GenomeNet

Database: RefSeq
Entry: NC_016115
LinkDB: NC_016115
Original site: NC_016115 
LOCUS       NC_016115             130055 bp    DNA     linear   CON 30-JUL-2015
DEFINITION  Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete
            sequence.
ACCESSION   NC_016115 NZ_ACZH01000000-NZ_ACZH01000154
VERSION     NC_016115.1  GI:357415565
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00191232
            Assembly: GCF_000176115.2
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Streptomyces.
REFERENCE   1  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid2 of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002477.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 21:55:32
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 6,693
            CDS                                       6,497
            Pseudo Genes                           :: 108
            CRISPR Arrays                          :: 4
            rRNAs                                  :: 6, 6, 6 (5S, 16S, 23S)
            complete rRNAs                         :: 6, 6, 6 (5S, 16S, 23S)
            tRNAs                                  :: 68
            ncRNA                                  :: 2
            Frameshifted Genes                     :: 60
            Frameshifted Genes On Monomer Runs     :: 1
            Frameshifted Genes Not On Monomer Runs :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..130055
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="Soil; soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /plasmid="pSFLA02"
                     /collected_by="Waksman and Lechevalier"
     gene            552..992
                     /locus_tag="SFLA_RS32905"
                     /old_locus_tag="Sfla_6645"
                     /db_xref="GeneID:11372454"
     CDS             552..992
                     /locus_tag="SFLA_RS32905"
                     /old_locus_tag="Sfla_6645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799156.1"
                     /db_xref="GI:908665232"
                     /db_xref="GeneID:11372454"
                     /translation="MAERGEAGVRVQVQDTSGQPLGVTAEVVDWRIGPHPQVPSEGDR
                     VHFRYRFDDADERSGPVVDACAVDKERMVLVCQTISPSEARPEAGGDLTGDSWLDVEH
                     PEHVAEVLLIPNDQSHAGGATCETDIKDGGGTHPPESPGVGDQL"
     gene            complement(2306..2503)
                     /locus_tag="SFLA_RS32910"
                     /db_xref="GeneID:23391549"
     CDS             complement(2306..2503)
                     /locus_tag="SFLA_RS32910"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826034.1"
                     /db_xref="GI:754215731"
                     /db_xref="GeneID:23391549"
                     /translation="MRWEGKGRAVSLIGVTAVCPPRTLAALIVLAFTTVNSAQGPAGI
                     QGTEGSHPRARKQTLVLQHRR"
     gene            complement(2795..3304)
                     /locus_tag="SFLA_RS32915"
                     /db_xref="GeneID:23391550"
     CDS             complement(2795..3304)
                     /locus_tag="SFLA_RS32915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010645375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding protein"
                     /protein_id="WP_041826036.1"
                     /db_xref="GI:754215734"
                     /db_xref="GeneID:23391550"
                     /translation="MFLPNGQDAPAAPTIDPEAVARRAAASMRLEPPKVASPRAAGTY
                     VVGMPMWMWATPSPLTFGPAVASATAGSVTVTATAKVTRVRWAMGDGTTVTCRGPGTP
                     YRQSWGKAMSPDCGHLYERPSYEQPGGRFKGAATAAWTAPALNDGGTFTDTRTTPFTA
                     AVHEVQVVN"
     gene            <3498..>3845
                     /locus_tag="SFLA_RS32920"
                     /pseudo
                     /db_xref="GeneID:23391551"
     CDS             <3498..>3845
                     /locus_tag="SFLA_RS32920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003963849.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /db_xref="GeneID:23391551"
     gene            3932..4294
                     /locus_tag="SFLA_RS32925"
                     /db_xref="GeneID:23391552"
     CDS             3932..4294
                     /locus_tag="SFLA_RS32925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010056716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826038.1"
                     /db_xref="GI:754215736"
                     /db_xref="GeneID:23391552"
                     /translation="MPEQRERLTALGIRGTTLPLTAAAPAELPAAPADAAKGPKKAGS
                     KAEAAFQRGLAALTQWVEKEGQRPVPRSTVVEITVDGEAEPVTVKLDAWNSNIKSRRD
                     KLYAEQLGALWRLGMRWA"
     gene            4450..6318
                     /locus_tag="SFLA_RS32930"
                     /old_locus_tag="Sfla_6649"
                     /db_xref="GeneID:11372447"
     CDS             4450..6318
                     /locus_tag="SFLA_RS32930"
                     /old_locus_tag="Sfla_6649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158387.1"
                     /db_xref="GI:503924393"
                     /db_xref="GeneID:11372447"
                     /translation="MHLNSFNVSGFRSLTEVSDIPVRKPTILAGHNDGGKSALLDALA
                     FLLGKHALAEDDRTYLTIDGDEVSAPLRCEESIVEGVFTLDAWEQEQFDLPERIRLRR
                     CCGEDLISRLEVWQPIPADERLRDLSQHLVPALKELVKEFGLSPGSMRKPDLEQALRR
                     YGRDHAGSDGWVAAPTALDKRMPRYLPFDGKVAKPDEAVKTVLVGRFQSYMADPDLKG
                     RLSAIEDEVQDRLRIDAKSLCEHIEMRCPDLQKVSVDPDVSFQQGFKAAPLRVARRAG
                     EVVGLDRTGLGSNRRISLAIWEWTSELLAEEQGTAPAMSTCDEAPEPPPVQTIVVYDE
                     PDTHLDYIHQRKIMQLIRTQSKIPNVSVLVATHSMNLIDGVDISDVVHLKLEDHRTVV
                     ERLGTGLLHDAIDEHLGKIAATVGLRNSVLLHERCFLAVEGETEQRAFPLLFRLCEGL
                     SLQAAGIALWACFNNEGALHLARYLVKQGRTIMLVVDADSRNVSKGIFKTPKLTQFFG
                     TESRRYVTFLGEPDDAQQEKYNELEELFEDDVWARIANKVWARAGTPWQPADFTALRG
                     QGKFSGAVQEMLQEQSESGPGGKPDMMYELSMALDDPDDVPEQLRRVFERLRELAS"
     gene            complement(7173..7436)
                     /locus_tag="SFLA_RS32935"
                     /old_locus_tag="Sfla_6651"
                     /db_xref="GeneID:11372449"
     CDS             complement(7173..7436)
                     /locus_tag="SFLA_RS32935"
                     /old_locus_tag="Sfla_6651"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="dTMP kinase"
                     /protein_id="WP_014158389.1"
                     /db_xref="GI:503924395"
                     /db_xref="GeneID:11372449"
                     /translation="MGDMTIPFLPPLSALGAIQRVLLVTLLTPAVLLALTAAVPALIV
                     LPFLPGGTDRAIALLTAHTAYLTALLTGSRTLPPNTARRPRGS"
     gene            complement(7475..9106)
                     /locus_tag="SFLA_RS32940"
                     /old_locus_tag="Sfla_6652"
                     /db_xref="GeneID:11372450"
     CDS             complement(7475..9106)
                     /locus_tag="SFLA_RS32940"
                     /old_locus_tag="Sfla_6652"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826040.1"
                     /db_xref="GI:754215739"
                     /db_xref="GeneID:11372450"
                     /translation="MKAIAVRGGLSRDETVRQLLDEHLEAQEHREPDMRLTHISTVLR
                     YPPALGRQKHRWVPEFGGPLRLRLHPGVADRARTVSLRLPGQFQRAHRDYQSRQLTDA
                     VMTAIAVHEPFTDTYLDGLQPVLRHRAARGLWGLAVAATSTAPELAVHEAVSRAEFPD
                     KDESATGASAGGPGASSRPQQTGASSRLLRVAAALEGETGWHSAVRFWVAANIARLLL
                     TGPGRDAAERMLFEQGEQWRELRLDYRYANAATREELRRGIGDWDDSGRGGGAVWRAE
                     RAVEVEDFEVWLVARGRAAERMNLPPGWLVRTPPTWRVSAVGGHGAALREPYAGWVVA
                     GRLLVFTSGGTPGVWPLTRGNGGRMRPVEGIEPVVAAAAGLAPAQASTFIEAMLLDWS
                     DDGEADLMRVPAVLRLPASQAYNFGYIDAAQRSSLMAQARVATLESMNHVLNHLHDDF
                     YRARLEAARDSGSVRDFRRLARWARVHFSPSPATWPWPGGPVAHEVVAGTRPEIVHWL
                     ATHAHRTTATLLQHSMGEAWNAAFDHRPPSFWTDM"
     gene            9701..10624
                     /locus_tag="SFLA_RS32945"
                     /old_locus_tag="Sfla_6654"
                     /db_xref="GeneID:11372452"
     CDS             9701..10624
                     /locus_tag="SFLA_RS32945"
                     /old_locus_tag="Sfla_6654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158391.1"
                     /db_xref="GI:503924397"
                     /db_xref="GeneID:11372452"
                     /translation="MATDLISGTTRAHMREISAQLGPSRLRPCWDGSGFTPGPAKDTS
                     GGGGKNLFSSYVDHIGWSDPGQVSRALGVFESMLRVYRTVVESSYGTEDETPQQRWAA
                     KLEEARREFEYDGYQITDRLRIFGSGEGRPDHEMADAQLYAEALSLLRHARNQMERLP
                     STTRGKSEPEIRDVLLVALGAAFAGRCTAESLNGKGKTDLLLRIGDRNVLVGECKIWG
                     GSTDFREEDIPQLLGYLTRYDRHAVIPLFIRKARPEEIVAKAVKELAEHPRCVSAAVP
                     DHEGRQYTFVFRSLSATPWDVEVALIPFVIE"
     gene            complement(10969..12177)
                     /locus_tag="SFLA_RS32950"
                     /old_locus_tag="Sfla_6656"
                     /db_xref="GeneID:11372443"
     CDS             complement(10969..12177)
                     /locus_tag="SFLA_RS32950"
                     /old_locus_tag="Sfla_6656"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158393.1"
                     /db_xref="GI:503924399"
                     /db_xref="GeneID:11372443"
                     /translation="MQDSAVVGTRRSRIADFLRQLDPDVRMALHFDDAAVIGADLLIS
                     MCRALLDTGSDQPWQDRLESTLEEFDLSDVETGLDSILEKFQNTDMAISWLTSFKGVN
                     YNAFALRLLGARDFKRLVDVVKEDGAIVALAVRRALRGAMPFAVAWSDAISNMTENQR
                     KAVSKADILGLDLVQIVIMVDEAFGTKFISTLPMELTTATTDDLVGWRPDDMTEIVST
                     IRHRVAESSAKRLERENSQLVRKIRGAKDALAHSEDGISQAANSLIELIDRILRNAFT
                     KEQVMAWVVANLPNEPGLTYPDERGVDQPNKRAEILCFVYRGGPTAREAHEYDNGQGP
                     SLIHDVLARVIVATRTSLQGFKHGDAGTQEEKEQLLSLLAGLEGALLLGLSISQIGIK
                     EGELPNNLEA"
     gene            complement(12328..12577)
                     /locus_tag="SFLA_RS32955"
                     /old_locus_tag="Sfla_6657"
                     /pseudo
                     /db_xref="GeneID:11372329"
     CDS             complement(12328..12577)
                     /locus_tag="SFLA_RS32955"
                     /old_locus_tag="Sfla_6657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007456545.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:11372329"
     gene            complement(12671..13510)
                     /locus_tag="SFLA_RS32960"
                     /old_locus_tag="Sfla_6658"
                     /db_xref="GeneID:11372425"
     CDS             complement(12671..13510)
                     /locus_tag="SFLA_RS32960"
                     /old_locus_tag="Sfla_6658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014140768.1"
                     /db_xref="GI:503906774"
                     /db_xref="GeneID:11372425"
                     /translation="MTERRRYPSDLSDARWELVEPVLTAWRAERRGRGLDIGRPPNHD
                     LRSLLDAVLYVNRTGIPWRYLPHDYPHWNTVYAYFARWQEEGVFDQLNSLLRRQVRRQ
                     EGRDDEPTACVIDSQSIKTSTNVPATGQGIDAGKKIVGRKRSIVIDTVGLLLGVLVTA
                     ASVQDSTAGRTLIERIAAEHPTIRKTWVDGGYRQHLVEHAATLGIDMHIVRRDTATRG
                     FTVLPRRWTVERTLGWLMNHRRLARDYEAHPHRSEAMIHVAMINLMTRRLSAESTPTW
                     RGA"
     gene            13793..14646
                     /locus_tag="SFLA_RS32965"
                     /pseudo
                     /db_xref="GeneID:23391553"
     CDS             13793..14646
                     /locus_tag="SFLA_RS32965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158486.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /db_xref="GeneID:23391553"
     gene            complement(14669..15073)
                     /locus_tag="SFLA_RS32970"
                     /old_locus_tag="Sfla_6660"
                     /db_xref="GeneID:11372330"
     CDS             complement(14669..15073)
                     /locus_tag="SFLA_RS32970"
                     /old_locus_tag="Sfla_6660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158395.1"
                     /db_xref="GI:503924401"
