GenomeNet

Database: RefSeq
Entry: NC_016115
LinkDB: NC_016115
Original site: NC_016115 
LOCUS       NC_016115             130055 bp    DNA     linear   CON 19-MAY-2017
DEFINITION  Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete
            sequence.
ACCESSION   NC_016115 NZ_ACZH01000000 NZ_ACZH01000001-NZ_ACZH01000154
VERSION     NC_016115.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00191232
            Assembly: GCF_000176115.2
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Streptomyces.
REFERENCE   1  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid2 of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002477.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 03:15:08
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 6,863
            CDS (total)                       :: 6,774
            Genes (coding)                    :: 6,537
            CDS (coding)                      :: 6,537
            Genes (RNA)                       :: 89
            rRNAs                             :: 6, 6, 6 (5S, 16S, 23S)
            complete rRNAs                    :: 6, 6, 6 (5S, 16S, 23S)
            tRNAs                             :: 68
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 237
            Pseudo Genes (ambiguous residues) :: 0 of 237
            Pseudo Genes (frameshifted)       :: 127 of 237
            Pseudo Genes (incomplete)         :: 153 of 237
            Pseudo Genes (internal stop)      :: 28 of 237
            Pseudo Genes (multiple problems)  :: 63 of 237
            CRISPR Arrays                     :: 4
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..130055
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /plasmid="pSFLA02"
                     /collected_by="Waksman and Lechevalier"
     gene            552..992
                     /locus_tag="SFLA_RS32905"
                     /old_locus_tag="Sfla_6645"
     CDS             552..992
                     /locus_tag="SFLA_RS32905"
                     /old_locus_tag="Sfla_6645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014669304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799156.1"
                     /translation="MAERGEAGVRVQVQDTSGQPLGVTAEVVDWRIGPHPQVPSEGDR
                     VHFRYRFDDADERSGPVVDACAVDKERMVLVCQTISPSEARPEAGGDLTGDSWLDVEH
                     PEHVAEVLLIPNDQSHAGGATCETDIKDGGGTHPPESPGVGDQL"
     gene            1074..1361
                     /locus_tag="SFLA_RS34875"
                     /old_locus_tag="Sfla_6646"
     CDS             1074..1361
                     /locus_tag="SFLA_RS34875"
                     /old_locus_tag="Sfla_6646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158386.1"
                     /translation="MIVSCASFTWCAGAGRSTVARWYAPRHEQPPERRHPERVVTIDR
                     VDYYDQAEVEAFWAAHQETVGTALLGVSGRRSGAGHGEKPRGGRPVSAERA"
     gene            complement(1843..2070)
                     /locus_tag="SFLA_RS34880"
     CDS             complement(1843..2070)
                     /locus_tag="SFLA_RS34880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559922.1"
                     /translation="MTPGLPTLDIEVGEVRAGLIDGGKPGAAALAPISGPSRCSAPGF
                     GAAPPGAPHLARRAWARRVWARRAQQLSRYA"
     gene            complement(2306..2503)
                     /locus_tag="SFLA_RS32910"
     CDS             complement(2306..2503)
                     /locus_tag="SFLA_RS32910"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826034.1"
                     /translation="MRWEGKGRAVSLIGVTAVCPPRTLAALIVLAFTTVNSAQGPAGI
                     QGTEGSHPRARKQTLVLQHRR"
     gene            complement(<2939..3304)
                     /locus_tag="SFLA_RS32915"
                     /pseudo
     CDS             complement(<2939..3304)
                     /locus_tag="SFLA_RS32915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010645375.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding protein"
