motif:TFAM:TIGR00384"
                     /note="TIGRFAM: succinate dehydrogenase and fumarate
                     reductase iron-sulfur protein;
                     KEGG: sgr:SGR_705 succinate dehydrogenase/fumarate
                     reductase iron-sulfur subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase and fumarate reductase
                     iron-sulfur protein"
                     /protein_id="YP_004921398.1"
                     /db_xref="GI:357409662"
                     /db_xref="GO:0016491"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:11370139"
                     /translation="MKLTLRVWRQQNAEAPGAMATYEVDGISQDMSFLEMLDTLNEEL
                     ILGGDEPVAFDHDCREGICGACSLVINGDAHGPERTTTCQLHMRSFDDGDTIDIEPWR
                     ASAFPVVKDLVVDRSSFDRIIQAGGYISAPTGTAPDAHATPVPKPDADSAFEHAECIG
                     CGACVAACPNGSAMLFTSAKVNHLNVLPQGAPERETRVLDMVATMDDEGFGGCTLTGE
                     CATACPKGIPLPSITAMNKEWLRATRKVRR"
     misc_feature    complement(481897..482640)
                     /locus_tag="Sfla_0415"
                     /note="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit; Validated; Region: PRK07570"
                     /db_xref="CDD:181038"
     misc_feature    complement(482278..482631)
                     /locus_tag="Sfla_0415"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_3; pfam13085"
                     /db_xref="CDD:257488"
     misc_feature    complement(481960..482169)
                     /locus_tag="Sfla_0415"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     gene            complement(482637..484595)
                     /locus_tag="Sfla_0416"
                     /db_xref="GeneID:11370140"
     CDS             complement(482637..484595)
                     /locus_tag="Sfla_0416"
                     /inference="protein motif:TFAM:TIGR01811"
                     /note="TIGRFAM: succinate dehydrogenase or fumarate
                     reductase, flavoprotein subunit;
                     KEGG: sgr:SGR_706 succinate dehydrogenase flavoprotein
                     subunit;
                     PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase or fumarate reductase,
                     flavoprotein subunit"
                     /protein_id="YP_004921399.1"
                     /db_xref="GI:357409663"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="InterPro:IPR011280"
                     /db_xref="GeneID:11370140"
                     /translation="MPDLSDYTNYRTGEPLVDAKAPTGPVAERWDTRRFEAKLVNPAN
                     RRKHTVIVVGTGLAGGSAGATLAEQGYHVVQFCFQDSPRRAHSVAAQGGINAAKNYRN
                     DGDSVHRLFYDTVKGGDFRARESNVHRLAEISVEIIDQCVAQGVPFAREYGGLLDNRS
                     FGGVQVSRTFYARGQTGQQLLLGAYQALSRQIAAGNVELYSRTEMLDLVVVDGKARGI
                     VARDLVTGKIDTYFADAVVLASGGYGNVFYLSTNAMNSNATAIWRAHRRGAWFANPCF
                     TQIHPTCIPRTGDHQSKLTLMSESLRNDGRIWVPKAKGDDRPANRIPEDERDYYLERV
                     YPAFGNLVPRDIASRAAKNVCDEGRGVGPGGQGVYLDFAEAIERMGRKKVEEKYGNLF
                     DMYARITAEDPYETPMRIYPAVHYTMGGLWVDYDLQTTIPGLFAIGEANFSDHGANRL
                     GASALMQGLADGYFVLPSTINDYLARNPHTEEIDAGHPAVAEAVAETEDRLNLLLAVD
                     GDRTPDSFHREIGELMWEFCGMARTEEGLRKALGRIPQIREEFWRRIKVPGTGEQFNQ
                     SLEKANRVVDYLELAELMCLDALHRAESCGGHFREESQTPDGEAARRDEEFSYAAAWE
                     FSATGDAPVLHKEDLVFEYVHPTQRSYA"
     misc_feature    complement(482643..484559)
                     /locus_tag="Sfla_0416"
                     /note="succinate dehydrogenase flavoprotein subunit;
                     Reviewed; Region: sdhA; PRK07573"
                     /db_xref="CDD:236054"
     misc_feature    complement(483219..484448)
                     /locus_tag="Sfla_0416"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    complement(482643..483047)
                     /locus_tag="Sfla_0416"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:251613"
     gene            complement(484597..485364)
                     /locus_tag="Sfla_0417"
                     /db_xref="GeneID:11370141"
     CDS             complement(484597..485364)
                     /locus_tag="Sfla_0417"
                     /inference="protein motif:TFAM:TIGR02046"
                     /note="TIGRFAM: succinate dehydrogenase (or fumarate
                     reductase) cytochrome b subunit, b558 family;
                     KEGG: sma:SAV_7307 cytochrome b subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase (or fumarate reductase)
                     cytochrome b subunit, b558 family"
                     /protein_id="YP_004921400.1"
                     /db_xref="GI:357409664"
                     /db_xref="InterPro:IPR011138"
                     /db_xref="GeneID:11370141"
                     /translation="MEMRRFMSWTDEDFPSSVVSMALATRTDRRPSMTRTLWDSSVGK
                     KTIMAVSGLVMLGYLVVHMLGNLKIFFGSDEFNHYAHWLRTLGEPFLHYEWALWIVRV
                     VLVAAVVLHAVSAYQLSRRDLRARPTAYVHRKARSSYATRTMRYGGVILALFIVWHIL
                     DLTTGTVHSGGFQSGHPYQNVLDTFSTWYGNVIYIVAVLALGLHVQHGFWSAAQTLGV
                     GSATRDRVLKTLANVLAVVLTAGFVSVPVAVMTGVVS"
     misc_feature    complement(484603..485247)
                     /locus_tag="Sfla_0417"
                     /note="succinate dehydrogenase (or fumarate reductase)
                     cytochrome b subunit, b558 family; Region: sdhC_b558_fam;