                     /db_xref="GeneID:11372330"
                     /translation="MISDNFPIGGSFRELEYGSPDGPSIRTAVRLAAPKHEGDLVQYL
                     HAGSTLVATPSAAPDVLSESGAIIGGLHLLTDGHWLWYSDLAHYVRRYHVELDPAFIE
                     HARGNNWSAPQISDERLEAMVTLLIGDEKEPD"
     gene            complement(<15141..15524)
                     /locus_tag="SFLA_RS32975"
                     /pseudo
                     /db_xref="GeneID:23391554"
     CDS             complement(<15141..15524)
                     /locus_tag="SFLA_RS32975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014177720.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /db_xref="GeneID:23391554"
     gene            complement(15752..15955)
                     /locus_tag="SFLA_RS32980"
                     /db_xref="GeneID:23391555"
     CDS             complement(15752..15955)
                     /locus_tag="SFLA_RS32980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018839784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826082.1"
                     /db_xref="GI:754215787"
                     /db_xref="GeneID:23391555"
                     /translation="MSLVVVLLTVAVVVFTAVLAATGAAVLARIDSATWPAALARAAT
                     TFAATLALAATVTGALSPFFLTR"
     gene            16074..18530
                     /locus_tag="SFLA_RS32985"
                     /db_xref="GeneID:23391556"
     CDS             16074..18530
                     /locus_tag="SFLA_RS32985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020126324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799145.1"
                     /db_xref="GI:908665221"
                     /db_xref="GeneID:23391556"
                     /translation="MDRKDSESAVARAELHRRLEDALVASRTRLTKIDLAARTGLGRT
                     TVQQAFNKDARLPSPYTVRELSIALKLPLGEMRDLLRTAEGGPTREEDTPGQPIARWD
                     PHDLEVHPAGTSVTGSGRRALPGYVRRRHDEDLAAAVRDAAAGNSRIQVLVGSSSTGK
                     TRACWEAVQPLAERGWWLWHPFDPTRADEAHKQLAHVGPRTVIWLNEAQHYLGDRQHG
                     EHIAAALHTILTTPERGPVLVLGTLWPKYAHDYTAPPKPGVDDPYSRVRELLAGRMVS
                     IPDQFGTAELAAAQDLADQGDALLVDALTRARDSGRITQDLAGAPELLRRYEQPHHAA
                     ARALLEAAMDARRLGVDLHIPQAFLTDAALDYLSDDDYDQLGNNNWAEQAYAELAEPV
                     HGKQAPLRRTTPRPSRRPPAPATEARTATPLPAGPVFRLADYLEQHGRTTRRHLCPPA
                     SFWNAAHTHLTHPDDLGNLTEAAQTRHRLQWAHHLRQRAADHGDTRALVHLVRMREEA
                     GDQDGAETLARQAATHGDTRALVHLAMMREKAGDQDGAETLARQAATHGDTRALVELA
                     MMRYQDGAETLYRQAITHGDTRAMVHLAMMRREAGDQDGAETLYRQAAALGNPFALPN
                     LVEMREKGRDLDNTKTSDREAADPDDTDALVHLAMMREEAGDQNGAETLARQAATHGD
                     SSALFILAMMRRRAGDQDGAETLARQAADQGDTGALVHLAKVRKKNEDRDGAETLYCE
                     AADHGDTGALVELALMREEAGDRDGAETLYRQAADRGNIDALSSSGAIKFWPYGLDPD
                     GTPTPRWQQSGPCTPEAAAK"
     repeat_region   17546..17779
     gene            18755..20188
                     /locus_tag="SFLA_RS33670"
                     /old_locus_tag="Sfla_6663"
                     /db_xref="GeneID:25120673"
     CDS             18755..20188
                     /locus_tag="SFLA_RS33670"
                     /old_locus_tag="Sfla_6663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014386297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799146.1"
                     /db_xref="GI:908665222"
                     /db_xref="GeneID:25120673"
                     /translation="MRFMPFTALHAGLGRLDATLPDLGHQLDWAQVYKARPRPPLVCP
                     QCEWGLHAKVSRYGVRFFCHDPGRPPSCELSNESWEHHMLKLELAGAIREAGWFAELE
                     VPAADGSWRADVMASSVDGTQRMAWEAQLSAITDEDIEYRTERYRAEGIRVCWVSPHK
                     KPPQWISVVPAVRVRSPEGRGQSWVVDDGLAGFDFTAGGWAFREEQLQRFVRWVLGGQ
                     VVSVESYPRYRRVPRVVDGKRLRFRRGRWWTSLQSADAQTRHESMRRRQEAAKEEREA
                     RQRKREEAAERRRKELEEKERIQRAQEAERRAKKAAEESRIRMEVWEREWAEEKARRE
                     REKAEKAQRLAREEAEREERERQALEAATVWWGRLSTQQKEELLAAVTERAWREEKLW
                     VTVPENPLMDPAYAYGVPLYTQGKRRRSLYGIVRPCPELLAASPRAREEHALVRNTQE
                     ATELQEAGCEGRITHFDLPEHEQLSMY"
     gene            complement(20195..21016)
                     /locus_tag="SFLA_RS32995"
                     /old_locus_tag="Sfla_6664"
                     /db_xref="GeneID:11372427"
     CDS             complement(20195..21016)
                     /locus_tag="SFLA_RS32995"
                     /old_locus_tag="Sfla_6664"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158397.1"
                     /db_xref="GI:503924403"
                     /db_xref="GeneID:11372427"
                     /translation="MPKKKRRPRHPAHLAHTPTTRRVSEPDQEREYVDEFQPLLDRYP
                     TVQDAVQAAEAGESVEWTGSIGGLPMRHRVVLAPEQLMVEQAILAGWPLDYMIRCAWF
                     QCDAHVDTEKAVLKTLDELHELTRPLLEEQVRAVRPDYEAVVLSAFAEPSDRGVPIFG
                     WRARYPVIEGLTWQSTRDTAAWNLSGCFDAIDPIVDIPELGRPAIAARLSCNGAPLMV
                     CKGCDLPLTDRHPRWTRVWVGPDGPRCEEPAVSDDGAQAGWDEEDFGYPHRPRPA"
     gene            complement(22019..22276)
                     /locus_tag="SFLA_RS33000"
                     /old_locus_tag="Sfla_6666"
                     /db_xref="GeneID:11372335"
     CDS             complement(22019..22276)
                     /locus_tag="SFLA_RS33000"
                     /old_locus_tag="Sfla_6666"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158399.1"
                     /db_xref="GI:503924405"
                     /db_xref="GeneID:11372335"
                     /translation="MSSPQSVSACVTGTRRRLGLGESAVIIVIIVMTALLITRGTPLT
                     EAATILGSSGLLAVLVTRYAQAGPRTAVMRRVGALLFPAQA"
     gene            complement(23389..24183)
                     /locus_tag="SFLA_RS33005"
                     /old_locus_tag="Sfla_6667"
                     /db_xref="GeneID:11372336"
     CDS             complement(23389..24183)
                     /locus_tag="SFLA_RS33005"
                     /old_locus_tag="Sfla_6667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020121828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799157.1"
                     /db_xref="GI:908665233"
                     /db_xref="GeneID:11372336"
                     /translation="MSLADIMENNPVDQVGEHLLAAAATLLYQQGDTEAAITATDVLA
                     VDMSLWNSDEYEPDEYRMYFTVEPQLVDQFTDQVVARIVDGIHAVMPRRGCAVRIESI
                     EVCPVVPVPSMDWRKQLRTANGPTPTNQARKVRLEPRDQHPIQDDLHFTNEWEHGLYQ
                     VLKARQATLPDNETIGIMPLGKMRLLGSTREPDFLITYKGRAGVIEVDGPHHGKPGRA
                     SSDHSRDNLMIHAGVEWVSRLDVQDVGTKAEVEKFVDNFLARLVRQ"
     gene            24465..25289
                     /locus_tag="SFLA_RS33010"
                     /old_locus_tag="Sfla_6668"
                     /db_xref="GeneID:11372337"
     CDS             24465..25289
                     /locus_tag="SFLA_RS33010"
                     /old_locus_tag="Sfla_6668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019064600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein PINc"
                     /protein_id="WP_014158401.1"
                     /db_xref="GI:503924407"
                     /db_xref="GeneID:11372337"
                     /translation="MMVTPIPGARLELVLQLLREAHTKAQNLGNFTSAEECLLNYLTW
                     TTEQARLLGSHVRAKDVEVLFFTPVYWALLNGAGHMEGRLVPKVSIGLVNQEVRQRTE
                     DLDLAVSSIRDAVRRWRGDVSTLVLDTSFFIEHEDKLEDADLFTLADFEGLVRVAVPM
                     TVVDEMDRLKEARVSGHARWRARYGLAVLDRLLTGPAKLGSVEVEVLPDPSGHVRLPD
                     EDDEIVDRALALGTMAAGPVTLVTYDTGMALRAKIAGVPCLKLPKELGPEPERPKD"
     gene            25932..26180
                     /locus_tag="SFLA_RS33015"
                     /db_xref="GeneID:23391558"
     CDS             25932..26180
                     /locus_tag="SFLA_RS33015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004993507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826046.1"
                     /db_xref="GI:754215746"
                     /db_xref="GeneID:23391558"
                     /translation="MNREFTVVLNILLTGKMDQQIVEVDGNNGESGFVLMDPEDANNP
                     AKVQEVRDFMIQWRTDRERMDAELDGIARASSMHTDTD"
     gene            complement(26337..27185)
                     /locus_tag="SFLA_RS33020"
                     /old_locus_tag="Sfla_6670"
                     /db_xref="GeneID:11372428"
     CDS             complement(26337..27185)
                     /locus_tag="SFLA_RS33020"
                     /old_locus_tag="Sfla_6670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158402.1"
                     /db_xref="GI:503924408"
                     /db_xref="GeneID:11372428"
                     /translation="MARVPENVDAQQLHVAARRVLLDGLTALSDQLDALTVVGAQAVY
                     LRTPEAALRTSFTSDGDISIDPDRLQNVPLLDQALLEAGFELLRDNQPGLWARTQRIG
                     GQEVPIEFDLLMAKGLAPKIGSRSVKIPPHGVMSARWVPGLEVAAVDRSPMTITSLEA
                     ADARTIIVNVAGPAALLVAKAFKINDRLKQADARPERLTHKDAGDVLRIIRAIPVAQV
                     TASFAKLREDPRVGEITQEGLQLLQDLFGGPTTPGVGMAVQALSGDLPEATVRALAPA
                     YVSRLM"
     gene            complement(27230..28381)
                     /locus_tag="SFLA_RS33025"
                     /old_locus_tag="Sfla_6671"
                     /db_xref="GeneID:11372339"
     CDS             complement(27230..28381)
                     /locus_tag="SFLA_RS33025"
                     /old_locus_tag="Sfla_6671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158403.1"
                     /db_xref="GI:503924409"
                     /db_xref="GeneID:11372339"
                     /translation="MDSKSDEEVGSPGRLFDAALERLRGLFGEGWAVEAVPGFQQDPS
                     DWYSDRMIEIRSADMGHTARYVVDLKSSLTPRTVDTELLSKLRLVRQVNSFTSLLVMA
                     PWMSPKTQDLLRIHGISYVDLTGNIWIRADRPAIFIYTEGQSRAPRSASQPSSAVTLS
                     GSKVDRLVRILADVRPPYRASDLAAATKLSLAYVSRLLGTLEDQLLIQREGRTIHSVN
                     WQGLLRARAEHSNLLNLNPYSGFIAPNGVDYLLRQMRDDDFTSRRLFAITGSYAAREV
                     APLSVGGQLMIYIRPDHFSDELVDHLGLLEVKQQADVLFLDAHDPVVFKQSRIVGGLP
                     HVALSQLALDCLSGPGRLPAEGEAVLERMSAHEQWRNLDIHTIKEWWAA"
     gene            complement(28769..29737)
                     /locus_tag="SFLA_RS33030"
                     /old_locus_tag="Sfla_6672"
                     /db_xref="GeneID:11372429"
     CDS             complement(28769..29737)
                     /locus_tag="SFLA_RS33030"
                     /old_locus_tag="Sfla_6672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_014158404.1"
                     /db_xref="GI:503924410"
                     /db_xref="GeneID:11372429"
                     /translation="MTVPQEASPSDADNVERHPCPRCTAEPGSPCRSRSGAVAGTYHT
                     GRFTKVPRLAKLLRVPTPADRGPGQPWRPGTPVPLALAPDTPTADIRIGYARCSTLTQ
                     ELQSQLDALAKHGIDRDKVFSEKISTRVRVRPQFEAALTLARQIKAHAPHCRVIFTVY
                     EMKRLGRDAAELTALADHLTAHGLVLEMLAGPLPGMYDPSGPGRLLFAFFAAMAETER
                     ENIRESTLEGLDAAARKGKHGGRPPVITDDMLHTVLRRRTNGESVEQIQPDLIIPTGK
                     RKGQAPSVASIYRALAEHEKQQAYPEAVEQAHADFVNLQPRDRGPA"
     gene            29961..31043
                     /locus_tag="SFLA_RS33035"
                     /old_locus_tag="Sfla_6673"
                     /db_xref="GeneID:11372430"
     CDS             29961..31043
                     /locus_tag="SFLA_RS33035"
                     /old_locus_tag="Sfla_6673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010072986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158405.1"
                     /db_xref="GI:503924411"
                     /db_xref="GeneID:11372430"
                     /translation="MLDRDLLRASRLAGYGIVSTQLSLLSDHRLGEVVAAATPLGSGI
                     GGRSAELDVNGTRVFVKRIPLTDIELRPENVRSTANIFELPMFYQYGVGSAGFGAWRE
                     LAVHTMTTNWVLGDEYAGFPLMYHWRVLPDSPPEGFTDEFGGLEGAVAHWEGSPAVRD
                     RLEAIGQSSCSLVVFLEHVPHTLAGWLADHRKPAVSEGGDGSPFRWVEKALMDGADFM
                     SSRGLVHFDAHFANILTDGRQLYFADFGLALSSRFDLSSGESSFLSDHLAYDRCYTAS
                     HLLQYHLLDGVRGDTERKAFLHDWIAGRRPGDVPPAITAIIDRHARPTVVVDSFFHRL
                     FTESKQTPFPATEIEQQLRTGTTTPS"
     gene            complement(31244..31630)
                     /locus_tag="SFLA_RS33040"