     gene            <3516..4294
                     /locus_tag="SFLA_RS34885"
                     /old_locus_tag="Sfla_6648"
                     /pseudo
     CDS             <3516..4294
                     /locus_tag="SFLA_RS34885"
                     /old_locus_tag="Sfla_6648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014668654.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
     gene            4450..6318
                     /locus_tag="SFLA_RS32930"
                     /old_locus_tag="Sfla_6649"
     CDS             4450..6318
                     /locus_tag="SFLA_RS32930"
                     /old_locus_tag="Sfla_6649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2813 domain-containing protein"
                     /protein_id="WP_014158387.1"
                     /translation="MHLNSFNVSGFRSLTEVSDIPVRKPTILAGHNDGGKSALLDALA
                     FLLGKHALAEDDRTYLTIDGDEVSAPLRCEESIVEGVFTLDAWEQEQFDLPERIRLRR
                     CCGEDLISRLEVWQPIPADERLRDLSQHLVPALKELVKEFGLSPGSMRKPDLEQALRR
                     YGRDHAGSDGWVAAPTALDKRMPRYLPFDGKVAKPDEAVKTVLVGRFQSYMADPDLKG
                     RLSAIEDEVQDRLRIDAKSLCEHIEMRCPDLQKVSVDPDVSFQQGFKAAPLRVARRAG
                     EVVGLDRTGLGSNRRISLAIWEWTSELLAEEQGTAPAMSTCDEAPEPPPVQTIVVYDE
                     PDTHLDYIHQRKIMQLIRTQSKIPNVSVLVATHSMNLIDGVDISDVVHLKLEDHRTVV
                     ERLGTGLLHDAIDEHLGKIAATVGLRNSVLLHERCFLAVEGETEQRAFPLLFRLCEGL
                     SLQAAGIALWACFNNEGALHLARYLVKQGRTIMLVVDADSRNVSKGIFKTPKLTQFFG
                     TESRRYVTFLGEPDDAQQEKYNELEELFEDDVWARIANKVWARAGTPWQPADFTALRG
                     QGKFSGAVQEMLQEQSESGPGGKPDMMYELSMALDDPDDVPEQLRRVFERLRELAS"
     gene            complement(6299..7078)
                     /locus_tag="SFLA_RS34890"
                     /old_locus_tag="Sfla_6650"
     CDS             complement(6299..7078)
                     /locus_tag="SFLA_RS34890"
                     /old_locus_tag="Sfla_6650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158388.1"
                     /translation="MATVDGPEPYGRPENSTPFATAPSRSHTSPPQARRNHIMYGCWK
                     AETPPSGPTHDLPPGHRVRRHHRAGLRTGDRRVCLGDRYFTLFSSPNSRRRAVVPNAG
                     APRSGPAAPRRDRAACSSRSLPCPDRPAHMGRCLERLLQTCRRVDGPRLLAGCHVDAV
                     GGWGGGVMSVVAGRMWSGEGVAMSTEGSDLRIPAPSGCRWCGIDEREHMQRWKPPAGW
                     HEWAPPTLEQRKERMQARRRQRPSGAGGGQATQGRLRTLAP"
     gene            complement(7173..7436)
                     /locus_tag="SFLA_RS32935"
                     /old_locus_tag="Sfla_6651"
     CDS             complement(7173..7436)
                     /locus_tag="SFLA_RS32935"
                     /old_locus_tag="Sfla_6651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158389.1"
                     /translation="MGDMTIPFLPPLSALGAIQRVLLVTLLTPAVLLALTAAVPALIV
                     LPFLPGGTDRAIALLTAHTAYLTALLTGSRTLPPNTARRPRGS"
     gene            complement(7475..9160)
                     /locus_tag="SFLA_RS32940"
                     /old_locus_tag="Sfla_6652"
     CDS             complement(7475..9160)
                     /locus_tag="SFLA_RS32940"
                     /old_locus_tag="Sfla_6652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158390.1"
                     /translation="MPTYVETNVWLPACALAAVKAIAVRGGLSRDETVRQLLDEHLEA
                     QEHREPDMRLTHISTVLRYPPALGRQKHRWVPEFGGPLRLRLHPGVADRARTVSLRLP
                     GQFQRAHRDYQSRQLTDAVMTAIAVHEPFTDTYLDGLQPVLRHRAARGLWGLAVAATS
                     TAPELAVHEAVSRAEFPDKDESATGASAGGPGASSRPQQTGASSRLLRVAAALEGETG
                     WHSAVRFWVAANIARLLLTGPGRDAAERMLFEQGEQWRELRLDYRYANAATREELRRG
                     IGDWDDSGRGGGAVWRAERAVEVEDFEVWLVARGRAAERMNLPPGWLVRTPPTWRVSA
                     VGGHGAALREPYAGWVVAGRLLVFTSGGTPGVWPLTRGNGGRMRPVEGIEPVVAAAAG
                     LAPAQASTFIEAMLLDWSDDGEADLMRVPAVLRLPASQAYNFGYIDAAQRSSLMAQAR