                     TIGR02046"
                     /db_xref="CDD:131101"
     misc_feature    complement(484606..485235)
                     /locus_tag="Sfla_0417"
                     /note="Succinate:quinone oxidoreductase (SQR)-like Type B
                     subfamily 2, transmembrane subunit; composed of proteins
                     with similarity to the SQRs of Geobacter metallireducens
                     and Corynebacterium glutamicum. SQR catalyzes the
                     oxidation of succinate to fumarate...; Region:
                     SQR_TypeB_2_TM; cd03498"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(484693..484695,484717..484722,
                     484732..484734,484942..484944,484966..484968,
                     484972..484974,485011..485013,485230..485232))
                     /locus_tag="Sfla_0417"
                     /note="putative Iron-sulfur protein interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(484720..484722,484729..484731,
                     484741..484743,484753..484755,484921..484923,
                     484942..484944,485020..485022,485029..485034,
                     485200..485202,485209..485211,485218..485223))
                     /locus_tag="Sfla_0417"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(484627..484629,484639..484641,
                     484783..484785,484813..484815,484822..484824,
                     484879..484881,484891..484893,485179..485181,
                     485191..485193))
                     /locus_tag="Sfla_0417"
                     /note="distal heme binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(484786..484788,484798..484803,
                     484873..484875,484885..484887,484894..484899,
                     484906..484911,484975..484977,484987..484989,
                     485014..485019))
                     /locus_tag="Sfla_0417"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239578"
     gene            485400..486332
                     /locus_tag="Sfla_0418"
                     /db_xref="GeneID:11370142"
     CDS             485400..486332
                     /locus_tag="Sfla_0418"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: sgr:SGR_708 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004921401.1"
                     /db_xref="GI:357409665"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:11370142"
                     /translation="MHFQQLAYFVAVAEARHFTRAAEEVHVSQPSLSQQIKALENELG
                     AELFSRARGNIALTDAGEALLPLARRILADADTARHEVQELVQLRRGRVRLGATPSVC
                     TGLLPDVLRAFHGAHPGIQLLIEEGGSHDLVRQLARGALDLALLVLPLPAASPALTTV
                     ELLHEDLVVVSPASRPAPGREGSVHVADLENEPLVMFRHGYDLRELTVAACRAEGFEP
                     SFTVEGGEMDAVLGFVRAGLGIAVVPRMVAVRAGQDLRTTPLASPGLRRTIALAHRSD
                     VEPPRAARELQRMLLGSGHPAVPSAADGPRPADG"
     misc_feature    485400..486272
                     /locus_tag="Sfla_0418"
                     /note="DNA-binding transcriptional regulator CynR;
                     Provisional; Region: PRK11242"
                     /db_xref="CDD:183051"
     misc_feature    485406..485585
                     /locus_tag="Sfla_0418"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    485673..486269
                     /locus_tag="Sfla_0418"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(485718..485723,485727..485732,485739..485741,
                     485751..485753,485757..485777,486060..486077,
                     486093..486098,486102..486107)
                     /locus_tag="Sfla_0418"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(486344..488518)
                     /locus_tag="Sfla_0419"
                     /db_xref="GeneID:11370143"
     CDS             complement(486344..488518)
                     /locus_tag="Sfla_0419"
                     /inference="protein motif:TFAM:TIGR00254"
                     /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
                     PFAM: EAL domain protein; GGDEF domain containing protein;
                     PAS fold-4 domain protein;
                     KEGG: sgr:SGR_709 hypothetical protein;
                     SMART: EAL domain protein; GGDEF domain containing
                     protein; PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor-containing diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="YP_004921402.1"
                     /db_xref="GI:357409666"
                     /db_xref="GO:0004871"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="GeneID:11370143"
                     /translation="MSIPSQPSGAPDAEPDGPEGRLRRFATIWSRAIFPSTATSLTRP
                     EFEEHLLPLARELSDTLHRRVFDAAPAHRVGAGLVAAHCTDPDALSSTLGVVDSYLVL
                     YCGGNGPVELSTEDSRARCARIQHALAGGFTQALRERTLAEQEAIARSALTARSHAEQ
                     ALHATEARFRAVFKDAAVGIGIADLDGNILEINDTLTRMFGGLENHVRSHKVNEWVHP
                     EDSPHVWKYYEELVRGEREHYSVEKPYYRNDGTVLWTNLTVSLLRDPEGRPEYQLALL
                     EDTTERRLLNLRLRYEATHDALTGLPNRTLFFERLEKALAPREGMRFGLCYLDLDGFK
                     AINDSLGHAAGDRLLVEVADRLQSCATAPGEMVARLGGDEFVALTTGPRTEDEVHELA
                     GRILLALATPVRLDGRELTVRGSIGVVEGPSGERTPAEVLRSADITMYRAKAAGGNRF
                     ALADAEADARAITRHGLTTALPTALDRGEFFIEYQPLVHLGDGSVHGAEALVRWCHPQ
                     HGVLGPDRFIPLAEHTGLIVPLGRWVLEESVRQANFWKERHTDGGPLRINVNLSPTQL
                     HHPSLVAETVDVLERSGLEPGALCLEVTESALIGADDDLLKPLRQLAEMGVDIALDDF