                     /db_xref="GeneID:23391559"
     CDS             complement(31244..31630)
                     /locus_tag="SFLA_RS33040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014173837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_049799158.1"
                     /db_xref="GI:908665234"
                     /db_xref="GeneID:23391559"
                     /translation="MRREIHEGLQVVENWNSANKDLFYGKDGDLAGADKESQEVSMLA
                     LHLLQSALVHVNTLLMQEVLADPKWADKLTDADRRALSPLFWTHVNPYGRFELDMNSR
                     LDLDLSIRATVPGPRAPQGEAAGAEA"
     gene            31723..32796
                     /locus_tag="SFLA_RS33045"
                     /old_locus_tag="Sfla_6675"
                     /db_xref="GeneID:11372341"
     CDS             31723..32796
                     /locus_tag="SFLA_RS33045"
                     /old_locus_tag="Sfla_6675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014140676.1"
                     /db_xref="GI:503906682"
                     /db_xref="GeneID:11372341"
                     /translation="MGTVLLDEKWPVLGRHEQAAGWLQVWSDLGRAPRTIDAYARGLA
                     EYLEMCERENVDPLTANRAHIAVYVRELTSRPSRRGANVVSIDSGSGLANATIQQRLV
                     PVRLFYDFLMEDGQRDSNPVGRGRYTPGRRHRGGHERGLVPRLTKMPWIPAEQQWLDI
                     LAVAAAEPVRNRVMLALAYDAALRREELCSLRTDDLDPAHRTLRVRAETTKNRLERVV
                     PYSAPTGVLLSGYLAHRATVSRARGPLFLSESRRNHAQPLSLWTWSKVVRRIALAADV
                     PRFSTHTTRHLCLTDLARMGWELHAIATFAGHRHTDSTLTYIHLSGRDLADKLSRGME
                     QIHGWRVQMLARLGEQATGTVAL"
     gene            33222..35156
                     /locus_tag="SFLA_RS33050"
                     /db_xref="GeneID:23391560"
     CDS             33222..35156
                     /locus_tag="SFLA_RS33050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_049799142.1"
                     /db_xref="GI:908665218"
                     /db_xref="GeneID:23391560"
                     /translation="MAAFAYLLGDFTDFHRIGGFIRRSLAWRVFGQEPVEETIAQVAA
                     TLQGWGYHPSNGAFGQFRTVLVQIMLINRSPLLQDMTTDALQRARESPALPSGARRGN
                     LHGVHRAIAALGHAGPPPKPIHAVMPDLEGVPEPWAAMVERWHDTSTLTPKVRGGFRS
                     IVAKAGRWLAAEHPEIVEPGQWTRETCAAWVAALDRMTVGEHVQRRAGLDKRGGKPLS
                     PRTKAGYLTATRTFFRDCQEWEWIPRRFDPVRALATPRSVAALIGPNPRVIADDIWAK
                     LLWAGLNVDPEDFPTNTYGLCYPIELIRAVTLTWLFGGLRSDEISRLRTGCIRWQHDG
                     FPIPGDSDEVLARDAVCLLDVPTHKTGTSFTKPIDPLLGKAIEAWQDARPQQPKMLDR
                     KTGEQVDFLFAHRAKRLANTYINTAVIPSLCRKAGVPTADVRGNITSHRARSTIASQL
                     YNAKEPMTLFELQAWLGHRSPESTQHYAKITPNTLARAYNDAGYFERNVRTIEVLVDR
                     DAVTSGAAASGEPWQYYDLGHGFCTYTFFEQCPHRMACARCDFYTPKATSKGQLLEAK
                     DNLQRMLASVPLSDEERAAVDDGQAALDQLLERLVDVPTPAGATPREIGAPATATLLP
                     IVAVNQGASAECRPAMRAPR"
     gene            complement(35137..35859)
                     /locus_tag="SFLA_RS33055"
                     /old_locus_tag="Sfla_6677"
                     /db_xref="GeneID:11372343"
     CDS             complement(35137..35859)
                     /locus_tag="SFLA_RS33055"
                     /old_locus_tag="Sfla_6677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_014140678.1"
                     /db_xref="GI:503906684"
                     /db_xref="GeneID:11372343"
                     /translation="MSIDPLLARARGLWEELASVPVSFASTGGVRVVVSPESRMCPSG
                     WVGVVVLGNSAIVTAPSQDTAKTVRDALAKLPVGALAGAHSVRGVLPVARVLGPAALA
                     YVSDNGFRPVADRRLTVQLVPGEHPDLRELENLAGADDSDEAGLNEITSPAFVIRERG
                     QIVAAAGYRSWPSRTAHVSVLTAPAWQGRGLARATGSGAVAHALTAGLLPQWRARVPA
                     SRRVALALGFRELGAQLSVELA"
     gene            complement(<36017..38143)
                     /locus_tag="SFLA_RS33060"
                     /pseudo
                     /db_xref="GeneID:23391561"
     CDS             complement(<36017..38143)
                     /locus_tag="SFLA_RS33060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010047492.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /db_xref="GeneID:23391561"
     gene            39341..39793
                     /locus_tag="SFLA_RS33065"
                     /old_locus_tag="Sfla_6678"
                     /db_xref="GeneID:11372344"
     CDS             39341..39793
                     /locus_tag="SFLA_RS33065"
                     /old_locus_tag="Sfla_6678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158406.1"
                     /db_xref="GI:503924412"
                     /db_xref="GeneID:11372344"
                     /translation="MDQEAMRSAVVGALSDVEAVKEKLTGLLAEIDGTASSVSIPRQG
                     LWTKEQVGLLWGRASHLTGVHALFQTTAEQAGTTVTFTSLIERSGLDERQQRNEHARL
                     SRLASELFGEKRWPIENWQGGYNTHSGKSEMLYRMDPQIAEWWLTLVD"
     gene            complement(39966..40754)
                     /locus_tag="SFLA_RS33070"
                     /old_locus_tag="Sfla_6679"
                     /db_xref="GeneID:11372345"
     CDS             complement(39966..40754)
                     /locus_tag="SFLA_RS33070"
                     /old_locus_tag="Sfla_6679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014158407.1"
                     /db_xref="GI:503924413"
                     /db_xref="GeneID:11372345"
                     /translation="MAGYGALSDVYEWLIGDDKLTPAKAAAVYYSDVVGSLLPNARVL
                     DCACGTGQLAVGLASLGLDVVAADASSGMVRRTEKAADEQDVSLRALRASWDELPDHL
                     ADSTFDLVFCVGNSLGHAEGSVGRLTALEAMSRLLNPGGRLVLHSRNWELVRSAGSRV
                     DVRDRLIRRNDREAVVSYYWQIEQRWEQEHFLEIVVAQIEPDGAVQACSERLSIWPYR
                     YVDLVAQLRSVGLTVQSTTFDPESDEYLVVASRDQVRGKSEPTR"
     gene            complement(41258..41659)
                     /locus_tag="SFLA_RS33075"
                     /old_locus_tag="Sfla_6680"
                     /db_xref="GeneID:11372431"
     CDS             complement(41258..41659)
                     /locus_tag="SFLA_RS33075"
                     /old_locus_tag="Sfla_6680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158408.1"
                     /db_xref="GI:503924414"
                     /db_xref="GeneID:11372431"
                     /translation="MSSLITEDEISHEIELVWLEETTDLDYVRQSLDRLPTRRGKPPY
                     HRDGRMIGYALLGPKAKASRSSGTFRRRVFWLLPHDRDTQPEGLYATGAPAEAVDPRT
                     LAAGTKGYKTERSEGGPPSTAMQELGITLPL"
     gene            complement(41656..43185)
                     /locus_tag="SFLA_RS33080"
                     /old_locus_tag="Sfla_6681"
                     /db_xref="GeneID:11372346"
     CDS             complement(41656..43185)
                     /locus_tag="SFLA_RS33080"
                     /old_locus_tag="Sfla_6681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_014158409.1"
                     /db_xref="GI:503924415"
                     /db_xref="GeneID:11372346"
                     /translation="MTSPGNDNMLFHFDPQLVAAQIREQATLPLPAQALAPPATAAAG
                     EATQHGLLPDTLTDRGNAKLFVKLYANDYRHVPGMGWYRWDTTRWQIDEDDTVVWAAG
                     DLAESIASSDPRGLYTTQALQQHRRRALSTTGMNAMLTQAKSAPGMVLNAARLDADAY
                     ALCTPDGIVDLRTGLLKTPDPNKDFHSRSTSVGPRPSPTPRWNRFLTDTFGDDAEGTE
                     MIEFLQLLLGYSVTGDVGGQVLPFLFGSGKNGKSVLLDVLMKLLGDYADAAPPGFLMA
                     RPYEGHPTDLAELHGRRVIVCSEVKHGDKFDEARVKLLTGGDRIKARRMRQDFFSFQP
                     THKLWLLGNHRPEVGTGGFAFWRRMRLIPFTRVVSDDRKIDNLADILVTEEGPGILGW
                     LIDGARRYLAGDKDLTGPERVRIATTAYAETEDHTGRFFEECCTLGPELRAEQTGLYT
                     AYRTWCQEEGAPAMTSRAFAARARELAGLASPKEMILSNQRKYYPGIGLLPEQERQAT
                     T"
     gene            complement(43182..44171)
                     /locus_tag="SFLA_RS33085"
                     /old_locus_tag="Sfla_6682"
                     /db_xref="GeneID:11372347"
     CDS             complement(43182..44171)
                     /locus_tag="SFLA_RS33085"
                     /old_locus_tag="Sfla_6682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_041826093.1"
                     /db_xref="GI:754215800"
                     /db_xref="GeneID:11372347"
                     /translation="MAPGRKTPAANCETCRQPGHSRAGCVCPSEGRWCHSFHAATLDQ
                     RRIDRWWGQNPQFGIGVACGPAGLVVVDIDAHATKSPGRDRILPGIPISDQVNLAGLT
                     NGFHTIAVLAALRDMPSPADDASTLRVRTPSGGLHVWYRVGDSRSWQCSSGSSPGRAL
                     AWQVDVRANGGYIVAPGTTTAAGTYTPLGSVRRPAVLPDWLAQELERTGHLPAFDVPA
                     PRAVPPRAQQAVIAAGGGRNHTHNILASVLAPVEACGQVAEGAGFSDILNRAAYTLGG
                     LVAASRLSQQEAEDLLLQTAAAARPGQNHRAEQIIRSGMAAGLKRPLYPGSVR"
     gene            <44843..45655
                     /locus_tag="SFLA_RS33090"
                     /old_locus_tag="Sfla_6683"
                     /pseudo
                     /db_xref="GeneID:11372348"
     CDS             <44843..45655
                     /locus_tag="SFLA_RS33090"
                     /old_locus_tag="Sfla_6683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015578572.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase"
                     /db_xref="GeneID:11372348"
     gene            complement(45801..46112)
                     /locus_tag="SFLA_RS33095"
                     /db_xref="GeneID:23391562"
     CDS             complement(45801..46112)
                     /locus_tag="SFLA_RS33095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020137024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158412.1"
                     /db_xref="GI:503924418"
                     /db_xref="GeneID:23391562"
                     /translation="MTRGQWGCVAAPVGGLATGVLGSVLLSAAWRACDVGVNGAANGL
                     ALIFYGALLTIISAVWWGALVGYVGRWNLAVALLGGTAGAAVMVWIFVALLHVPNGYR
                     C"
     gene            complement(46109..47251)
                     /locus_tag="SFLA_RS33675"
                     /old_locus_tag="Sfla_6685"
                     /db_xref="GeneID:25120674"
     CDS             complement(46109..47251)
                     /locus_tag="SFLA_RS33675"
                     /old_locus_tag="Sfla_6685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007266225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799147.1"
                     /db_xref="GI:908665223"
                     /db_xref="GeneID:25120674"
                     /translation="MTTDLSVLTKAAEKWETVAADLAKVGKRYGETVQKITLGQNWHG
                     LSVEAAHTKFATTRREYTSAQTEAKSVAKILRDAHTGFVDLKKKVESARDDAVAAGMA
                     VSTAGRAAFDFTRLQDPAQERALRHDPDLKGAEESWTSHIAAAVRAVAEFDSAVKQAL
                     EAVVVDGNLLDGTVGGFNATATPVIPPTGQERSEQKFTDAEKWIFEEMKRNAKSDTVG
                     TIKALLDEPEWYEFGRNYGSDINAAMVMWGAKVAPGQDWDHKPQLQQRYDLQTIDDYY
                     FKQPGTNREVFYDIYSNVHYGYVGRAAGFDTDTLIQGASLGETVLTGDDDQGDQITMR
                     VGVDLYEKYGDDLTEEQLRQGINDAMDQMERAQRNGEDVPQVRTRK"
     gene            complement(47284..47664)
                     /locus_tag="SFLA_RS33105"
                     /old_locus_tag="Sfla_6686"
                     /db_xref="GeneID:11372350"
     CDS             complement(47284..47664)
                     /locus_tag="SFLA_RS33105"
                     /old_locus_tag="Sfla_6686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158414.1"
                     /db_xref="GI:503924420"
                     /db_xref="GeneID:11372350"
                     /translation="MAWDESSGGGTPAGPLVPGGGGLFGSSPAEKNAAANDIETELEP
                     DTKKFSDGAKESTNTAARTLNGWETASGLKKVVGTWDQQVRVLMGRLAAEKASLRNTS
                     GLFFQNDLGTGSELRGVRSSLDEL"
     gene            complement(48359..49129)
                     /locus_tag="SFLA_RS33110"
                     /old_locus_tag="Sfla_6687"
                     /db_xref="GeneID:11372351"
     CDS             complement(48359..49129)
                     /locus_tag="SFLA_RS33110"
                     /old_locus_tag="Sfla_6687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158415.1"
                     /db_xref="GI:503924421"
                     /db_xref="GeneID:11372351"
                     /translation="MRALLLIALAAAAWAAWHWSRFPGKWDHAFSTRYASDRASLVTG
                     RRSLREVNKEAARAENSARKRAGAEEAKYQQDIQELENEIAGLLRPGLGSHVKGPIGD