                     VATLESMNHVLNHLHDDFYRARLEAARDSGSVRDFRRLARWARVHFSPSPATWPWPGG
                     PVAHEVVAGTRPEIVHWLATHAHRTTATLLQHSMGEAWNAAFDHRPPSFWTDM"
     gene            9409..9579
                     /locus_tag="SFLA_RS34895"
                     /old_locus_tag="Sfla_6653"
     CDS             9409..9579
                     /locus_tag="SFLA_RS34895"
                     /old_locus_tag="Sfla_6653"
                     /inference="COORDINATES: protein motif:HMM:PF14355.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559924.1"
                     /translation="MSNLITGIAEMRNKVGSGHGTPTAPKGIQESHVLLVIDSAHTIT
                     RFVTSRLNELFA"
     gene            9701..10624
                     /locus_tag="SFLA_RS32945"
                     /old_locus_tag="Sfla_6654"
     CDS             9701..10624
                     /locus_tag="SFLA_RS32945"
                     /old_locus_tag="Sfla_6654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158391.1"
                     /translation="MATDLISGTTRAHMREISAQLGPSRLRPCWDGSGFTPGPAKDTS
                     GGGGKNLFSSYVDHIGWSDPGQVSRALGVFESMLRVYRTVVESSYGTEDETPQQRWAA
                     KLEEARREFEYDGYQITDRLRIFGSGEGRPDHEMADAQLYAEALSLLRHARNQMERLP
                     STTRGKSEPEIRDVLLVALGAAFAGRCTAESLNGKGKTDLLLRIGDRNVLVGECKIWG
                     GSTDFREEDIPQLLGYLTRYDRHAVIPLFIRKARPEEIVAKAVKELAEHPRCVSAAVP
                     DHEGRQYTFVFRSLSATPWDVEVALIPFVIE"
     gene            10641..10829
                     /locus_tag="SFLA_RS34900"
                     /old_locus_tag="Sfla_6655"
     CDS             10641..10829
                     /locus_tag="SFLA_RS34900"
                     /old_locus_tag="Sfla_6655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158392.1"
                     /translation="MPTRGAHSTIGRGWELSNDAVTRPEHLRDVSPQVSVQTDVSAFA
                     NEVDDLEFVWGPRIRLNW"
     gene            complement(10969..12177)
                     /locus_tag="SFLA_RS32950"
                     /old_locus_tag="Sfla_6656"
     CDS             complement(10969..12177)
                     /locus_tag="SFLA_RS32950"
                     /old_locus_tag="Sfla_6656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158393.1"
                     /translation="MQDSAVVGTRRSRIADFLRQLDPDVRMALHFDDAAVIGADLLIS
                     MCRALLDTGSDQPWQDRLESTLEEFDLSDVETGLDSILEKFQNTDMAISWLTSFKGVN
                     YNAFALRLLGARDFKRLVDVVKEDGAIVALAVRRALRGAMPFAVAWSDAISNMTENQR
                     KAVSKADILGLDLVQIVIMVDEAFGTKFISTLPMELTTATTDDLVGWRPDDMTEIVST
                     IRHRVAESSAKRLERENSQLVRKIRGAKDALAHSEDGISQAANSLIELIDRILRNAFT
                     KEQVMAWVVANLPNEPGLTYPDERGVDQPNKRAEILCFVYRGGPTAREAHEYDNGQGP
                     SLIHDVLARVIVATRTSLQGFKHGDAGTQEEKEQLLSLLAGLEGALLLGLSISQIGIK
                     EGELPNNLEA"
     gene            complement(12328..12577)
                     /locus_tag="SFLA_RS32955"
                     /old_locus_tag="Sfla_6657"
                     /pseudo
     CDS             complement(12328..12577)
                     /locus_tag="SFLA_RS32955"
                     /old_locus_tag="Sfla_6657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007456545.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(12671..13513)
                     /locus_tag="SFLA_RS32960"
                     /old_locus_tag="Sfla_6658"
     CDS             complement(12671..13513)
                     /locus_tag="SFLA_RS32960"
                     /old_locus_tag="Sfla_6658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015031871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
                     /protein_id="WP_086010477.1"
                     /translation="MMTERRRYPSDLSDARWELVEPVLTAWRAERRGRGLDIGRPPNH
                     DLRSLLDAVLYVNRTGIPWRYLPHDYPHWNTVYAYFARWQEEGVFDQLNSLLRRQVRR
                     QEGRDDEPTACVIDSQSIKTSTNVPATGQGIDAGKKIVGRKRSIVIDTVGLLLGVLVT