                     GTGYSNLANLRRLPVSVLKLDRSFTQGMQHHPADPVDLKIVEGIVSLAHSLDLAVTVE
                     GVETGAQAEQLRQIGCDTAQGWYYARPGAPDRIHSLLLADAV"
     misc_feature    complement(487676..488023)
                     /locus_tag="Sfla_0419"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(487685..487993)
                     /locus_tag="Sfla_0419"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(487769..487771,487784..487786,
                     487865..487876,487913..487915,487931..487933,
                     487943..487945))
                     /locus_tag="Sfla_0419"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(487742..487744,487748..487750,
                     487835..487840,487847..487849,487871..487873,
                     487883..487885))
                     /locus_tag="Sfla_0419"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(487166..487639)
                     /locus_tag="Sfla_0419"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(487400..487402,487532..487534))
                     /locus_tag="Sfla_0419"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(487397..487408,487412..487414,
                     487481..487483,487493..487495,487505..487510,
                     487517..487519))
                     /locus_tag="Sfla_0419"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(487337..487339,487424..487426))
                     /locus_tag="Sfla_0419"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(486377..487114)
                     /locus_tag="Sfla_0419"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(488515..489333)
                     /locus_tag="Sfla_0420"
                     /db_xref="GeneID:11370144"
     CDS             complement(488515..489333)
                     /locus_tag="Sfla_0420"
                     /inference="protein motif:PFAM:PF04672"
                     /note="PFAM: protein of unknown function DUF574;
                     KEGG: sgr:SGR_710 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921403.1"
                     /db_xref="GI:357409667"
                     /db_xref="InterPro:IPR006764"
                     /db_xref="GeneID:11370144"
                     /translation="MERPAWAPQGIDISVPSVSRMYDFYLGGSHNFEVDREAARKAME
                     FMPGLPKVMQANRAFMRRAVHHATTLGVNQFLDIGSGIPTFGNVHEVAQAADPEARVA
                     YVDHDPVAVAHSQAVLEGNERAVIAAADLRKPKDILDNPEVNALLDLDRPVALLLVAV
                     LHFIEDADGPYAAVAELRDALAPGSLLVLTHASYEGIPLPQEEAGGTVDVYRTIRNPL
                     IMRTRKEISRFFEGYEMIDPGLVAMPEWRPESAEALAQEDPFTYSGFAGVGRKA"
     misc_feature    complement(488764..489111)
                     /locus_tag="Sfla_0420"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(488860..488862,488941..488949,
                     489016..489021,489082..489102))
                     /locus_tag="Sfla_0420"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(489538..490497)
                     /locus_tag="Sfla_0421"
                     /db_xref="GeneID:11370145"
     CDS             complement(489538..490497)
                     /locus_tag="Sfla_0421"
                     /inference="similar to AA sequence:KEGG:SAV_7302"
                     /note="KEGG: sma:SAV_7302 lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_004921404.1"
                     /db_xref="GI:357409668"
                     /db_xref="InterPro:IPR005297"
                     /db_xref="GeneID:11370145"
                     /translation="MNTWRNASLAVTAAALLALTTACGQEQGAETPGGQAVGNAAPAR
                     QPADGGYGSDGGYGSEAAAGAAPKEAGQLAVWDSKKLGEVLTDSEGFTLYRFDKDTAE
                     PPASRCEGDCAEIWPAVAARNAEAAAGTDASLIGEVTRGDGTKQLTVAGWPMYRYAQD
                     TGPGEAKGQGVGGTWFAAAPDGKKAVVNADGPSAGEQADLAGLSVRKDPQLGDIVVDK
                     RGMTVYRFKKDSAWPMKSACTGDCLKKWPVVPPVSKNDVEGVTTKGFVTFGRPDGIQQ
                     QSLDCWPLYTFSGDSEPGDTNGQGVGGTWYAVSPGAKLVGAPK"
     misc_feature    complement(490147..490254)
                     /locus_tag="Sfla_0421"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     misc_feature    complement(489961..490092)
                     /locus_tag="Sfla_0421"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     misc_feature    complement(489568..489969)
                     /locus_tag="Sfla_0421"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4315"
                     /db_xref="CDD:226765"
     misc_feature    complement(489751..489897)
                     /locus_tag="Sfla_0421"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     misc_feature    complement(489574..489699)
                     /locus_tag="Sfla_0421"
                     /note="Secreted repeat of unknown function; Region:
                     Lipoprotein_15; pfam03640"
                     /db_xref="CDD:252078"
     gene            491242..492009
                     /locus_tag="Sfla_0422"
                     /db_xref="GeneID:11370146"
     CDS             491242..492009
                     /locus_tag="Sfla_0422"
                     /inference="similar to AA sequence:KEGG:SGR_711"
                     /note="KEGG: sgr:SGR_711  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921405.1"
                     /db_xref="GI:357409669"
                     /db_xref="GeneID:11370146"
                     /translation="MSEWLVLTIAMASACAVVLTTAVLSNRRIADDDDPSQTPDVIEY