                     LTLYKHAVKKTGENPVDIPLAGLTATFRSDPTYMIDLTLPGSRTHRTKYPRRREPGDE
                     ATPFFTAEQLSDFTLEIMNAAADESNFRACRDARLPRARKELEAAQNNSAARDEALQT
                     LQDVCAWQKSNPRRIEALANLEEKRRQWQQLTGKMPPK"
     gene            complement(49580..50263)
                     /locus_tag="SFLA_RS33115"
                     /old_locus_tag="Sfla_6689"
                     /db_xref="GeneID:11372353"
     CDS             complement(49580..50263)
                     /locus_tag="SFLA_RS33115"
                     /old_locus_tag="Sfla_6689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003979140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158417.1"
                     /db_xref="GI:503924423"
                     /db_xref="GeneID:11372353"
                     /translation="MSLAIEQLLADAGQAAHEPRRAFDVAAGLRRLARDAGYTAAPPD
                     PFIPPLAHAHHQLVIVSRWCLTHSGAAVHIERLAAELGEETSSEVRAPLKDLDVDGAH
                     IFACMLYLADHPESALFWWQLAAGAGHGIAAYCLYLRHLGLGESREARHWLQQLQRPL
                     DGPDDEFMTGLDRFTLYIRRHGSPNLVSTGGIEVEIERLADTGNTGGLVCRPDQQLAD
                     RLHELAGQH"
     gene            complement(50260..50784)
                     /locus_tag="SFLA_RS33120"
                     /old_locus_tag="Sfla_6690"
                     /db_xref="GeneID:11372354"
     CDS             complement(50260..50784)
                     /locus_tag="SFLA_RS33120"
                     /old_locus_tag="Sfla_6690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase"
                     /protein_id="WP_014158418.1"
                     /db_xref="GI:503924424"
                     /db_xref="GeneID:11372354"
                     /translation="MTEDVRADGSSPVADAVLPLPLEFEAHYVTHQEAYHRYALFYLG
                     SNDAAEEAVHRVFYEILRHWDALLAESNLQQQTWAIMRRVVISQSLMSFRKKITLMHS
                     NIGLFAALSKLPARQFDVIVLRYIERYDTKRISWYLGITHSTVDYHCRKAKERLSELL
                     KLDIEPKNTKGKAE"
     gene            complement(51730..51921)
                     /locus_tag="SFLA_RS33680"
                     /db_xref="GeneID:25120675"
     CDS             complement(51730..51921)
                     /locus_tag="SFLA_RS33680"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799148.1"
                     /db_xref="GI:908665224"
                     /db_xref="GeneID:25120675"
                     /translation="MPAVLWSRAGMAVSSRMKWRGECPAGSAVTWAPSRMRPLGSCGI
                     RVWPGMLWSAIQSARAALM"
     gene            complement(52750..53322)
                     /locus_tag="SFLA_RS33130"
                     /old_locus_tag="Sfla_6693"
                     /db_xref="GeneID:11372357"
     CDS             complement(52750..53322)
                     /locus_tag="SFLA_RS33130"
                     /old_locus_tag="Sfla_6693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158419.1"
                     /db_xref="GI:503924425"
                     /db_xref="GeneID:11372357"
                     /translation="MGFMESRTAAGLRIVEEWTAPDRLVPPTVIGQAPSIPFEDGRVE
                     VLRDFLDPLLQQKANADWYRLAVEGGLFSETDRRFLIALSPGRDRLSRWHCVELQSEW
                     DIMSKGADGLLGSAPYRPEFSMLSLDGNVLCFATTWEYAISTSVLKAPHRSHVLRHWA
                     EGLTDGSMDDMGDPNDLPLSVAARRWLDHH"
     gene            complement(55441..55647)
                     /locus_tag="SFLA_RS33135"
                     /db_xref="GeneID:23391565"
     CDS             complement(55441..55647)
                     /locus_tag="SFLA_RS33135"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826049.1"
                     /db_xref="GI:754215750"
                     /db_xref="GeneID:23391565"
                     /translation="MGPSQHLSWVQILMPILHGWQRNTLTLRRFRIVYAKTESSMRTR
                     CGSLVEDSQRLCATFTELAWFTAI"
     gene            complement(56062..56823)
                     /locus_tag="SFLA_RS33140"
                     /old_locus_tag="Sfla_6695"
                     /db_xref="GeneID:11372359"
     CDS             complement(56062..56823)
                     /locus_tag="SFLA_RS33140"
                     /old_locus_tag="Sfla_6695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158421.1"
                     /db_xref="GI:503924427"
                     /db_xref="GeneID:11372359"
                     /translation="MSGNETAGVDLSRAALGAAMEAARKNGTGPKVKRKPQAVTMVRR
                     DGREAMGLGTAIGALVTERAWELPAAGATLQERWAAIAPELAGHVAAVSYDPDSGWLT
                     VCPESSAWATKARMEQTRVIAAATRAAGRTVVRALRILPRDVAPAPGPAAVLADSAPA
                     APTGPARTRETACEGYRSALAAHQEVAPPRRVGPGIAAAVERQTAAIRELSCRAFPET
                     DIAVLNDAPAPIEPARAERAVPEPSRAPQAAGEVP"
     gene            complement(56820..57212)
                     /locus_tag="SFLA_RS33145"
                     /db_xref="GeneID:23391566"
     CDS             complement(56820..57212)
                     /locus_tag="SFLA_RS33145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006919930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826051.1"
                     /db_xref="GI:754215752"
                     /db_xref="GeneID:23391566"
                     /translation="MGAGPGPAGHAKARRAEAAAAQPADDVPAAPVAPVAMPAPRPAP
                     AVVPGAEPEFADADDDQEFVLEELTREQVLDWRNRAAADHQLVFDHIDRYGELSAQRL
                     FTRAFVSQVQRLSGLGHLDVDYTTWGQA"
     gene            58378..58773
                     /locus_tag="SFLA_RS33150"
                     /old_locus_tag="Sfla_6697"
                     /db_xref="GeneID:11372361"
     CDS             58378..58773
                     /locus_tag="SFLA_RS33150"
                     /old_locus_tag="Sfla_6697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158422.1"
                     /db_xref="GI:503924428"
                     /db_xref="GeneID:11372361"
                     /translation="MKVAVELVGARVTRTAFDYQVRISFTDHEPDGRVRLDGELVIET
                     PITVTDAVGTQAILLPGTGTALAPLLGLFTKAVTKAEVTGLGTLSLGFDDGTRLSIDP
                     DPDYESWSLTGSGLEPVLVGPGGETDWQH"
     gene            58878..59468
                     /locus_tag="SFLA_RS33155"
                     /old_locus_tag="Sfla_6698"
                     /db_xref="GeneID:11372362"
     CDS             58878..59468
                     /locus_tag="SFLA_RS33155"
                     /old_locus_tag="Sfla_6698"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158423.1"
                     /db_xref="GI:503924429"
                     /db_xref="GeneID:11372362"
                     /translation="MTTAPDAPPHTVLPYGPGNRWTFTYEGNGYVKTEELALYAEPNG
                     STLTDDYLANKISTEALWQMWVDEWADSYHKQWPNLYRPGEVHISWYVTTPDITGTFE
                     GASHITDWRTLPGQLDADRGQEDFLTHYTHPTHVVTGERLNWLRLPVVDRGWNSGASN
                     KGGFIQQATGWKPSPLQPTMDVRQIGAAAGLYVPPL"
     gene            complement(59940..61325)
                     /locus_tag="SFLA_RS33160"
                     /old_locus_tag="Sfla_6699"
                     /db_xref="GeneID:11372363"
     CDS             complement(59940..61325)
                     /locus_tag="SFLA_RS33160"
                     /old_locus_tag="Sfla_6699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015577925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaB domain protein helicase domain protein"
                     /protein_id="WP_014158424.1"
                     /db_xref="GI:503924430"
                     /db_xref="GeneID:11372363"
                     /translation="MSSTHDLPAQHPAAHLEEPRLHTDQAAFLRTPPQSLEAEQATLG
                     TLMTSMGASQRYFAETLETGILAEEYYKPAHTVIHRAICDLHKAGEPADVVTVAAELV
                     KRGELSKVGGAPYLHACIQAVPTTANGPRYAEIVRAKAYRRAAIESAQKILQYAYSEE
                     GDEADVRGLVEQELTAIVAGTPGLRDAPPLVDDIYLDYVAELEEIQNGRQLGLSYGIT
                     DLDAMTSGMHPQNVTVIAAQSGVGKSTLALNAAVAAAKNGATVMFSSLEMSSTELMHK
                     IVAAEGSLALHHLTRIDGLTSEDWKKVERLGRELFRTLPLRIHRPDHASLRDIESAAR
                     ACARKDGLDVLVVDYLQLVEIEQTRNITREQAVAAVSRGLKNLSVDLKCHVIALSQLN
                     DDGMVRESRAIKNDASVMIKVERPDMDEPESPRAGEVDFVIEKNRFGPRATVSAAAQL
                     HYSRFIDMQSA"
     gene            complement(61402..62496)
                     /locus_tag="SFLA_RS33165"
                     /old_locus_tag="Sfla_6700"
                     /db_xref="GeneID:11372364"
     CDS             complement(61402..62496)
                     /locus_tag="SFLA_RS33165"
                     /old_locus_tag="Sfla_6700"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826053.1"
                     /db_xref="GI:754215755"
                     /db_xref="GeneID:11372364"
                     /translation="MTVEEIHETGAITHRGPVASVQVHAHMEFGPYALTAPLDTKIVI
                     QLMFMLAEQTRQGPDAGLLRVTPLTVLERLRELGVRAGNGSALVGKNAVYDSFARLRE
                     KGYIRRITPRDEKGRPTGTAYEFYDWPSWNPDAPNETEIADSALFPQVSTTSGNAGTG
                     NAGSHVAQKGAKQQSVQVKSTSGIAGSGIAGSGIAGSAFPQVKSTSGNAGNPPHPPEE
                     VTTSSPNPLTDTTGLGSLPSPREEGEAGYAEEDLQAAADVLQLLPDPWTQGKLNASKL
                     APKLLGVMAEQGWPGIHTVDRALLTRQLTKNPHKITNPYRLLAGDRIPNLPRYAVVAT
                     TPAPGSTADGWCPKHPKYRAGNRCIPCVTA"
     gene            complement(63025..63711)
                     /locus_tag="SFLA_RS33170"
                     /old_locus_tag="Sfla_6702"
                     /db_xref="GeneID:11372433"
     CDS             complement(63025..63711)
                     /locus_tag="SFLA_RS33170"
                     /old_locus_tag="Sfla_6702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding protein"
                     /protein_id="WP_014158427.1"
                     /db_xref="GI:503924433"
                     /db_xref="GeneID:11372433"
                     /translation="MNADEAVLLDDTLVNCLEARLGELLRAGRANTLNLEGRFEISRI
                     SASLSGQLRSAPRAILMAGMPGAGKTTLARAFEQAGMVRLCPDEEMFRRYGHYGRDFP
                     RGQFRVREAPVLKEIALELQEHLAAGRDVVVDHGFWTPEERGQWAASAMEAGGSPVLV
                     YLPVPHEVRWERIRERNARALIDANSIEFSEEDLQRFAGRFHPPTADEQHIVYDGDPS
                     AVLDLVGLRR"
     gene            complement(63711..64466)
                     /locus_tag="SFLA_RS33175"
                     /old_locus_tag="Sfla_6703"
                     /db_xref="GeneID:11372434"
     CDS             complement(63711..64466)
                     /locus_tag="SFLA_RS33175"
                     /old_locus_tag="Sfla_6703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014158428.1"
                     /db_xref="GI:503924434"
                     /db_xref="GeneID:11372434"
                     /translation="MPGQQRADNRPPYARIAGHYRDLISSGELAPGELLPSIRALADQ
                     WQVSTATADRAMKLLRDEKLVNGIPGVGTEVMARPVSLASGSERHDRSSRTKSSWGVG
                     EKSSGHTAAMVAAPEDVAHALGINPGDDVVRRSRVYRDAHGIVSHSTSWIPAEFAQVL
                     PELARSERLKGGLSLDLIAEATGRQVTHRVDEETARIATPDDLKLLELDAETVAAILV
                     LTARFLDADDELLEYGVDLGAPGRTRRTMSEVL"
     gene            64793..65701
                     /locus_tag="SFLA_RS33685"
                     /old_locus_tag="Sfla_6704"
                     /db_xref="GeneID:25120676"
     CDS             64793..65701
                     /locus_tag="SFLA_RS33685"
                     /old_locus_tag="Sfla_6704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003954248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158429.1"
                     /db_xref="GI:503924435"
                     /db_xref="GeneID:25120676"
                     /translation="MASRTRTERPSRTRTRRTNGRPALALSTIPAQELNLLPGEMSLV
                     CRDCKTWCPITGLKTPKMAPHRRPEEQGAHRCPSSNQLLEANVTFDEWREQLMTVEAT
                     ATYRRAPRQHHKPLPEPFTPVHRLAARERTSLVHLFVLLEQARHALCAHRTACTGCRG
                     GGRCATGRDLEISFRETQATCTIAREQQMRSDRLNAQRARAVRTGQERTRAYVLDKAH
                     QIDQLRRAVPQGALPTEGPEVPLIHLAPRQAAAQPEEGQIKCEHCGATESGLADAVAA
                     GWHRVTRRPHCGRCAQRFPAWTRTSF"
     gene            65884..66432
                     /locus_tag="SFLA_RS33185"
                     /old_locus_tag="Sfla_6705"
                     /db_xref="GeneID:11372367"
     CDS             65884..66432
                     /locus_tag="SFLA_RS33185"