                     AASVQDSTAGRTLIERIAAEHPTIRKTWVDGGYRQHLVEHAATLGIDMHIVRRDTATR
                     GFTVLPRRWTVERTLGWLMNHRRLARDYEAHPHRSEAMIHVAMINLMTRRLSAESTPT
                     WRGA"
     gene            13793..14646
                     /locus_tag="SFLA_RS32965"
                     /pseudo
     CDS             13793..14646
                     /locus_tag="SFLA_RS32965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019065501.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            complement(14669..15073)
                     /locus_tag="SFLA_RS32970"
                     /old_locus_tag="Sfla_6660"
     CDS             complement(14669..15073)
                     /locus_tag="SFLA_RS32970"
                     /old_locus_tag="Sfla_6660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158395.1"
                     /translation="MISDNFPIGGSFRELEYGSPDGPSIRTAVRLAAPKHEGDLVQYL
                     HAGSTLVATPSAAPDVLSESGAIIGGLHLLTDGHWLWYSDLAHYVRRYHVELDPAFIE
                     HARGNNWSAPQISDERLEAMVTLLIGDEKEPD"
     gene            complement(<15141..15524)
                     /locus_tag="SFLA_RS32975"
                     /pseudo
     CDS             complement(<15141..15524)
                     /locus_tag="SFLA_RS32975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018796608.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
     gene            complement(15752..15955)
                     /locus_tag="SFLA_RS32980"
     CDS             complement(15752..15955)
                     /locus_tag="SFLA_RS32980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020126393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826082.1"
                     /translation="MSLVVVLLTVAVVVFTAVLAATGAAVLARIDSATWPAALARAAT
                     TFAATLALAATVTGALSPFFLTR"
     gene            16299..18530
                     /locus_tag="SFLA_RS32985"
     CDS             16299..18530
                     /locus_tag="SFLA_RS32985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019074642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_086010478.1"
                     /translation="MRDLLRTAEGGPTREEDTPGQPIARWDPHDLEVHPAGTSVTGSG
                     RRALPGYVRRRHDEDLAAAVRDAAAGNSRIQVLVGSSSTGKTRACWEAVQPLAERGWW
                     LWHPFDPTRADEAHKQLAHVGPRTVIWLNEAQHYLGDRQHGEHIAAALHTILTTPERG
                     PVLVLGTLWPKYAHDYTAPPKPGVDDPYSRVRELLAGRMVSIPDQFGTAELAAAQDLA
                     DQGDALLVDALTRARDSGRITQDLAGAPELLRRYEQPHHAAARALLEAAMDARRLGVD
                     LHIPQAFLTDAALDYLSDDDYDQLGNNNWAEQAYAELAEPVHGKQAPLRRTTPRPSRR
                     PPAPATEARTATPLPAGPVFRLADYLEQHGRTTRRHLCPPASFWNAAHTHLTHPDDLG
                     NLTEAAQTRHRLQWAHHLRQRAADHGDTRALVHLVRMREEAGDQDGAETLARQAATHG
                     DTRALVHLAMMREKAGDQDGAETLARQAATHGDTRALVELAMMRYQDGAETLYRQAIT
                     HGDTRAMVHLAMMRREAGDQDGAETLYRQAAALGNPFALPNLVEMREKGRDLDNTKTS
                     DREAADPDDTDALVHLAMMREEAGDQNGAETLARQAATHGDSSALFILAMMRRRAGDQ
                     DGAETLARQAADQGDTGALVHLAKVRKKNEDRDGAETLYCEAADHGDTGALVELALMR
                     EEAGDRDGAETLYRQAADRGNIDALSSSGAIKFWPYGLDPDGTPTPRWQQSGPCTPEA
                     AAK"
     gene            18764..20188
                     /locus_tag="SFLA_RS33670"
                     /old_locus_tag="Sfla_6663"
     CDS             18764..20188
                     /locus_tag="SFLA_RS33670"
                     /old_locus_tag="Sfla_6663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Competence CoiA family protein"
                     /protein_id="WP_014158396.1"
                     /translation="MPFTALHAGLGRLDATLPDLGHQLDWAQVYKARPRPPLVCPQCE
                     WGLHAKVSRYGVRFFCHDPGRPPSCELSNESWEHHMLKLELAGAIREAGWFAELEVPA
                     ADGSWRADVMASSVDGTQRMAWEAQLSAITDEDIEYRTERYRAEGIRVCWVSPHKKPP
                     QWISVVPAVRVRSPEGRGQSWVVDDGLAGFDFTAGGWAFREEQLQRFVRWVLGGQVVS
                     VESYPRYRRVPRVVDGKRLRFRRGRWWTSLQSADAQTRHESMRRRQEAAKEEREARQR