                     MTMMIGVVYAIVLGLAIAGVWEGRSAAQESVRMEAQALHEVSARSAVYPVEVRDRIRK
                     DVDAYVAHVVGAEWKSMTDDGNLTEEGTRLLDRVRADVTEYKPRTDHEGQAYQPLVDQ
                     VAAADDARGSRGQNAGATMPGVVWFGLITGAVVTVGLIFTLQIRRTFRELLLAGLFSV
                     LIAFLLFLIWDFDAPFGRGISATTAPFVDLFPRATGG"
     misc_feature    491386..491943
                     /locus_tag="Sfla_0422"
                     /note="Protein of unknown function (DUF4239); Region:
                     DUF4239; pfam14023"
                     /db_xref="CDD:258258"
     gene            492199..492723
                     /locus_tag="Sfla_0423"
                     /db_xref="GeneID:11370147"
     CDS             492199..492723
                     /locus_tag="Sfla_0423"
                     /inference="similar to AA sequence:KEGG:SGR_712"
                     /note="KEGG: sgr:SGR_712 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921406.1"
                     /db_xref="GI:357409670"
                     /db_xref="GeneID:11370147"
                     /translation="MRAIRVAPVALLGAAACLLMAPAASADVLNGGTSTSFTPTITPS
                     TVAPGGRVTLGAMGCTSDATAFSGVFDTTTIPSGRSATTTVDQDARRGAVYEVTFRCG
                     TTTRSANLTITSGATSSPTTSSTSSPSGVLGGLGGSVDTMDPTEIAAGSALVAVASAG
                     ALYVLRKRRTGRQH"
     gene            complement(492819..493490)
                     /locus_tag="Sfla_0424"
                     /db_xref="GeneID:11370148"
     CDS             complement(492819..493490)
                     /locus_tag="Sfla_0424"
                     /inference="similar to AA sequence:KEGG:SGR_713"
                     /note="KEGG: sgr:SGR_713 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921407.1"
                     /db_xref="GI:357409671"
                     /db_xref="GeneID:11370148"
                     /translation="MRASRALAVTATAFAAVGLAAPLAAAGGGPGSNPSNFPTNVTVN
                     PSSVFQGATMHVSAEGCGRSGGKVWSNAFPTVNLSPGRVGYATARIRDNATPGQYSLS
                     VRCNDSDNNFGGGNGGDGGQGGNGGQSGQSGHGGQGGNGGQGGGNGGNGGQGGNGGQG
                     GGNGDPVATARFTVLPSRGAHGGLGGSMGPSSVEMQVGGGLVAAAAVGGAVFVVRRRM
                     NNAAI"
     gene            493815..494477
                     /locus_tag="Sfla_0425"
                     /db_xref="GeneID:11370149"
     CDS             493815..494477
                     /locus_tag="Sfla_0425"
                     /inference="protein motif:PFAM:PF04203"
                     /note="PFAM: peptidase C60 sortase A and B;
                     KEGG: sgr:SGR_714 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C60 sortase A and B"
                     /protein_id="YP_004921408.1"
                     /db_xref="GI:357409672"
                     /db_xref="InterPro:IPR005754"
                     /db_xref="GeneID:11370149"
                     /translation="MGRDQWGGERSRRTPWGAIALVMLTGLALMRNGAETSPGPPQPA
                     AAASVAGPREAAVSAPLDGEPVQPLAYAPVERIRIPSIEVDAPVVDVNLDPAGWIEAP
                     PAQDPNLAGWYQNGIAPGQRGTAVMVGHVDNLAGPAVFYGLGSLDKGRQIEVSRYDGR
                     VAVFEIYGVEVFSKNDFPGSRVYGDTGYAELRVITCGGGYTKAAGYDGNVVVFARLVE
                     TR"
     misc_feature    494028..494462
                     /locus_tag="Sfla_0425"
                     /note="Sortase E (SrtE) is a membrane transpeptidase found
                     in gram-positive bacteria that cleaves surface proteins at
                     a cell sorting motif and catalyzes a transpeptidation
                     reaction in which the surface protein substrate is
                     covalently linked to peptidoglycan for...; Region:
                     Sortase_E; cd05829"
                     /db_xref="CDD:99712"
     misc_feature    order(494097..494099,494154..494156,494190..494192,
                     494196..494198,494202..494204,494397..494402,
                     494430..494432,494439..494441)
                     /locus_tag="Sfla_0425"
                     /note="active site"
                     /db_xref="CDD:99712"
     misc_feature    order(494202..494204,494400..494402,494439..494441)
                     /locus_tag="Sfla_0425"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:99712"
     gene            complement(494502..495347)
                     /locus_tag="Sfla_0426"
                     /db_xref="GeneID:11370150"
     CDS             complement(494502..495347)
                     /locus_tag="Sfla_0426"
                     /inference="protein motif:PFAM:PF01522"
                     /note="PFAM: polysaccharide deacetylase;
                     KEGG: sgr:SGR_715  oligosaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_004921409.1"
                     /db_xref="GI:357409673"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR017909"
                     /db_xref="GeneID:11370150"
                     /translation="MKHDQIPAERRTFLRLALALGAATAVRMIAADPAGTPTRPGGEP
                     PAPAAGPPARAQAGPGSYRLRPMTSGTPPRFRPAPPPVRTRPFEEMPGLGSDAMVLSF
                     DDGPDPRYTPDILATLRRYDVRAMFFVCGEMAADNRDLLREMSDDGHVVGNHSWSHPL
                     IPKLPRGAIRDELGSTSEVVERTLGVPPLWYRAPYGAWNRNSFEIGAALGMEPMAWTV
                     DTLDWTEPGTDTIVRRVEKGAAPGVVVLSHDAGGNRSQSVAALRRYLPALLEKGYRPT
                     VPRRS"
     misc_feature    complement(494526..>495077)
                     /locus_tag="Sfla_0426"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    complement(494544..495053)