                     /old_locus_tag="Sfla_6705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009998991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcriptional regulator"
                     /protein_id="WP_014158430.1"
                     /db_xref="GI:503924436"
                     /db_xref="GeneID:11372367"
                     /translation="MHRMTSTQARHTRRAVLQAAVDAGARCHGADSDPDLFFRADDEG
                     LAAWRARRTKAIRLCTGCPVRAACEELALRDGDGRPDADEMVRAGLTGRELAAVRAAH
                     TERLAAAVEADRDTEGRRLDTLTTQLQREASTNPDSNRNGGVRLMAARTAAQNDRLRA
                     LAAQIRQIRTARRVRAGWGAAA"
     gene            66429..66713
                     /locus_tag="SFLA_RS33190"
                     /old_locus_tag="Sfla_6706"
                     /db_xref="GeneID:11372368"
     CDS             66429..66713
                     /locus_tag="SFLA_RS33190"
                     /old_locus_tag="Sfla_6706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003955500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158431.1"
                     /db_xref="GI:503924437"
                     /db_xref="GeneID:11372368"
                     /translation="MSTTTLIPWAGRAADVGREIGRQDDRGGDDGRGYERDETDRFHQ
                     YVHGLVLHGDTRAHTAGRRARRTLAGMAPGYKRQPILQPVRPLVFGSETS"
     gene            67299..67625
                     /locus_tag="SFLA_RS33195"
                     /old_locus_tag="Sfla_6709"
                     /db_xref="GeneID:11372370"
     CDS             67299..67625
                     /locus_tag="SFLA_RS33195"
                     /old_locus_tag="Sfla_6709"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158434.1"
                     /db_xref="GI:503924440"
                     /db_xref="GeneID:11372370"
                     /translation="MTPTLNLDSFRDQHGDPTRWSTADIDSYLVLGDIAPPEPLPYTY
                     AEMQAMAADYQRSANDQKAIADRLAGEGHDTAASIWRRGARGARELAAAARMGWPAFE
                     AHLNGW"
     gene            68186..70093
                     /locus_tag="SFLA_RS33200"
                     /old_locus_tag="Sfla_6710"
                     /db_xref="GeneID:11372371"
     CDS             68186..70093
                     /locus_tag="SFLA_RS33200"
                     /old_locus_tag="Sfla_6710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2637 domain-containing protein"
                     /protein_id="WP_014158435.1"
                     /db_xref="GI:503924441"
                     /db_xref="GeneID:11372371"
                     /translation="MTLTDWPRTAVGPDPEPSSPTPVSETPAVVSGTPGIVSETPGLV
                     SQPTNGTETEPSGGPLTGTQRLAIGAIVAAALVLAGIGLYLSFAHVADFAHQELRFGS
                     LDKGRLFAVGVDVGIMVMIAVDLLMAWLKRPITWVRYPVWLLTCATVVLNAASAAPQD
                     EAPWALMDYIAAFAHGVVPVLFIMIVEVGRDSIDRMVRPKRAERDSIPWIRWTLAPIA
                     TSKIFRRMRLWGVTSYPEMVRRDQDLIAYEQWLKRKHKGDLHKAKDDELLPMKMAPYG
                     YTVDEALALPGQQDEAARKRAEKAERERLDAETRSQIAEAEAEADRLRAKGKVELVQA
                     EVDGQTGQARAHAKAQVSAAERAAELEREALDNAVIAEGRARKAQAERKEAEDRQAEA
                     QADLETAGLERQAAEQRRIAAEADQIAAAEAQAIETQTIAEARRAAAKADLERAGLER
                     QAAQNRKEAAEADRVAAAEAQAIETQAIAEARKAAAEADRAAAETEKVAAETRRAAAE
                     TDRKTAEENQRREAALADIVRARKAAAEADRAAAETRQAAAEIERRAVEIEDEAKLSG
                     RQRAVRKVARMALTAGLTPDGLAPEDLHRELCERISIAAVQQQLDVSSTDTASKYRTE
                     AAALLADGYRP"
     gene            70216..70689
                     /locus_tag="SFLA_RS33205"
                     /old_locus_tag="Sfla_6711"
                     /db_xref="GeneID:11372372"
     CDS             70216..70689
                     /locus_tag="SFLA_RS33205"
                     /old_locus_tag="Sfla_6711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158436.1"
                     /db_xref="GI:503924442"
                     /db_xref="GeneID:11372372"
                     /translation="MNSNEPSTAPLRDVAQNAEATARYLADMQRVLLDMGANLEILQR
                     ETRVHCRSTSVEGDRWYHAKLRALPVEKALKDVLKSLNSLTDGLEKSAYKRRSHDEAV
                     VNTGKARKEKALEKVRKNNPQQIQPASNPGESGDSGQNPGYGGPASIYDLGKRSA"
     gene            70686..70916
                     /locus_tag="SFLA_RS33210"
                     /old_locus_tag="Sfla_6712"
                     /db_xref="GeneID:11372373"
     CDS             70686..70916
                     /locus_tag="SFLA_RS33210"
                     /old_locus_tag="Sfla_6712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter"
                     /protein_id="WP_014158437.1"
                     /db_xref="GI:503924443"
                     /db_xref="GeneID:11372373"
                     /translation="MTRPLLKAEIKAQRSRDYLIAQRTAFIEKHGEDLGAFYFLIMLV
                     QTHGRKALKRGDTAALRSLAHDLHALYLKHTA"
     gene            complement(70946..71173)
                     /locus_tag="SFLA_RS33215"
                     /db_xref="GeneID:23391568"
     CDS             complement(70946..71173)
                     /locus_tag="SFLA_RS33215"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826055.1"
                     /db_xref="GI:754215757"
                     /db_xref="GeneID:23391568"
                     /translation="MWKEPSGVGEFGRPVEDVTGYGEIDELAFGVVTGHEMLPPGGLT
                     TSDCLAYACARLGVWVCRRLGVGDASRAAAR"
     gene            72629..73054
                     /locus_tag="SFLA_RS33220"
                     /db_xref="GeneID:23391569"
     CDS             72629..73054
                     /locus_tag="SFLA_RS33220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014677478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799149.1"
                     /db_xref="GI:908665225"
                     /db_xref="GeneID:23391569"
                     /translation="MTQPRTTASAQSGMAAQHRTDITFDQYLVEIANIALAASADQER
                     AEELAAALGKVADALRDMATDLVGDHNIDTKVTNLISDLADAAGRMKAQAERCAQTCE
                     IAAEAARLAAVGVARTYGEDMQAMDDAGLTHASSAAHHD"
     gene            73072..73488
                     /locus_tag="SFLA_RS33225"
                     /old_locus_tag="Sfla_6714"
                     /db_xref="GeneID:11372375"
     CDS             73072..73488
                     /locus_tag="SFLA_RS33225"
                     /old_locus_tag="Sfla_6714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_014158439.1"
                     /db_xref="GI:503924445"
                     /db_xref="GeneID:11372375"
                     /translation="MSSELSPRPATTPAPADGDNRYKSVQLKLKKLAAAMDSSSDELG
                     SLQREMRANAERTEALAVDIANAHLDTRFVELTNTVAIALGGAAHDVSKLHQNAQDVA
                     QTTHETQRTHSTLYSALDDIRSSRKERTPKPGFFAR"
     gene            73596..75701
                     /locus_tag="SFLA_RS33230"
                     /old_locus_tag="Sfla_6715"
                     /db_xref="GeneID:11372376"
     CDS             73596..75701
                     /locus_tag="SFLA_RS33230"
                     /old_locus_tag="Sfla_6715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein ParM"
                     /protein_id="WP_014158440.1"
                     /db_xref="GI:503924446"
                     /db_xref="GeneID:11372376"
                     /translation="MSVPRSVALERIAYTLAAPVLAAAPNLSPDGSVNTGMLLAGAAG
                     VGGALLAVKSREGTGRKLVRLSPVVFGAAVDAAAMYTTGWGWDAALAAAWAAAGWWLL
                     PLSRSARRHHRPALAPIPQPARTAPATAAPPVVDDGADPFTRDVRLLWERAGNPGRTI
                     VAHADRHPVTSHDLTMLLRAAEPGRPITGLSEAGVAAAFGVDDDPDVVRFAQVVRQPG
                     RQGGPGWLEVHLTPDEAARRRKAPTEHEWWADRIGATSGPVPGSDFVKKVRDTERKVT
                     HYIAQVPDEQGEPRVNLHALAAALKTKYDEGRLFVTIDGNQVLVSLWDSSPLAQVFPA
                     TRELLTPDKDGRWVTGYLGNGQPARNRVYTDRGAAHGLFVAPSGGGKTQLMGLHVAAD
                     ALFGAVVMLATEAPDEKTAALGEHTARYGVGALYMIRLLRVMVALMEIRGQMRWDDGK
                     VHEWDPKLPGCPYRMLSAYLDEFLSAARNGDYGAEIMDLAELVSVKGRKYGVGLKVAG
                     QSVYVQDGFTQLLCENLRENCIPVVLKVAPKKITDMFRALGIPSENTPDPLPRSFSPA
                     EAGRIERVMAGQPEPPSDSNTGGAGWIIEGKQPDILRTLFMDFKAGIDDFFPDTIATL
                     TDHEIRELELRDLWFDWTEPPRPGEFGPEPDDEDGDDTAPKKRGGGKPRSGQKSGPRR
                     DAVNSPRQALDAIRTFTNA"
     gene            75788..76309
                     /locus_tag="SFLA_RS33235"
                     /old_locus_tag="Sfla_6716"
                     /db_xref="GeneID:11372377"
     CDS             75788..76309
                     /locus_tag="SFLA_RS33235"
                     /old_locus_tag="Sfla_6716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158441.1"
                     /db_xref="GI:503924447"
                     /db_xref="GeneID:11372377"
                     /translation="MPTTHIQSIPTLPTRAPAVLSLEARLAAVEAAMTVALDEAAVAY
                     EVRTAHIPTTPVADVVTLPLTPTLTPTNPYASPVANLLQRAQQRLLADGWCAGSQIRE
                     DGARCLYGAIRAEAAGDRSLEARGLEVLMDAIRSQFSDADSVPTFNDSWANGRVPMQM
                     LGQAAALADSCGQ"
     gene            76527..77767
                     /locus_tag="SFLA_RS33240"
                     /pseudo
                     /db_xref="GeneID:23391570"
     CDS             76527..77767
                     /locus_tag="SFLA_RS33240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006379116.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /db_xref="GeneID:23391570"
     gene            complement(77782..78126)
                     /locus_tag="SFLA_RS33245"
                     /pseudo
                     /db_xref="GeneID:23391571"
     CDS             complement(77782..78126)
                     /locus_tag="SFLA_RS33245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016828384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:complement(78001..78003),aa:OTHER)
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:23391571"
     gene            78421..78723
                     /locus_tag="SFLA_RS33250"
                     /db_xref="GeneID:23391572"
     CDS             78421..78723
                     /locus_tag="SFLA_RS33250"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826057.1"
                     /db_xref="GI:754215760"
                     /db_xref="GeneID:23391572"
                     /translation="MEGVPLEESEARRRAEEFGRTLTDRWDEWAFELNLWTIPAVTGV
                     YGFTWSPTAKDELGRQIRVGGNWPILVDRETGACRVVQGSNEMATLRGTSGVRTAR"
     gene            79258..79726
                     /locus_tag="SFLA_RS33255"
                     /pseudo
                     /db_xref="GeneID:23391573"
     CDS             79258..79726
                     /locus_tag="SFLA_RS33255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011039404.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane plasmid transfer protein"
                     /db_xref="GeneID:23391573"
     gene            80056..80421
                     /locus_tag="SFLA_RS33260"
                     /old_locus_tag="Sfla_6721"
                     /db_xref="GeneID:11372382"
     CDS             80056..80421
                     /locus_tag="SFLA_RS33260"
                     /old_locus_tag="Sfla_6721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014676360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158444.1"
                     /db_xref="GI:503924450"
                     /db_xref="GeneID:11372382"
                     /translation="MRRGTSEYEAAQEAMAEILLERARNGDWPIQYGKLSKLLADEGH
                     NIPAHSVEMDHLLADVSHQESTDGTKAMLSAMVVLKEKGEPGAGFYRLAREEFGRKGD
                     NVTIWGEEMKLLAHDFRQC"
     gene            complement(82652..83005)
                     /locus_tag="SFLA_RS33265"
                     /old_locus_tag="Sfla_6724"
                     /db_xref="GeneID:11372385"
     CDS             complement(82652..83005)
                     /locus_tag="SFLA_RS33265"
                     /old_locus_tag="Sfla_6724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158447.1"
                     /db_xref="GI:503924453"
                     /db_xref="GeneID:11372385"
                     /translation="MDLSATGEPVMTHEDPQVRVGVHIGQGTCILIRDGIDFAAYHAW
                     VEFAAPDQKSWTAEKVEFSAKRPDGESVGLTVDLLNDACDGPRDGVPDAIWKVVALAA
                     TSAGDVGIRYTAPTS"
     gene            complement(83109..83345)
                     /locus_tag="SFLA_RS33270"
                     /old_locus_tag="Sfla_6725"