                     KREEAAERRRKELEEKERIQRAQEAERRAKKAAEESRIRMEVWEREWAEEKARREREK
                     AEKAQRLAREEAEREERERQALEAATVWWGRLSTQQKEELLAAVTERAWREEKLWVTV
                     PENPLMDPAYAYGVPLYTQGKRRRSLYGIVRPCPELLAASPRAREEHALVRNTQEATE
                     LQEAGCEGRITHFDLPEHEQLSMY"
     gene            complement(20195..21016)
                     /locus_tag="SFLA_RS32995"
                     /old_locus_tag="Sfla_6664"
     CDS             complement(20195..21016)
                     /locus_tag="SFLA_RS32995"
                     /old_locus_tag="Sfla_6664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158397.1"
                     /translation="MPKKKRRPRHPAHLAHTPTTRRVSEPDQEREYVDEFQPLLDRYP
                     TVQDAVQAAEAGESVEWTGSIGGLPMRHRVVLAPEQLMVEQAILAGWPLDYMIRCAWF
                     QCDAHVDTEKAVLKTLDELHELTRPLLEEQVRAVRPDYEAVVLSAFAEPSDRGVPIFG
                     WRARYPVIEGLTWQSTRDTAAWNLSGCFDAIDPIVDIPELGRPAIAARLSCNGAPLMV
                     CKGCDLPLTDRHPRWTRVWVGPDGPRCEEPAVSDDGAQAGWDEEDFGYPHRPRPA"
     gene            complement(21181..22005)
                     /locus_tag="SFLA_RS34905"
                     /old_locus_tag="Sfla_6665"
     CDS             complement(21181..22005)
                     /locus_tag="SFLA_RS34905"
                     /old_locus_tag="Sfla_6665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014158398.1"
                     /translation="MPDRRGRPMAPIGDPNHGVGRLARALRDGRSRRGLSRRQLAVEI
                     DRSVTTIQRAEAGDVRPTLLVSQQIADACGIDHDEIEALWRKAARLGRGHRVTDAPRL
                     KLVRTSADLAAALRRVWEENGEPSSRHMEERAEARAREFAPLSRMSAWRIRERKQPVT
                     SVRQLYAYLIACEVPEGTFPAWAKAWQRAKRDDRWTPKIVPAPHPSHPRRRVTPSEAV
                     DFMIRSGLRPIDPYPGHAAPWTAQCMACSSISRVRYSKVKTGAGGCRVCRRNQMAA"
     gene            complement(22019..22276)
                     /locus_tag="SFLA_RS33000"
                     /old_locus_tag="Sfla_6666"
     CDS             complement(22019..22276)
                     /locus_tag="SFLA_RS33000"
                     /old_locus_tag="Sfla_6666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158399.1"
                     /translation="MSSPQSVSACVTGTRRRLGLGESAVIIVIIVMTALLITRGTPLT
                     EAATILGSSGLLAVLVTRYAQAGPRTAVMRRVGALLFPAQA"
     gene            complement(23389..24204)
                     /locus_tag="SFLA_RS33005"
                     /old_locus_tag="Sfla_6667"
     CDS             complement(23389..24204)
                     /locus_tag="SFLA_RS33005"
                     /old_locus_tag="Sfla_6667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158400.1"
                     /translation="MLCMGEALSLADIMENNPVDQVGEHLLAAAATLLYQQGDTEAAI
                     TATDVLAVDMSLWNSDEYEPDEYRMYFTVEPQLVDQFTDQVVARIVDGIHAVMPRRGC
                     AVRIESIEVCPVVPVPSMDWRKQLRTANGPTPTNQARKVRLEPRDQHPIQDDLHFTNE
                     WEHGLYQVLKARQATLPDNETIGIMPLGKMRLLGSTREPDFLITYKGRAGVIEVDGPH
                     HGKPGRASSDHSRDNLMIHAGVEWVSRLDVQDVGTKAEVEKFVDNFLARLVRQ"
     gene            24465..25289
                     /locus_tag="SFLA_RS33010"
                     /old_locus_tag="Sfla_6668"
     CDS             24465..25289
                     /locus_tag="SFLA_RS33010"
                     /old_locus_tag="Sfla_6668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein PINc"
                     /protein_id="WP_014158401.1"
                     /translation="MMVTPIPGARLELVLQLLREAHTKAQNLGNFTSAEECLLNYLTW
                     TTEQARLLGSHVRAKDVEVLFFTPVYWALLNGAGHMEGRLVPKVSIGLVNQEVRQRTE
                     DLDLAVSSIRDAVRRWRGDVSTLVLDTSFFIEHEDKLEDADLFTLADFEGLVRVAVPM
                     TVVDEMDRLKEARVSGHARWRARYGLAVLDRLLTGPAKLGSVEVEVLPDPSGHVRLPD
                     EDDEIVDRALALGTMAAGPVTLVTYDTGMALRAKIAGVPCLKLPKELGPEPERPKD"
     gene            25932..26180
                     /locus_tag="SFLA_RS33015"
     CDS             25932..26180