                     /locus_tag="Sfla_0426"
                     /note="Catalytic NodB homology domain of rhizobial
                     NodB-like proteins; Region: CE4_NodB_like_6s_7s; cd10917"
                     /db_xref="CDD:213022"
     misc_feature    complement(order(494604..494606,494610..494612,
                     494679..494684,494700..494702,494763..494768,
                     494772..494774,494871..494888,495036..495047))
                     /locus_tag="Sfla_0426"
                     /note="NodB motif; other site"
                     /db_xref="CDD:213022"
     misc_feature    complement(order(494604..494606,494610..494612,
                     494700..494702,494760..494768,494874..494876,
                     494886..494888,495036..495041))
                     /locus_tag="Sfla_0426"
                     /note="active site"
                     /db_xref="CDD:213022"
     misc_feature    complement(order(494604..494606,494682..494684,
                     494772..494774,495039..495041))
                     /locus_tag="Sfla_0426"
                     /note="catalytic site [active]"
                     /db_xref="CDD:213022"
     misc_feature    complement(order(494874..494876,494886..494888,
                     495036..495038))
                     /locus_tag="Sfla_0426"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213022"
     gene            495454..495987
                     /locus_tag="Sfla_0427"
                     /db_xref="GeneID:11370151"
     CDS             495454..495987
                     /locus_tag="Sfla_0427"
                     /inference="protein motif:PFAM:PF00582"
                     /note="PFAM: UspA domain-containing protein;
                     KEGG: sgr:SGR_716 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_004921410.1"
                     /db_xref="GI:357409674"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="GeneID:11370151"
                     /translation="MPVTHAGHAEAPGALCTGATTLGAVTDQQQHRFERGTDGPKVIV
                     AGIDGSQSSMRAAAYAAGLARRQNAMLALVYVQPVLSAGAALGAPVADATGEVAEELV
                     NEIRTAAERLKDTWNVRWEFHTFHGDPYNGLVTASDELKADAVIVGASESAGHRFIGS
                     VAVRLVKAGRWPVTVVP"
     misc_feature    495580..495981
                     /locus_tag="Sfla_0427"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(495589..495597,495679..495681,495892..495897,
                     495901..495906,495928..495939)
                     /locus_tag="Sfla_0427"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(496040..497239)
                     /locus_tag="Sfla_0428"
                     /db_xref="GeneID:11370152"
     CDS             complement(496040..497239)
                     /locus_tag="Sfla_0428"
                     /inference="protein motif:PFAM:PF09587"
                     /note="KEGG: sgr:SGR_717 hypothetical protein;
                     PFAM: Capsule synthesis protein, CapA;
                     SMART: Capsule synthesis protein, CapA"
                     /codon_start=1
                     /transl_table=11
                     /product="capsule synthesis protein CapA"
                     /protein_id="YP_004921411.1"
                     /db_xref="GI:357409675"
                     /db_xref="InterPro:IPR019079"
                     /db_xref="GeneID:11370152"
                     /translation="MTKRIRQGAAIAVAGLLATATACTGQQSSTPGFAGRHLSAGPGA
                     NGAGAGGEDGADSFTLLASGDVLPHSSIIDRAAADAGGAGYDFRPMLKGAAPAVSGAD
                     LAICHMETVYGRNGGPYTGYPDFRSPPEVATALRATGYDSCSTASNHTLDDGTQGIRR
                     TLDALDRAGIAHAGSARSAEESSRPTMLRAGKGKDAAKVAHLAYTYGTNDRTLPDGQP
                     WAVNLIDKDRIVADARTAREAGADVVVVSLHWGTEWQERPDDDQLDLGHALTASTTGK
                     RPDIDLIIGTHAHVPQAYEKVNGTWIVYGMGDQVAGAMVDDAGVRDPRANESSMGRFT
                     FERPAEPGRRWEVRKAEFLPQLFDPEAARVVGLDREAGRLREIRERIQGVVLSRGAAQ
                     DGLVAGK"
     misc_feature    complement(496310..497062)
                     /locus_tag="Sfla_0428"
                     /note="CapA and related proteins, metallophosphatase
                     domain; Region: MPP_CapA; cd07381"
                     /db_xref="CDD:163624"
     misc_feature    complement(order(496373..496375,496379..496381,
                     496493..496495,496793..496798,496913..496915,
                     497039..497041,497045..497047))
                     /locus_tag="Sfla_0428"
                     /note="putative active site [active]"
                     /db_xref="CDD:163624"
     misc_feature    complement(order(496373..496375,496379..496381,
                     496493..496495,496796..496798,496913..496915,
                     497039..497041,497045..497047))
                     /locus_tag="Sfla_0428"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163624"
     gene            497498..498067
                     /locus_tag="Sfla_0429"
                     /db_xref="GeneID:11370153"
     CDS             497498..498067
                     /locus_tag="Sfla_0429"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="KEGG: sgr:SGR_718 RNA polymerase sigma factor SigL;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
                     type 2"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_004921412.1"
                     /db_xref="GI:357409676"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0016987"