                     /db_xref="GeneID:11372386"
     CDS             complement(83109..83345)
                     /locus_tag="SFLA_RS33270"
                     /old_locus_tag="Sfla_6725"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158448.1"
                     /db_xref="GI:503924454"
                     /db_xref="GeneID:11372386"
                     /translation="MGRAAVMTRADGEQRRRAVPISVSNFLVLLRETLPEFPGSLAAA
                     VVTTAAAAAYRAVRITRPRRPEPTSAESFARSHR"
     gene            complement(83448..84782)
                     /locus_tag="SFLA_RS33275"
                     /old_locus_tag="Sfla_6726"
                     /db_xref="GeneID:11372387"
     CDS             complement(83448..84782)
                     /locus_tag="SFLA_RS33275"
                     /old_locus_tag="Sfla_6726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="WP_014158449.1"
                     /db_xref="GI:503924455"
                     /db_xref="GeneID:11372387"
                     /translation="MLQTVFNGRGEFVLIALAAVTIAALVGYFAARKFLDRPWAYAGL
                     FATLAAELSVTIFFPSPGHVSGQCVLNRNYNEPFATEQGLLNVAMFLPIGLFGVLALR
                     RVFPVFLGGALLSVATELGQALAPWVGRSCDSGDVLTNTLGAGIGALIGWAIVRAVRG
                     EVHSLRSAGKPAVVVFAVGFIVCAVVWKAWITPLAVDSTSLQIAGGDEKAQAQQVLAA
                     AFDDHVDIKNVQLQSGQNDAPDLLMITLESGFAELSWPDKEQLTVSLESTSQPGPGSF
                     AVPGAGAAPESADDALRIATKYAKERFPWGLEDSHVKSFPVGDDAEFGWMVSWRSRVD
                     GVLMPMRLDVQINRAGRVSALLTRHAEDFTSIPPRKVSEKQAAATASKYAGGAKTAAG
                     NLLAIRREGEWRAQWVIPVSSGTDSYPVYVDAETGKVDERASLVQGLPTAPN"
     gene            complement(84852..85307)
                     /locus_tag="SFLA_RS33690"
                     /old_locus_tag="Sfla_6727"
                     /db_xref="GeneID:25120677"
     CDS             complement(84852..85307)
                     /locus_tag="SFLA_RS33690"
                     /old_locus_tag="Sfla_6727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004932411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158450.1"
                     /db_xref="GI:503924456"
                     /db_xref="GeneID:25120677"
                     /translation="MNVFAHKIVRSAAVAGLTLASMGGTGAAQASTSAPSGDVSIQES
                     CPSSGQVGYGRVCTSLSSGRLFHDKTQGSGPVTVRTWYEKNSGGSSISAKLGFNYAGT
                     TTWGSTFTQSPGTTKSASWSRNWSSDCYSTIGMMSVTGQGTYQTPSGTC"
     gene            complement(85700..86044)
                     /locus_tag="SFLA_RS33285"
                     /old_locus_tag="Sfla_6728"
                     /db_xref="GeneID:11372436"
     CDS             complement(85700..86044)
                     /locus_tag="SFLA_RS33285"
                     /old_locus_tag="Sfla_6728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018520745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826112.1"
                     /db_xref="GI:754215823"
                     /db_xref="GeneID:11372436"
                     /translation="MPDGLPRSGTISNLEKNRVLLDWLRWQVGQTERRIRELETQEAQ
                     ERERRERARAEMSWKIQPQRSSSIALLHRGGCATYPDRVGLISREDAKVALAEPDIEP
                     CQVCRPDTGLLS"
     gene            complement(86082..86324)
                     /locus_tag="SFLA_RS33290"
                     /old_locus_tag="Sfla_6729"
                     /db_xref="GeneID:11372389"
     CDS             complement(86082..86324)
                     /locus_tag="SFLA_RS33290"
                     /old_locus_tag="Sfla_6729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158452.1"
                     /db_xref="GI:503924458"
                     /db_xref="GeneID:11372389"
                     /translation="MERFPFPDDLVRAQQEWHNTYRALACSRPRRATELRRRLLALSV
                     RIHCHPFWSTPPGRTPAARVDLRQRTRGGRRTESAA"
     gene            complement(86375..86812)
                     /locus_tag="SFLA_RS33295"
                     /old_locus_tag="Sfla_6730"
                     /db_xref="GeneID:11372390"
     CDS             complement(86375..86812)
                     /locus_tag="SFLA_RS33295"
                     /old_locus_tag="Sfla_6730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158453.1"
                     /db_xref="GI:503924459"
                     /db_xref="GeneID:11372390"
                     /translation="MQRMIISAALAAALVPLAAASAVSAPTAAQAYVDKRVRNCAGKA
                     SDCRPGAVAHYWYKRGSSARGVGWVYASREGARTGTARWLFKKPGDTWKTGGAWKRAG
                     RVGGTFAETSWGRDGHTGPVYPRGTRICVQFRGLPTKACVSLK"
     gene            87065..87730
                     /locus_tag="SFLA_RS33300"
                     /old_locus_tag="Sfla_6732"
                     /db_xref="GeneID:11372391"
     CDS             87065..87730
                     /locus_tag="SFLA_RS33300"
                     /old_locus_tag="Sfla_6732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158455.1"
                     /db_xref="GI:503924461"
                     /db_xref="GeneID:11372391"
                     /translation="MINNVARSLAAAVLTLVPLLAAAPVQAAEVTTLADGVHALPLAA
                     ESRTGYERSSFKHWVDADKDSCNTRMEVLIAESRIAPTIEAGCKVTAGSWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLGSDRSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTVDQPEADALTTLAESCGQQPLDFEPATD
                     PSK"
     gene            complement(87859..88590)
                     /locus_tag="SFLA_RS33305"
                     /old_locus_tag="Sfla_6733"
                     /db_xref="GeneID:11372392"
     CDS             complement(87859..88590)
                     /locus_tag="SFLA_RS33305"
                     /old_locus_tag="Sfla_6733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014140713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158456.1"
                     /db_xref="GI:503924462"
                     /db_xref="GeneID:11372392"
                     /translation="MRRSRVAALAAVVLSATLISCNPQLADDKPNGSTPTSTGSAASP
                     APGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPEQGDRCKLAGGVWMSYYDEVEVTDAKKLDIDHMVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     VEKTALLDLAKDCTDTVVEFEEAAE"
     gene            88865..89341
                     /locus_tag="SFLA_RS33310"
                     /old_locus_tag="Sfla_6734"
                     /db_xref="GeneID:11372393"
     CDS             88865..89341
                     /locus_tag="SFLA_RS33310"
                     /old_locus_tag="Sfla_6734"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158457.1"
                     /db_xref="GI:503924463"
                     /db_xref="GeneID:11372393"
                     /translation="MSAWLTPDQVASGALSLGYAMMIAALQGMTCDTSLLYGHGANAF
                     ATYPGLTRGKKANHLWLPLAVIESEDTRARLGDARTEEERLERAVDAFARYLGQSRPD
                     AMVSDLLHEPPAPAPVVVLSPNRTPTPSGPARHAPGRPPSTTNASTKPNHSSVSTS"
     gene            complement(89760..90410)
                     /locus_tag="SFLA_RS33695"
                     /old_locus_tag="Sfla_6735"
                     /db_xref="GeneID:25120678"
     CDS             complement(89760..90410)
                     /locus_tag="SFLA_RS33695"
                     /old_locus_tag="Sfla_6735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158458.1"
                     /db_xref="GI:503924464"
                     /db_xref="GeneID:25120678"
                     /translation="MLIVNAVLETPDTVDFSLWPVADLPPYQFMALSGGMSPLEVGSA
                     LAMLADYNSRTGDDDRPVMDASEAIRRLLETDKVIAPGGLRFHDTRINAIVQPGCCCG
                     LEDWREWLDVAGGETLWLGHDPSPRLEHADGSVQLWPDGGDAQETPPGQPIDIVAGDL
                     PGILHTVQEGLQGFLALTMKWAARQSPTLAADLAARLDADLVISAPLPGTSGQHVP"
     gene            90607..91164
                     /locus_tag="SFLA_RS33320"
                     /old_locus_tag="Sfla_6736"
                     /db_xref="GeneID:11372395"
     CDS             90607..91164
                     /locus_tag="SFLA_RS33320"
                     /old_locus_tag="Sfla_6736"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826059.1"
                     /db_xref="GI:754215762"
                     /db_xref="GeneID:11372395"
                     /translation="MPSPTRTHAVRASAARARSTTVHDQRQRAAQPQREYRLTDAQKQ
                     RLADMQEERELAGVRAWNRRPYGDRTDQELTRLIANGPVDARREDRAAAAAEESERAL
                     LQEIAEAEAGGTSLGQIEVAPIYVLLDQADEHLAAARVEQAREQAPPRSPRPPTNTFG
                     SSGPLTARAASRCAWRAPPARSTPS"
     gene            91128..91670
                     /locus_tag="SFLA_RS33325"
                     /old_locus_tag="Sfla_6737"
                     /db_xref="GeneID:11372396"
     CDS             91128..91670
                     /locus_tag="SFLA_RS33325"
                     /old_locus_tag="Sfla_6737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012258294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158460.1"
                     /db_xref="GI:503924466"
                     /db_xref="GeneID:11372396"
                     /translation="MAGTSRKEHTQLTKQAEAARAAAWREGADARVAARQAAADAWKV
                     LRDSPYVTVLGATERQAPDVDTLATRLAEMRETKVPARAQQKDTGDEKRVARCHGQAT
                     TARENAAMYRAVAADARTEKTLRAQIAEQHPRLHESEVRARTELQQARDARTTRVAAQ
                     SSRSYQPPSQARSGPSRGRR"
     gene            complement(91807..91995)
                     /locus_tag="SFLA_RS33330"
                     /db_xref="GeneID:23391576"
     CDS             complement(91807..91995)
                     /locus_tag="SFLA_RS33330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014668657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826061.1"
                     /db_xref="GI:754215764"
                     /db_xref="GeneID:23391576"
                     /translation="MASGSGPLLTSHAALILLTAVMVGGAVAVLTYLSASNGAAAALA
                     GLMGAGASTPVLHTLIGS"
     gene            92526..92789
                     /locus_tag="SFLA_RS33335"
                     /old_locus_tag="Sfla_6739"
                     /db_xref="GeneID:11372398"
     CDS             92526..92789
                     /locus_tag="SFLA_RS33335"
                     /old_locus_tag="Sfla_6739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826063.1"
                     /db_xref="GI:754215767"
                     /db_xref="GeneID:11372398"
                     /translation="MTQAPRVFGTEHDAPTTGQQPGHTYRELVGGPLDGQLIEVTGWT
                     DEEITTGARLITPHSAYGPGGRASYGPTFSRPDGPWVWEGDLP"
     gene            92902..93192
                     /locus_tag="SFLA_RS33340"
                     /old_locus_tag="Sfla_6740"
                     /db_xref="GeneID:11372399"
     CDS             92902..93192
                     /locus_tag="SFLA_RS33340"
                     /old_locus_tag="Sfla_6740"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158463.1"
                     /db_xref="GI:503924469"
                     /db_xref="GeneID:11372399"
                     /translation="MSCTCAEGFTVQLHDGGTRYPVVPVDQHTEISYYFDARCTRCRS
                     KYEAPFARVDSKGQALTDQMQDVPVVDRVWFSKQCGPFTCGCGEESQAGDPA"
     gene            94857..95864
                     /locus_tag="SFLA_RS33345"
                     /old_locus_tag="Sfla_6741"
                     /db_xref="GeneID:11372400"
     CDS             94857..95864
                     /locus_tag="SFLA_RS33345"
                     /old_locus_tag="Sfla_6741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_014158464.1"
                     /db_xref="GI:503924470"
                     /db_xref="GeneID:11372400"
                     /translation="MLRIHFTSKDLARVTLGYNSSLPVSEAVMSLQALRRGSGPKFSA
                     WRHHLAGKQLPARVSLLGSLVPASGWAPDFLTPGPEHASPTTGAFDVIRATPRRRLAA
                     ELHRLSSHHRLPAWTHLLADGDREALDTVTDTLAAYYDVAVTPYADRMRAVLDADHAW
                     RVHTMARLGVGAVLAGLHPQVRWEEPVLELAGFAGQGQVDFHLEGRGLLLSAHIFCGS
                     RPRALLNEVGTPVLVYAPVWNLQSDSLVAAPADARPHVSTALAALLGRTRAAVLEALA
                     TPAGHNTKQLAERLAISPASASEHVAALRAAGLVTSLRHANMVRHTATTLGKNLISTA
                     T"
     gene            96290..96848
                     /locus_tag="SFLA_RS33350"
                     /pseudo
                     /db_xref="GeneID:23391577"
     CDS             96290..96848