                     /locus_tag="SFLA_RS33015"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826046.1"
                     /translation="MNREFTVVLNILLTGKMDQQIVEVDGNNGESGFVLMDPEDANNP
                     AKVQEVRDFMIQWRTDRERMDAELDGIARASSMHTDTD"
     gene            complement(26337..27185)
                     /locus_tag="SFLA_RS33020"
                     /old_locus_tag="Sfla_6670"
     CDS             complement(26337..27185)
                     /locus_tag="SFLA_RS33020"
                     /old_locus_tag="Sfla_6670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158402.1"
                     /translation="MARVPENVDAQQLHVAARRVLLDGLTALSDQLDALTVVGAQAVY
                     LRTPEAALRTSFTSDGDISIDPDRLQNVPLLDQALLEAGFELLRDNQPGLWARTQRIG
                     GQEVPIEFDLLMAKGLAPKIGSRSVKIPPHGVMSARWVPGLEVAAVDRSPMTITSLEA
                     ADARTIIVNVAGPAALLVAKAFKINDRLKQADARPERLTHKDAGDVLRIIRAIPVAQV
                     TASFAKLREDPRVGEITQEGLQLLQDLFGGPTTPGVGMAVQALSGDLPEATVRALAPA
                     YVSRLM"
     gene            complement(27230..28381)
                     /locus_tag="SFLA_RS33025"
                     /old_locus_tag="Sfla_6671"
     CDS             complement(27230..28381)
                     /locus_tag="SFLA_RS33025"
                     /old_locus_tag="Sfla_6671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158403.1"
                     /translation="MDSKSDEEVGSPGRLFDAALERLRGLFGEGWAVEAVPGFQQDPS
                     DWYSDRMIEIRSADMGHTARYVVDLKSSLTPRTVDTELLSKLRLVRQVNSFTSLLVMA
                     PWMSPKTQDLLRIHGISYVDLTGNIWIRADRPAIFIYTEGQSRAPRSASQPSSAVTLS
                     GSKVDRLVRILADVRPPYRASDLAAATKLSLAYVSRLLGTLEDQLLIQREGRTIHSVN
                     WQGLLRARAEHSNLLNLNPYSGFIAPNGVDYLLRQMRDDDFTSRRLFAITGSYAAREV
                     APLSVGGQLMIYIRPDHFSDELVDHLGLLEVKQQADVLFLDAHDPVVFKQSRIVGGLP
                     HVALSQLALDCLSGPGRLPAEGEAVLERMSAHEQWRNLDIHTIKEWWAA"
     gene            complement(28769..29737)
                     /locus_tag="SFLA_RS33030"
                     /old_locus_tag="Sfla_6672"
     CDS             complement(28769..29737)
                     /locus_tag="SFLA_RS33030"
                     /old_locus_tag="Sfla_6672"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_014158404.1"
                     /translation="MTVPQEASPSDADNVERHPCPRCTAEPGSPCRSRSGAVAGTYHT
                     GRFTKVPRLAKLLRVPTPADRGPGQPWRPGTPVPLALAPDTPTADIRIGYARCSTLTQ
                     ELQSQLDALAKHGIDRDKVFSEKISTRVRVRPQFEAALTLARQIKAHAPHCRVIFTVY
                     EMKRLGRDAAELTALADHLTAHGLVLEMLAGPLPGMYDPSGPGRLLFAFFAAMAETER
                     ENIRESTLEGLDAAARKGKHGGRPPVITDDMLHTVLRRRTNGESVEQIQPDLIIPTGK
                     RKGQAPSVASIYRALAEHEKQQAYPEAVEQAHADFVNLQPRDRGPA"
     gene            29961..31043
                     /locus_tag="SFLA_RS33035"
                     /old_locus_tag="Sfla_6673"
     CDS             29961..31043
                     /locus_tag="SFLA_RS33035"
                     /old_locus_tag="Sfla_6673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010072986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158405.1"
                     /translation="MLDRDLLRASRLAGYGIVSTQLSLLSDHRLGEVVAAATPLGSGI
                     GGRSAELDVNGTRVFVKRIPLTDIELRPENVRSTANIFELPMFYQYGVGSAGFGAWRE
                     LAVHTMTTNWVLGDEYAGFPLMYHWRVLPDSPPEGFTDEFGGLEGAVAHWEGSPAVRD
                     RLEAIGQSSCSLVVFLEHVPHTLAGWLADHRKPAVSEGGDGSPFRWVEKALMDGADFM
                     SSRGLVHFDAHFANILTDGRQLYFADFGLALSSRFDLSSGESSFLSDHLAYDRCYTAS
                     HLLQYHLLDGVRGDTERKAFLHDWIAGRRPGDVPPAITAIIDRHARPTVVVDSFFHRL
                     FTESKQTPFPATEIEQQLRTGTTTPS"
     gene            complement(31244..31687)
                     /locus_tag="SFLA_RS33040"
     CDS             complement(31244..31687)
                     /locus_tag="SFLA_RS33040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014173837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_078559925.1"