                     /db_xref="InterPro:IPR000838"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:11370153"
                     /translation="MTTATTDERALAELQREHGPALFHFLLGLTFGDRQRAEDLLQET
                     LVRAWQHPEAFDAPYESMRPWLFTVARRLAIDARRSRQARPTEVSDAVLESAPARDDT
                     AAAAVHSLDVREAVRTLSPEHRAVLVQIYFRGLSVGETAQVLGIPPGTVKSRSYYALR
                     LLSRTLPGYSSRSSTSTSASRDTASTTST"
     misc_feature    497498..498004
                     /locus_tag="Sfla_0429"
                     /note="RNA polymerase sigma factor SigL; Provisional;
                     Region: PRK09645"
                     /db_xref="CDD:236605"
     misc_feature    497543..497749
                     /locus_tag="Sfla_0429"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    497825..497983
                     /locus_tag="Sfla_0429"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(497855..497857,497885..497887,497903..497908,
                     497936..497938,497942..497947,497951..497959,
                     497963..497968,497972..497974)
                     /locus_tag="Sfla_0429"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(498001..498198)
                     /locus_tag="Sfla_0430"
                     /db_xref="GeneID:11370154"
     CDS             complement(498001..498198)
                     /locus_tag="Sfla_0430"
                     /inference="similar to AA sequence:KEGG:Caci_3980"
                     /note="KEGG: cai:Caci_3980 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921413.1"
                     /db_xref="GI:357409677"
                     /db_xref="GeneID:11370154"
                     /translation="MTTDRGDDPHVRQTLGAYVLDALDARESGQVARHLQRCEVCAAA
                     YVEVVDAVSLLALVDVDDLLE"
     gene            498310..498822
                     /locus_tag="Sfla_0431"
                     /db_xref="GeneID:11370155"
     CDS             498310..498822
                     /locus_tag="Sfla_0431"
                     /inference="similar to AA sequence:KEGG:SGR_719"
                     /note="KEGG: sgr:SGR_719 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921414.1"
                     /db_xref="GI:357409678"
                     /db_xref="GeneID:11370155"
                     /translation="MRPEHYEESGGDGLLVPMAWMYSEYIADELLVTGDLMEPTTLEY
                     RAGRDALALTIFLSDGAATEELPVARVDELRLLTAYGASWRHWVCARLEALERPTAPA
                     GLPDPGLALARAAWRWLEETELLAADLDAIGPPPWEPSDADDEAGEVRVWTPAWQLGL
                     PLGHLAVHLH"
     gene            complement(498835..500061)
                     /locus_tag="Sfla_0432"
                     /db_xref="GeneID:11370156"
     CDS             complement(498835..500061)
                     /locus_tag="Sfla_0432"
                     /inference="protein motif:PFAM:PF06580"
                     /note="PFAM: histidine kinase internal region; ATP-binding
                     region ATPase domain protein;
                     KEGG: sgr:SGR_720  two-component system sensor kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase LytS"
                     /protein_id="YP_004921415.1"
                     /db_xref="GI:357409679"
                     /db_xref="GO:0000155"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR010559"
                     /db_xref="GeneID:11370156"
                     /translation="MTGAGIAVIALLALLLFGTGFLLGRTARPVRTSDVGTPVEHATF
                     ETLHTASLAAPPLRSGLTEESARRSARRLRSLLGTDALCLTDRDRVLVWDGEGDHHGK
                     DVMEQVEGLLASGRDTAFHSDCGDLDCTLRWAVAVPLTVDHRVLGTLVAYAPRESAVL
                     ARAAGEVARWVCVQLELAELDRSRTQIVEAEIKALRAQISPHFIFNSLAAIASFVRTD
                     PERARELLLEFADFTRYSFRRHGEFTTLADELHSIDQYLALVRARFGARLSVTLQVAP
                     EVLPVSLPFLCLQPLVENAVKHGLEGAVTLPRPHGPVRAVDAPIRVTISALDAGAEAE
                     VVIEDDGTGMDPERLRRILRGEGGASAGIGLLNVDERLRQVYGDDYGLVIETGVGAGM
                     KITLRLPKYRAGVHGS"
     misc_feature    complement(499246..499491)
                     /locus_tag="Sfla_0432"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    complement(498868..499200)
                     /locus_tag="Sfla_0432"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(498880..498882,498886..498891,
                     498904..498906,498910..498912,498967..498978,
                     499030..499035,499039..499041,499045..499047,
                     499051..499053,499171..499173,499180..499182,
                     499192..499194))
                     /locus_tag="Sfla_0432"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(499180..499182)
                     /locus_tag="Sfla_0432"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(498970..498972,498976..498978,
                     499033..499035,499039..499041))
                     /locus_tag="Sfla_0432"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(500058..501548)
                     /locus_tag="Sfla_0433"
                     /db_xref="GeneID:11370157"
     CDS             complement(500058..501548)
                     /locus_tag="Sfla_0433"
                     /inference="protein motif:PFAM:PF00474"
                     /note="PFAM: Na+/solute symporter;
                     KEGG: sgr:SGR_721  sodium:solute symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/solute symporter"
                     /protein_id="YP_004921416.1"
                     /db_xref="GI:357409680"