                     /locus_tag="SFLA_RS33350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010361227.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /db_xref="GeneID:23391577"
     gene            complement(96903..97877)
                     /locus_tag="SFLA_RS33355"
                     /old_locus_tag="Sfla_6743"
                     /db_xref="GeneID:11372402"
     CDS             complement(96903..97877)
                     /locus_tag="SFLA_RS33355"
                     /old_locus_tag="Sfla_6743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018521842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799150.1"
                     /db_xref="GI:908665226"
                     /db_xref="GeneID:11372402"
                     /translation="MGFDLETRREVHVSEREPEHWKRLGYGGAGQLVCFYCFHGFEAP
                     AGTRVPLVTRGRLGGKVRRHFAHPPGQAPTGGHGPETVWHITTKHLLAAWARSRPGVD
                     RVRLEQWTEDHDRRADVEVLLQDGTKVALEAQRKLMTDDGWRARHRDYARQGVVDVWF
                     WRPRVHFPHVVLDEGLPVWFYSVSKREAATSLGRPHARVHRWWQVPDLAVFGLHHPPC
                     ALDELERVTIPLGALGLGPGGAVLPEDLQKRVLDSQRETREEAKRRKDSEARYARAAR
                     ESQERAARAPAPVPLPPLPPVPAGGLRCEVCRRPLDPLLARTRRHILC"
     gene            98514..99203
                     /locus_tag="SFLA_RS33360"
                     /old_locus_tag="Sfla_6744"
                     /db_xref="GeneID:11372403"
     CDS             98514..99203
                     /locus_tag="SFLA_RS33360"
                     /old_locus_tag="Sfla_6744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_041826065.1"
                     /db_xref="GI:754215769"
                     /db_xref="GeneID:11372403"
                     /translation="MTEPTYLHTTRVAYDTVAENYAKLVPSAFEDDLYGRAMISTFAE
                     LTRALDSGPVADLGCGPGHVTAHLQSLGVTAFGIDLSPETVAVARRRHPELQFDEGSM
                     TDLDLADGSLGGVIAWYSIVHTPPELLPVIFAEFHRVLASAGHLLIAFKAGDRLRHLE
                     NAYGHELSLDVYWVSPDRIAELLAQAGLMVDARLIREPNEQEKPRQGQQAYLLARKPV
                     EQGARAADTIA"
     gene            complement(99240..99691)
                     /locus_tag="SFLA_RS33365"
                     /pseudo
                     /db_xref="GeneID:23391578"
     CDS             complement(99240..99691)
                     /locus_tag="SFLA_RS33365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010047505.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:23391578"
     gene            complement(99708..100748)
                     /locus_tag="SFLA_RS33370"
                     /old_locus_tag="Sfla_6746"
                     /db_xref="GeneID:11372405"
     CDS             complement(99708..100748)
                     /locus_tag="SFLA_RS33370"
                     /old_locus_tag="Sfla_6746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018514116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826067.1"
                     /db_xref="GI:754215772"
                     /db_xref="GeneID:11372405"
                     /translation="MLISRDVDGANPQTRLRLGDVVVVLVGRVGEAASVTGEHEDWNT
                     ARSVAVVRCAAPALAEWVRVWLTAPAARAWCVAHASGSAQATLGLAKLRRLPVPMPPL
                     GVQDRVLRTVKTIEARIEANERIAETAVALADAHFAVATADRRNWPQHRFKDVVKART
                     GAAAKPSEPVSEGAGTAWAAPADVMRSPLPYLDQTAERVAEGADGDHEVCPPDTVLVA
                     PKAGEVQAAVNRMPVVAGRGVLAVRPHGPFDGWWLLHEIRSRSGELSALGQGTAGREL
                     SARAFLYAAVSWPPVEARGRFVRLAAPLHARALTAVRENRSLRLLLAESLRREVPATL
                     PAVAFATVPASR"
     gene            complement(100895..102280)
                     /locus_tag="SFLA_RS33375"
                     /old_locus_tag="Sfla_6747"
                     /db_xref="GeneID:11372406"
     CDS             complement(100895..102280)
                     /locus_tag="SFLA_RS33375"
                     /old_locus_tag="Sfla_6747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017679724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_014158468.1"
                     /db_xref="GI:503924474"
                     /db_xref="GeneID:11372406"
                     /translation="METTEYSQVVGKALDKLRGPLDIQDAQQLLLAVIFLRCVSDIPA
                     GGASGDRPQWRQLAELGSSLAGDHELTWALKQALDAWTSSYLDGGRPMSESIPDHLVA
                     GPLLREVLGLVDRADRLVELYEECLERFSNNKKGGNYFTPRHLVRLLVEMLAPRQGEQ
                     VFDPACGSGGFLVESARYVQEHGGSSAAVGLVGRDINPRARQVAWMNLTARGLEADLG
                     SRPVNSLWADDTPAGAFDVVFVNPPFNLKLARDDLRYDSRWRYGEPPRSNANFAWIQH
                     VVSKLTTRGRAAMLLPDGATFTSGAAAGIRRGLVADDLVSAVVALPAGLFPHTSISAS
                     AWIFSREKPAERRGQVLFVDARKQGNLVGRGRRTLSEGAIESIADTYRSWYAESYQDR
                     PGWCRSATVEEIAAQEFNLQAVRYVGAPAEAPAPQSAEQRVAELTRELYGHFADAARL
                     ETEIRDILGEL"
     gene            102803..103753
                     /locus_tag="SFLA_RS33700"
                     /old_locus_tag="Sfla_6749"
                     /db_xref="GeneID:25120679"
     CDS             102803..103753
                     /locus_tag="SFLA_RS33700"
                     /old_locus_tag="Sfla_6749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018851289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799151.1"
                     /db_xref="GI:908665227"
                     /db_xref="GeneID:25120679"
                     /translation="MLDFPPVPNGVDYLRSVVTHLNPATGGSPRDIKYAVLHLQAAAE
                     VLLKARLSREHWSLIFADPRTATSDAYAEAKFTSCTTGAAVERLRNIAGVSISDKEAD
                     ALDKLADDRNALQHYGLTFNAKVIEARAATVLDFLVRFIDEHLEPELRKSGPLYLEME
                     VVRRGLKDIQSFVTKRMNRLRGNELKDAENRTLRCPDCQQLAMLAEAGRSRCCFCGKA
                     WPAYDLADLLRTDEQPEPLDQCPGCYVPTLADNAVFADGKPTLFCTNCAGRFAPAELG
                     NCAACGCYCSTSDTGGQDLCIFCAEDIRRQEQEDHERFWM"
     gene            103794..104885
                     /locus_tag="SFLA_RS33385"
                     /old_locus_tag="Sfla_6750"
                     /db_xref="GeneID:11372409"
     CDS             103794..104885
                     /locus_tag="SFLA_RS33385"
                     /old_locus_tag="Sfla_6750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014158471.1"
                     /db_xref="GI:503924477"
                     /db_xref="GeneID:11372409"
                     /translation="MTTTPPAPVPGPRATLTAFRRDPRELWPEYARKLYDHLAAHYGE
                     DDPLPTLAASWIAHQRSLNTQKSYARGFRIFEEFAREHGAHPLTVSFPLADTFRLYLE
                     TTPTWVRVKGGRRGEMVRAGEPYSDASRANALSASSSFYSYLDIVSDTPLKNPFDAVR
                     RPVIDPGYSPTPGYTEAQWAALVVTARDHHRVAAYRKRAYAILLLLYTCCLRIDSLLS
                     AKVEHLGYDQGHHVIKVKVKGGSWRNKPIPPIAWDALQDYLDGRKTGWLICTASGGQL
                     DEPAVWQLLQSLAKRAGLPPRGPHGVKGDAVTHALAKKDARPDKIQRWADHHDSRTTQ
                     RYNRRKDNLDSPGYGIGADLAETLADTPT"
     gene            complement(105047..105370)
                     /locus_tag="SFLA_RS33390"
                     /old_locus_tag="Sfla_6751"
                     /db_xref="GeneID:11372410"
     CDS             complement(105047..105370)
                     /locus_tag="SFLA_RS33390"
                     /old_locus_tag="Sfla_6751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012887532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158472.1"
                     /db_xref="GI:503924478"
                     /db_xref="GeneID:11372410"
                     /translation="MTVTQADLNALSVAHPNLNANGYGSSAFAPQPVRLDEVQAAYAW
                     IAEQTWLTVPAESSYSLKHVMERVTGMYVTNGAFIAAALLHAPAGLEVQLDDLNPAIG
                     IKVEG"
     gene            complement(105471..105719)
                     /locus_tag="SFLA_RS33395"
                     /db_xref="GeneID:23391580"
     CDS             complement(105471..105719)
                     /locus_tag="SFLA_RS33395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826069.1"
                     /db_xref="GI:754215774"
                     /db_xref="GeneID:23391580"
                     /translation="MADLRKSGSLEQDADVVILLHREDAYDKDSPRSGEADLIVVTQC
                     GNGPPGPWHAEAARHMREGASNLGRRGPGLLGMVRYHT"
     gene            106146..106385
                     /locus_tag="SFLA_RS33705"
                     /db_xref="GeneID:25120680"
     CDS             106146..106385
                     /locus_tag="SFLA_RS33705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008739403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799152.1"
                     /db_xref="GI:908665228"
                     /db_xref="GeneID:25120680"
                     /translation="MNVSGDDQAEARAAPEGLAVKLLQAGERRGRGQAVGGDIDGLRA
                     IARACPDTLTGDRDKALTLTGFHYASRAARTRPGC"
     gene            106427..106855
                     /locus_tag="SFLA_RS33710"
                     /db_xref="GeneID:25120681"
     CDS             106427..106855
                     /locus_tag="SFLA_RS33710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008739403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799153.1"
                     /db_xref="GI:908665229"
                     /db_xref="GeneID:25120681"
                     /translation="MLTGKTKHSVRNAKICYADDPEICPVQAWTAYRTRLVAEHGERW
                     ADPSTPAFVGIDRWGHVTGGMEPDSVTRAITRISTRAGVPIAWTGHLLRIGLASVARR
                     KGRDGIAIADQGGWARYSRSMLGYMQRDDGWDDNASAGLA"
     gene            complement(106950..107684)
                     /locus_tag="SFLA_RS33405"
                     /db_xref="GeneID:23391582"
     CDS             complement(106950..107684)
                     /locus_tag="SFLA_RS33405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="WP_014158473.1"
                     /db_xref="GI:503924479"
                     /db_xref="GeneID:23391582"
                     /translation="MGRPEKPIRTLNPHLLMLATHLRETREEAGLTYAELAARTRHNW
                     SATTLQRAASGERIPRLEVVEAYVLACGARSAERARRLWRHARSYEHGADYTNAPRPR
                     LVESAADLRAALRATYYKAGAMPLREMERRAGLGRLPRTTVRRMLDGATMLDQEQLRS
                     FLTVCDVPERDHQDWLDAWTRVWKRNTVDGLYERSFADEMIVRLAVTTKAMGRQLMGP
                     PLARQRNIRRTLSPFAEGNLGTTQAG"
     gene            complement(107693..107926)
                     /locus_tag="SFLA_RS33410"
                     /old_locus_tag="Sfla_6755"
                     /db_xref="GeneID:11372413"
     CDS             complement(107693..107926)
                     /locus_tag="SFLA_RS33410"
                     /old_locus_tag="Sfla_6755"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158474.1"
                     /db_xref="GI:503924480"
                     /db_xref="GeneID:11372413"
                     /translation="MSRRRHAAGVRLPAPHRLTGTETAVIIVIILTSTALAWGGMDPN
                     ILVQLLASVLLLSVGSVVTLRFVRRAPLPLSRV"
     gene            108609..108884
                     /locus_tag="SFLA_RS33415"
                     /db_xref="GeneID:23391583"
     CDS             108609..108884
                     /locus_tag="SFLA_RS33415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826071.1"
                     /db_xref="GI:754215776"
                     /db_xref="GeneID:23391583"
                     /translation="MAAVEDILDAIGTLGGAGPELALILTVVAATTNGARRHLGLTMD
                     DQERSRLLPRRCCSRPAPRAPRPAARRGRRGLSPRLPGPRCLGIPQR"
     gene            complement(109019..109810)
                     /locus_tag="SFLA_RS33420"
                     /old_locus_tag="Sfla_6756"
                     /db_xref="GeneID:11372439"
     CDS             complement(109019..109810)
                     /locus_tag="SFLA_RS33420"
                     /old_locus_tag="Sfla_6756"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158475.1"
                     /db_xref="GI:503924481"
                     /db_xref="GeneID:11372439"
                     /translation="MTTAAFSDDDGDPLEELRDTQDAVRRAADAVSASFADLLAPQRE
                     VARLARETLMPAIDASRFINEVLAPQRAFQGQMRAMMQDITSMQRLVVPNPLDGVLAQ
                     IRENQQQYQDTFSRLTDGLVPRIDTSFLDGLLHDTVPWQGLSGPGRDILAGVLDDARA
                     SVEAGEEREVPEEMVTELEEQAAQFATSAPGLLPPAAQKYLFAVFTAGMVMTTLMYVS
                     VVSDAGNAVLDEVYQHGELAIIVFTAACLAWDRRQRNRGDDGGGD"
     gene            109972..110199
                     /locus_tag="SFLA_RS33425"
                     /db_xref="GeneID:23391584"