                     /translation="MISAAVRFHVTDNYLADVEMRREIHEGLQVVENWNSANKDLFYG
                     KDGDLAGADKESQEVSMLALHLLQSALVHVNTLLMQEVLADPKWADKLTDADRRALSP
                     LFWTHVNPYGRFELDMNSRLDLDLSIRATVPGPRAPQGEAAGAEA"
     gene            31723..32796
                     /locus_tag="SFLA_RS33045"
                     /old_locus_tag="Sfla_6675"
     CDS             31723..32796
                     /locus_tag="SFLA_RS33045"
                     /old_locus_tag="Sfla_6675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014140676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_014140676.1"
                     /translation="MGTVLLDEKWPVLGRHEQAAGWLQVWSDLGRAPRTIDAYARGLA
                     EYLEMCERENVDPLTANRAHIAVYVRELTSRPSRRGANVVSIDSGSGLANATIQQRLV
                     PVRLFYDFLMEDGQRDSNPVGRGRYTPGRRHRGGHERGLVPRLTKMPWIPAEQQWLDI
                     LAVAAAEPVRNRVMLALAYDAALRREELCSLRTDDLDPAHRTLRVRAETTKNRLERVV
                     PYSAPTGVLLSGYLAHRATVSRARGPLFLSESRRNHAQPLSLWTWSKVVRRIALAADV
                     PRFSTHTTRHLCLTDLARMGWELHAIATFAGHRHTDSTLTYIHLSGRDLADKLSRGME
                     QIHGWRVQMLARLGEQATGTVAL"
     gene            33222..35156
                     /locus_tag="SFLA_RS33050"
     CDS             33222..35156
                     /locus_tag="SFLA_RS33050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005484840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_049799142.1"
                     /translation="MAAFAYLLGDFTDFHRIGGFIRRSLAWRVFGQEPVEETIAQVAA
                     TLQGWGYHPSNGAFGQFRTVLVQIMLINRSPLLQDMTTDALQRARESPALPSGARRGN
                     LHGVHRAIAALGHAGPPPKPIHAVMPDLEGVPEPWAAMVERWHDTSTLTPKVRGGFRS
                     IVAKAGRWLAAEHPEIVEPGQWTRETCAAWVAALDRMTVGEHVQRRAGLDKRGGKPLS
                     PRTKAGYLTATRTFFRDCQEWEWIPRRFDPVRALATPRSVAALIGPNPRVIADDIWAK
                     LLWAGLNVDPEDFPTNTYGLCYPIELIRAVTLTWLFGGLRSDEISRLRTGCIRWQHDG
                     FPIPGDSDEVLARDAVCLLDVPTHKTGTSFTKPIDPLLGKAIEAWQDARPQQPKMLDR
                     KTGEQVDFLFAHRAKRLANTYINTAVIPSLCRKAGVPTADVRGNITSHRARSTIASQL
                     YNAKEPMTLFELQAWLGHRSPESTQHYAKITPNTLARAYNDAGYFERNVRTIEVLVDR
                     DAVTSGAAASGEPWQYYDLGHGFCTYTFFEQCPHRMACARCDFYTPKATSKGQLLEAK
                     DNLQRMLASVPLSDEERAAVDDGQAALDQLLERLVDVPTPAGATPREIGAPATATLLP
                     IVAVNQGASAECRPAMRAPR"
     gene            complement(35137..35859)
                     /locus_tag="SFLA_RS33055"
                     /old_locus_tag="Sfla_6677"
     CDS             complement(35137..35859)
                     /locus_tag="SFLA_RS33055"
                     /old_locus_tag="Sfla_6677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014140678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_014140678.1"
                     /translation="MSIDPLLARARGLWEELASVPVSFASTGGVRVVVSPESRMCPSG
                     WVGVVVLGNSAIVTAPSQDTAKTVRDALAKLPVGALAGAHSVRGVLPVARVLGPAALA
                     YVSDNGFRPVADRRLTVQLVPGEHPDLRELENLAGADDSDEAGLNEITSPAFVIRERG
                     QIVAAAGYRSWPSRTAHVSVLTAPAWQGRGLARATGSGAVAHALTAGLLPQWRARVPA
                     SRRVALALGFRELGAQLSVELA"
     gene            complement(35894..38650)
                     /locus_tag="SFLA_RS33060"
     CDS             complement(35894..38650)
                     /locus_tag="SFLA_RS33060"
                     /inference="COORDINATES: protein motif:HMM:PF13700.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010047492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE transposase"
                     /protein_id="WP_078559926.1"
                     /translation="MRQEWEPEDLIEVWTLLEDEVVRLRNKTGANRLGFALLLKFFEV
                     EARFPESAGEVPAPAVAYVAQQVRVPAEQWAAYDWQGRAITRHRTEIRTAFGFRAGTE
                     EDQERLAEWLAAELCPVELSRERLMAAVVARCRNDHVEPPAPAKVQRLVGRAVTDFEA
                     RFCRSRVDRISHATRSRLEDLVAGSEDETAGEGGGEGAVSGGGRSHFAELKADPGAPG