                     /db_xref="GO:0005215"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR018212"
                     /db_xref="GeneID:11370157"
                     /translation="MSAPGHPASVVAVALVVLATVLVGGFGLRISRTTSDFYVASRTV
                     RPRLNAAAISGEYLSAASFLGIAGLVLVHGPDMLWYPVGYTAGYLVLLVFVAAPLRRS
                     GAYTLPDFAEGRLESRQVRRLVSVFVVGAGWVYLVPQLQGAGLTLKILTGAPGWLGDV
                     LVASVVVIAVAAGGMRSITFVQVFQYWLKLTALLVPAIFLVLAWQGDGRPRVTFDEQI
                     SVFRADHPLYATYGLIIATFLGTMGLPHVVVRFYTSPNGRDARRTTVAVLALVGLFYL
                     LPPVYGALGRLYAPDFMHGGDADAAVLLLPARVIGGLGGDLLGALLAGGAFAAFLSTA
                     SGLTMAVAGVITQDVLPSRGVRHFRLATVLAIAVPLAGSLLVSRVPVADAVGMAFAVS
                     ASSFCPLLVLGIWWRRLTPPGAIAGLLLGGGSALLSVAITVSGAVRPPGWPHALLAWP
                     AVWSVPVGFLAMILVSLATPGRIPPGTNAAMTRFHLPEALAAGRVR"
     misc_feature    complement(500145..501479)
                     /locus_tag="Sfla_0433"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u4; cd11480"
                     /db_xref="CDD:212050"
     misc_feature    complement(order(500550..500555,500562..500564,
                     501375..501377,501384..501386))
                     /locus_tag="Sfla_0433"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212050"
     gene            complement(501545..501907)
                     /locus_tag="Sfla_0434"
                     /db_xref="GeneID:11370158"
     CDS             complement(501545..501907)
                     /locus_tag="Sfla_0434"
                     /inference="similar to AA sequence:KEGG:SGR_722"
                     /note="KEGG: sgr:SGR_722 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004921417.1"
                     /db_xref="GI:357409681"
                     /db_xref="GeneID:11370158"
                     /translation="MSAESTPRREVVTGEPRRVRPLPRYRAQSEIDEQTALGGAYVRS
                     LMRSQLRAGLTVFAVLATVAGTLPLLFEALGSDALVWGVLGFATCPPLTLAAWWYVRR
                     AERNERDFARLVEGLPSP"
     misc_feature    complement(501578..>501787)
                     /locus_tag="Sfla_0434"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:260505"
     gene            complement(501970..502881)
                     /locus_tag="Sfla_0435"
                     /db_xref="GeneID:11370159"
     CDS             complement(501970..502881)
                     /locus_tag="Sfla_0435"
                     /inference="protein motif:PFAM:PF04397"
                     /note="KEGG: sgr:SGR_723  two-component system response
                     regulator;
                     PFAM: LytTr DNA-binding region; response regulator
                     receiver;
                     SMART: LytTr DNA-binding region; response regulator
                     receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="LytTR family two component transcriptional
                     regulator"
                     /protein_id="YP_004921418.1"
                     /db_xref="GI:357409682"
                     /db_xref="GO:0000156"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR007492"
                     /db_xref="GeneID:11370159"
                     /translation="MLLEPADVGSPEHPERVGSGVAVRFGGAHVLTYVTNPGTTHAVP
                     PPEHLNSGLMLRVLAVDDEEPALEELLYLLRADPRIRSAEGATGATEALRRIGAAVDA
                     GPDDPSAIDVVFLDIHMAGLTGLDVAQLLAGFAAPPLIVFVTAHEGFAVHAFDLKAVD
                     YVLKPVRRERLAEAVRRVAEQVGERTASVHDAAADQIAVELGGVIRFVPVDDIAYAEA
                     QGDYARLHTSSGSHLVRIPLTTLEERWRSRGFVRIHRRHLVALNRIDELRLDAGSMSV
                     RIGDAELAVSRRHTRSLRDLLMRQTGR"
     misc_feature    complement(501991..502722)
                     /locus_tag="Sfla_0435"
                     /note="Response regulator of the LytR/AlgR family
                     [Transcription / Signal transduction mechanisms]; Region:
                     LytT; COG3279"
                     /db_xref="CDD:225818"
     misc_feature    complement(502345..502710)
                     /locus_tag="Sfla_0435"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(502387..502392,502399..502401,
                     502450..502452,502510..502512,502534..502536,
                     502696..502701))
                     /locus_tag="Sfla_0435"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(502534..502536)
                     /locus_tag="Sfla_0435"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(502510..502518,502522..502527))
                     /locus_tag="Sfla_0435"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(502384..502392)
                     /locus_tag="Sfla_0435"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(501994..502269)
                     /locus_tag="Sfla_0435"
                     /note="LytTr DNA-binding domain; Region: LytTR;
                     smart00850"
                     /db_xref="CDD:197918"
     gene            complement(503016..503876)
                     /locus_tag="Sfla_0436"
                     /db_xref="GeneID:11370160"
     CDS             complement(503016..503876)
                     /locus_tag="Sfla_0436"
                     /inference="protein motif:PRIAM:4.2.99.18"
                     /note="PFAM: DNA glycosylase/AP lyase, H2TH DNA-binding;
                     Formamidopyrimidine-DNA glycosylase catalytic domain
                     protein;
                     KEGG: sgr:SGR_724  formamidopyrimidine-DNA glycosylase;