     CDS             109972..110199
                     /locus_tag="SFLA_RS33425"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826074.1"
                     /db_xref="GI:754215779"
                     /db_xref="GeneID:23391584"
                     /translation="MRTRGSWQHVVCDAAFLGGVARDTFGSYDFVWVLLGDACAAAAL
                     LSLVIRRTPSTYDTASVPLDRETASSRQNTA"
     gene            110485..111699
                     /locus_tag="SFLA_RS33430"
                     /old_locus_tag="Sfla_6758"
                     /db_xref="GeneID:11372415"
     CDS             110485..111699
                     /locus_tag="SFLA_RS33430"
                     /old_locus_tag="Sfla_6758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_014158476.1"
                     /db_xref="GI:503924482"
                     /db_xref="GeneID:11372415"
                     /translation="MASPYPGGEREKLVSKLPATLRQALKVRAAQLSTDVQDAVAAGI
                     QAWRDHPDQLPAVDTAGAESFGTYLPEGLYDGFKADCRTREVSYIQGLAQSVALWLAQ
                     NPAASAQPVRRLIVCNQKGGVGKTSVAAGLAQALAEGAEHILKAALAAGLSNEDAQSL
                     AQAGGQRVLLVDYDPQGHLSHQLGLKAIPAGEESLVTHMLHRDQAQHSLLDLTIPIDG
                     ERFGDQLHILPAAFDAFLLDSGLTIFRGPRHAALERALAPIEEHFDVIVIDSPPSLGL
                     SMDAGLYYGRQREDERPAASGLIIPVEAEDTSAQAYGMLINQVDSLARDYDIQIDQLG
                     LVVNKFDSRRGYIATSSRDKWMQLGTPPVLAVVPDLKEQREAVRLQKALLAYAPTSEQ
                     SHAMRQIAKGLK"
     gene            111924..112802
                     /locus_tag="SFLA_RS33435"
                     /old_locus_tag="Sfla_6759"
                     /db_xref="GeneID:11372416"
     CDS             111924..112802
                     /locus_tag="SFLA_RS33435"
                     /old_locus_tag="Sfla_6759"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008740906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799154.1"
                     /db_xref="GI:908665230"
                     /db_xref="GeneID:11372416"
                     /translation="MADSLTSRGIIQPLTVVTRSAFLAAHPGQDEALGTAQYVVVDGN
                     RRLAGAKVAGIDDVPVHIDDSLADDADTLLETALTAAVQHEDLDPLDEAKALQRLVEV
                     HGSQRAVARSLGKSSGWVTQRLALLKLTPDLQQAVEDKKLPVEVARTVGQLPEQQQGG
                     AAEAALVKREQKKATRKRGAYAVSTPAGSAAGPAKTAVPTAPSATSSSHQASTPAQHD
                     LGADHMPWADGAAVMDTVFARLNPAQRSAFILRYFQISRGVEDVVADMYGDLTPENRA
                     ALAVILDQVATQLRKA"
     gene            complement(112950..116567)
                     /locus_tag="SFLA_RS33440"
                     /old_locus_tag="Sfla_6760"
                     /db_xref="GeneID:11372417"
     CDS             complement(112950..116567)
                     /locus_tag="SFLA_RS33440"
                     /old_locus_tag="Sfla_6760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010643388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_014158478.1"
                     /db_xref="GI:503924484"
                     /db_xref="GeneID:11372417"
                     /translation="MVWDKKPGVAASATGAARADSGGLANSGVLHVEKLYQYAPTVEA
                     PSTEEVTAAVEAYAQRVREVFGRLDLEVLTPLSEQGEHPVVELREVFVPPLVRADPPA
                     VELPRELMRRLMEHGEITELGDLPPGADKGALARIREAYRQRPPKQVLHVLADGDVER
                     TALLGDPGAGKSTLARYLALTLTSPVMPEPLSALAGKLPIVVELRRYADERWRDRTFE
                     DFLEHLHSLEGMSVPRPVLDVLLQQQRVVMVFDGLDELFDPAVRNETSRRIGAFAARH
                     PGVRIVVTSRVIGYQRAILDGAGFKHYMLQDLDEDQIGEFARLWYTNACPHDASLAQN
                     LVERVTSAVAHSRPVRELAGNPLLLTILAIIGRRQTLPRDRQGVYKHAVTVLVAHWDR
                     DAKQLTTTGAPEALEVLGADERLELLRLLARRMQDGQGGIAGNHIHARDLEAVFGEYL
                     SEYELPPVQAKAAARGMVAQLRERNFILSRYGGEVYGFVHRAFLEYLAAADIAHRYKE
                     DREWTPEELITSVVEQRADDPAWHEVILLVIGQIPERDAARAIDRLLYMHQQCANRNN
                     RMLVLTIRALAEVRKIGALAPQSRAVVDSLRSAVSHSHYPGAAELQASLPALGTFNEY
                     WTGRQRYLHWFLLLGQHQVKTYDSATVASALYLSLSEPSVLAHFSPSADVRRSSLQHV
                     VDHLDDPTATLALLLDRATTDPHEGPRFIALQLLAERFAKEPGTLALLLDRATTDPHE
                     NPRCTALQLLAERFANEPRTLALLLDRATTDPHENPRCTALQSLAERFANEPRTLALL
                     LDRATTDPHENPRCTALQSLAEHFANEPGTLPLLTDHATDPHEKLRYTALQLLAEHFA
                     NEPGTLPLLTDHATDPHPTPRYIVFQLLAQHFANEPGTLPLLTDHATTDPHPTPRFLA
                     LHLLAQSFAKEPGTLALLLDRATTDPHEDPRDIALNLLAQSFANEPCTLALLLDRATT
                     DPHENPRYTALQLLAEHFTKEPGTLALLLDRATTDPHEEPRYTALQLLADHFANEPGT
                     LALLLDRATTDPHEEPRCTALQLLADHFANEPGTLALLLDRATTDPHEEPRYTAFELL
                     TQRFLEQPETLVFLQGRTRTEREPVLRARAFRALAAALPSGDVYEVGTSALEDDHSDV
                     RAGGAWILAFGCPNDPRGRAVLRDHAQSDPHADVRTAASDALRAAEVLSAQEWKLGSA
                     I"
     gene            117494..119215
                     /locus_tag="SFLA_RS33445"
                     /db_xref="GeneID:23391585"
     CDS             117494..119215
                     /locus_tag="SFLA_RS33445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020556889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799155.1"
                     /db_xref="GI:908665231"
                     /db_xref="GeneID:23391585"
                     /translation="MRDQIDQARVSHDTVVLSQVLAGGGGVGKTQLAAVYAHQSLAAG
                     VELVVWVDASETEQVIARYAQAAYWVQAAEGPAGKAEQDARAFLQWLATTSRSWLLVL
                     DDVTDLEGLQPWWPPPSSGGGGRVLATTRRHDALLSGGGRAVVNIDTYNAEEADTYLS
                     ERLRVANAVHLLDAQAGKVAEALGYLPLALAHAAAYMVNEDVPCTDYLHRFNDSTVRM
                     SALLPRQADTEGYGRRVAAALMLSLDIAQQCEPVGLAIPALRLASVLDPAGHPRSFWT
                     SEAATRYLSAHRLGPISAARSSDDVQAEGRSVIRLLHRYGLLIDDAQAGPRAVRVHAL
                     TARAVREHTPSDALPDIVKTAADALAELWWTVPPIYREERAVLRTNIDSLDGHAGDLL
                     WEVEGHHLLRWAGRSLTGYGLATAAVHYWQQLTATSERLLGRTHPHTLAVRRDLAVAY
                     FRADNPKQGFAMLQEDFHHQEHVLSLARPTAGEAGTTSQLEGTGTAIELLEDTLAARE
                     RLLGPEDPAALNARVQLALAYRHAGMTKNATLTLSALTTDTPQRTRQPGQRAPAHRLQ
                     RWWERKR"
     gene            120324..121031
                     /locus_tag="SFLA_RS33450"
                     /old_locus_tag="Sfla_6763"
                     /db_xref="GeneID:11372440"
     CDS             120324..121031
                     /locus_tag="SFLA_RS33450"
                     /old_locus_tag="Sfla_6763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_014158481.1"
                     /db_xref="GI:503924487"
                     /db_xref="GeneID:11372440"
                     /translation="MTARRPAPRRRPRRSPARSRKRKQAHTGGEILVGVVVIGWLSSQ
                     LMHWLAAHPWVPLLLALLAGAGAFIWFRSRVQAQALLHTQVRALRYPMAALDGLQHRQ
                     FEHAIRDLMLRDGCADAVQVGGAGDNGADVKATDPYGRRWVIQCKHRRAGLAGAAVGT
                     PDLHVLNGTGRPVHKGDVIVLVTNGRFTKPATEFARSQRLHLVDRHTLATWAAGSQPL
                     WELLRAVPPPRRPTTLS"
     gene            121177..121422
                     /locus_tag="SFLA_RS33455"
                     /old_locus_tag="Sfla_6764"
                     /db_xref="GeneID:11372441"
     CDS             121177..121422
                     /locus_tag="SFLA_RS33455"
                     /old_locus_tag="Sfla_6764"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158482.1"
                     /db_xref="GI:503924488"
                     /db_xref="GeneID:11372441"
                     /translation="MESFPFPDDLIHAQQAWHATYRQLATPRPRHTAALRRRLLALSV
                     RIQWHPFWSTPSGRLPAARAELKRLARHHGQLEARTA"
     gene            complement(121569..125354)
                     /locus_tag="SFLA_RS33715"
                     /old_locus_tag="Sfla_6765"
                     /db_xref="GeneID:25120682"
     CDS             complement(121569..125354)
                     /locus_tag="SFLA_RS33715"
                     /old_locus_tag="Sfla_6765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide TPR_1 repeat-containing
                     protein"
                     /protein_id="WP_014158483.1"
                     /db_xref="GI:503924489"
                     /db_xref="GeneID:25120682"
                     /translation="MSGSGTRRLSRGELIRQRAKARFVGRRAQLALFTENLSKDPLSE
                     EAPADFLFHVRGVGGVGKSTLLRQWQEAARRAEAVTAVVDENDVHGVQQAMVELARQL
                     AEQAGPCKEFDKAVEQYRREQAAQADPMLVEGEASVSSRMVTQAALGAASLIPGAGVV
                     TAMANPDAAAQGLDRIRAASRTRAQRRGGQGDETGMSRAFVCELERLCRRQRWVVLFF
                     DTWEQTAQYLDGWLLRLLDEEFGPVPANVIVVLAGRDELSEREWAPLRDQVADVPLEV
                     FTEAETRSLLTSRGVTDVGVVEAVLQLSMGLPLLVELLALARPRTSEDVDAGGNLADV
                     AVERFVQWITDPEKREAVRACALPLQLNEDVFTEAAGPGAEGLWEWLRGQPFISGRGD
                     YKHYHAVVRASMIRQQRTHSPQGWTSAHLRLAETHATWRAAVEARLPEAKRWDDAEWR
                     RHRLDETYHRLCAHPGTYLTDALEQVVQAAGQETAVLRQWIETLEQAAQDTADTTLFA
                     WTGRLRDTLTGDDPRLTCLEVLLSHSQLSSESRSWAHTHRGILLYRSDQDEEALTEFD
                     RAIAHNARNALAWARRGEEHRLLGNEDQAVADLTAALELEPTNAWALGSRGETHQQAG
                     RNQEAVADLTAALELDPTLTWALGARGDTHRQAGRYDEAVTDYTAALELDPTLTWALG
                     ARGETHRQAGRYDEAVTDYTAALELDPTYATALGARGQAHQQAGRHEQAVTDLTAALE
                     LDPTYAAALGARGDTHRLAGRYDEAVTDLTAALELDPTYAAALGARGDTHRQAGRYDE
                     AVTDYTAALELDPTYATALGARGETHRQAGRYDEAVTDLTATLELDPTYAAALGSRGD
                     AHKQASRYDEAVTDYTAALELDPTYATALGSRGDAHRQAGRYDEAVTDLTAALELDPT
                     NAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQAGRYEQAVAD
                     YTAALELDPTNAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQ
                     AGRYEQAVADYTAALELDPTDDWALAQRGETHRQAGRYEQAITDYTAALELDPTDAWA
                     LGSRGQAHQQAGRYEQAVTDLTAALELDPTLDWALASRSQAHRQAGHREEARMDVEQA
                     TEAHPDDLECAFEKLMLETVEGRFEAFREQWRQLLTSPVNPQDETKASYLRLFRTVLI
                     EPEAGVPEATTGVLATHPSEGDIADAVRYLAELSVLEGEVGERARQCHDLIMRRPSS"
     gene            127422..127601
                     /locus_tag="SFLA_RS33465"
                     /old_locus_tag="Sfla_6767"
                     /db_xref="GeneID:11372422"
     CDS             127422..127601
                     /locus_tag="SFLA_RS33465"
                     /old_locus_tag="Sfla_6767"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014043491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140614.1"
                     /db_xref="GI:503906620"
                     /db_xref="GeneID:11372422"
                     /translation="MPTSDRPLLLLLLVLVVGLVLGALAYLSYEHPALTEPLTLVLAG
                     AAVLVPCIALTVTRR"
     gene            128520..129395
                     /locus_tag="SFLA_RS33470"
                     /old_locus_tag="Sfla_6769"
                     /db_xref="GeneID:11372423"
     CDS             128520..129395
                     /locus_tag="SFLA_RS33470"
                     /old_locus_tag="Sfla_6769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014158486.1"
                     /db_xref="GI:503924492"
                     /db_xref="GeneID:11372423"
                     /translation="MSGVGGGYPSDLTDEQWALVEPLLPPARVGPKGGRREKHPRRRI
                     VDAIFYVVRTGCAWRQLPKDFAPWPTVYWYFTWWHDDGTVERIHDALRGKVREADGRN
                     AEPSAGLIDSQSVRTADTVPVASRGFDAGKKVKGRKRFIVTDTLGLLLAVHVVAAGVQ
                     DRDGARRPLLWTRLDHPGVKKIWADQRFAGRLVDWVTQILGRELEIVRKDPDQRGFQV
                     QPKRWAVERTFSWLTAHRRLARDYEASPARSETMIRWAMIGIMVRRLTRTGPATRPGP
                     RPLTRVSAAGHATGW"
     gene            complement(129405..129806)
                     /locus_tag="SFLA_RS33475"
                     /old_locus_tag="Sfla_6770"
                     /db_xref="GeneID:11372424"
     CDS             complement(129405..129806)
                     /locus_tag="SFLA_RS33475"
                     /old_locus_tag="Sfla_6770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014158487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158487.1"
                     /db_xref="GI:503924493"
                     /db_xref="GeneID:11372424"
                     /translation="MVSDARVPFVGDFRELEQGSPDGPSLRSAVKAEASVSARELVKY
                     LRSGALLAATTTLVRDVLATDNPVIGGLHLLTDGHWLWYSDLAHYVEHYHAALDPQFI
                     AHAQANGWTVPQLDDADLLALEAVLLGDDTN"
CONTIG      join(CP002477.1:1..130055)
//
DBGET integrated database retrieval system