                     SMART: Formamidopyrimidine-DNA glycosylase catalytic
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="YP_004921419.1"
                     /db_xref="GI:357409683"
                     /db_xref="InterPro:IPR000214"
                     /db_xref="InterPro:IPR010663"
                     /db_xref="InterPro:IPR012319"
                     /db_xref="InterPro:IPR015886"
                     /db_xref="GeneID:11370160"
                     /translation="MPELPEVEALRDFLGDHLVGKEIARVLPLAISVLKTYDPPVTEL
                     EGADVSAVARHGKFLDITAGDLHLLIHLARAGWLQWKDGFPATPPRPGKGPLALRTVL
                     TGGDGFDLTEMGTTKRLAVHLVRDPAEVPGVARLGPDPLADSFDRDAFAAVLGGARRQ
                     IKGALRDQSLIAGIGNAYSDEILHVAKMSPFKLTSALGDEDVTRLYDAMRTTLQDAVE
                     RSRGVAAGRLKAEKKSSMRVHGRTGQPCPVCGDTVLEVSFSDSSLQYCPTCQTGGKPL
                     ADRRLSRLLK"
     misc_feature    complement(503064..503876)
                     /locus_tag="Sfla_0436"
                     /note="Formamidopyrimidine-DNA glycosylase [DNA
                     replication, recombination, and repair]; Region: Nei;
                     COG0266"
                     /db_xref="CDD:223344"
     misc_feature    complement(503505..503876)
                     /locus_tag="Sfla_0436"
                     /note="Uncharacterized bacterial subgroup of the
                     N-terminal domain of Fpg (formamidopyrimidine-DNA
                     glycosylase, MutM)_Nei  (endonuclease VIII) base-excision
                     repair DNA glycosylases; Region: BaFpgNei_N_1; cd08973"
                     /db_xref="CDD:176807"
     misc_feature    complement(order(503598..503603,503652..503660,
                     503664..503666,503706..503708,503868..503873))
                     /locus_tag="Sfla_0436"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:176807"
     misc_feature    complement(503871..503873)
                     /locus_tag="Sfla_0436"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176807"
     misc_feature    complement(order(503703..503717,503841..503843,
                     503850..503855,503859..503870))
                     /locus_tag="Sfla_0436"
                     /note="putative H2TH interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176807"
     misc_feature    complement(order(503706..503708,503868..503870))
                     /locus_tag="Sfla_0436"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176807"
     misc_feature    complement(503211..503471)
                     /locus_tag="Sfla_0436"
                     /note="Formamidopyrimidine-DNA glycosylase H2TH domain;
                     Region: H2TH; pfam06831"
                     /db_xref="CDD:115485"
     misc_feature    complement(503067..503150)
                     /locus_tag="Sfla_0436"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            complement(503932..504798)
                     /locus_tag="Sfla_0437"
                     /db_xref="GeneID:11370161"
     CDS             complement(503932..504798)
                     /locus_tag="Sfla_0437"
                     /inference="protein motif:PFAM:PF04909"
                     /note="PFAM: amidohydrolase 2;
                     KEGG: scb:SCAB_84361 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_004921420.1"
                     /db_xref="GI:357409684"
                     /db_xref="GO:0003824"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="GeneID:11370161"
                     /translation="MTPPPVVDAHHHVWDLAVRDQDWITGEELAPLRRTFTLADLEPE
                     ARAAGVVSTVLVQTVTVAEETPELLALADAGTLVAGVVGWTDLTAPDVSGTLASLRAL
                     PGGDRLVGIRHQVQGEPDPEWLLRPDVLRGLAAVAAAGLVYDLVVRPHQLPAAVRAAA
                     LLPELTFVLDHAGKPPVARRATHPWADGLRALAALPNTVCKLSGLVTEADPLSWTVED
                     LRPYADTVIEAFGPTRLMYGSDWPVCRLAAGYADVLATARELTDGLGDADRQSVLAGT
                     AQRVYGLREPAG"
     misc_feature    complement(503950..504798)
                     /locus_tag="Sfla_0437"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            complement(504800..505768)
                     /locus_tag="Sfla_0438"
                     /db_xref="GeneID:11370162"
     CDS             complement(504800..505768)
                     /locus_tag="Sfla_0438"
                     /inference="protein motif:PRIAM:1.1.1.107"
                     /note="KEGG: sma:SAV_7284 oxidoreductase;
                     PFAM: aldo/keto reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal 4-dehydrogenase"
                     /protein_id="YP_004921421.1"
                     /db_xref="GI:357409685"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="GeneID:11370162"
                     /translation="MRRIRIGSSAVEITELSFGAAAIGNLFTEVDPGQAAAAVDAAWE
                     EGIRYFDTAPHYGLGLSERRLGEALRDRPRAEYTISTKAGRLLDPLPPAWTAAHLGLS
                     DGFAVPHTHRRRWDFSADGIRRSIEDSLGRLGLDRVDIVYLHDPDDHAEAAFREGYPA
                     LEKLRAEGVVGAIGAGMNQTAMLTRFLRETDVDVVLCAGRLTLLDHSALDTLLPEAAA
                     RHRDVVVGGVFNSGLLADPRPDAAYDYAAAPAPLLDRALRIRDVAEGHGVPLRAAALH
                     YPLRHPAVAGVLVGTRSPEEVRDAAAQLRRPVPDALWDDLRAEGLL"
     misc_feature    complement(504815..505762)
                     /locus_tag="Sfla_0438"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(504869..504874,504881..504883,
                     504896..504907,504956..504958,505076..505093,