                     LESLLAEVNKLQRVRRLELPADLFADVSEKLVDAWRARASKEYPANLERMKPPRRLTL
                     LAALCHVRQTEITDSLVDLFIQLVLKINTRAERKVDKELNAELKKIRGKDAMLLRVAE
                     AALSEPSGTVRRVIYPVVGGEKTLKALAAEAAANEARYKARVRTVLRSSYSAHWRRML
                     SPLLGALELKCNNTSYRPVMDAIDLLQRYLDQPLKEGAFFDPAESVPLAGVVPEHWRA
                     AVVDDQGRVERIPYELCVLGALRDAVRRREIWVVGANRWRNPEDDLPADFEDNRDVHY
                     AALGQPQDSREFIAALQGKLRTSLDRFESALAEGTTGGVAIVKKHGEPWIRVSPRGKQ
                     EEPESLVAVKGEIERRWGTIDLLDILKYAEFDTDFIAEFTSVATRENLSKDVLRRRLL
                     LVLFGLGTNMGIKRVAVTGKHGESEATLRRVRHLFINRANMRAALRKLVNATFAVRDE
                     MWWGTGTACASDSRKFGAWSSNLMTEWHQRYRGPGVMIYWHVERKSVCIYSQLKSCSA
                     SEVASMIEGVLRHCTDMEVDRQYTDTHGASIVGFAFAHMLDFKLMPRLKNIGAAKLYR
                     PAAGQDEKWPNLGPVLSTKTINWDLIAQQYDQIVKYTTALRLGTAEAEQVLRRFTRGG
                     PKHPTYQAIEELGRAVRTAFVCVLWNQVCQVPAARGETGSRGATGCLRGFGVFGGGLV
                     GFIP"
     gene            39341..39793
                     /locus_tag="SFLA_RS33065"
                     /old_locus_tag="Sfla_6678"
     CDS             39341..39793
                     /locus_tag="SFLA_RS33065"
                     /old_locus_tag="Sfla_6678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158406.1"
                     /translation="MDQEAMRSAVVGALSDVEAVKEKLTGLLAEIDGTASSVSIPRQG
                     LWTKEQVGLLWGRASHLTGVHALFQTTAEQAGTTVTFTSLIERSGLDERQQRNEHARL
                     SRLASELFGEKRWPIENWQGGYNTHSGKSEMLYRMDPQIAEWWLTLVD"
     gene            complement(39966..40754)
                     /locus_tag="SFLA_RS33070"
                     /old_locus_tag="Sfla_6679"
     CDS             complement(39966..40754)
                     /locus_tag="SFLA_RS33070"
                     /old_locus_tag="Sfla_6679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_014158407.1"
                     /translation="MAGYGALSDVYEWLIGDDKLTPAKAAAVYYSDVVGSLLPNARVL
                     DCACGTGQLAVGLASLGLDVVAADASSGMVRRTEKAADEQDVSLRALRASWDELPDHL
                     ADSTFDLVFCVGNSLGHAEGSVGRLTALEAMSRLLNPGGRLVLHSRNWELVRSAGSRV
                     DVRDRLIRRNDREAVVSYYWQIEQRWEQEHFLEIVVAQIEPDGAVQACSERLSIWPYR
                     YVDLVAQLRSVGLTVQSTTFDPESDEYLVVASRDQVRGKSEPTR"
     gene            complement(41258..41659)
                     /locus_tag="SFLA_RS33075"
                     /old_locus_tag="Sfla_6680"
     CDS             complement(41258..41659)
                     /locus_tag="SFLA_RS33075"
                     /old_locus_tag="Sfla_6680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_639793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158408.1"
                     /translation="MSSLITEDEISHEIELVWLEETTDLDYVRQSLDRLPTRRGKPPY
                     HRDGRMIGYALLGPKAKASRSSGTFRRRVFWLLPHDRDTQPEGLYATGAPAEAVDPRT
                     LAAGTKGYKTERSEGGPPSTAMQELGITLPL"
     gene            complement(41656..43185)
                     /locus_tag="SFLA_RS33080"
                     /old_locus_tag="Sfla_6681"
     CDS             complement(41656..43185)
                     /locus_tag="SFLA_RS33080"
                     /old_locus_tag="Sfla_6681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_014158409.1"
                     /translation="MTSPGNDNMLFHFDPQLVAAQIREQATLPLPAQALAPPATAAAG
                     EATQHGLLPDTLTDRGNAKLFVKLYANDYRHVPGMGWYRWDTTRWQIDEDDTVVWAAG
                     DLAESIASSDPRGLYTTQALQQHRRRALSTTGMNAMLTQAKSAPGMVLNAARLDADAY
                     ALCTPDGIVDLRTGLLKTPDPNKDFHSRSTSVGPRPSPTPRWNRFLTDTFGDDAEGTE
                     MIEFLQLLLGYSVTGDVGGQVLPFLFGSGKNGKSVLLDVLMKLLGDYADAAPPGFLMA
                     RPYEGHPTDLAELHGRRVIVCSEVKHGDKFDEARVKLLTGGDRIKARRMRQDFFSFQP
                     THKLWLLGNHRPEVGTGGFAFWRRMRLIPFTRVVSDDRKIDNLADILVTEEGPGILGW
                     LIDGARRYLAGDKDLTGPERVRIATTAYAETEDHTGRFFEECCTLGPELRAEQTGLYT
                     AYRTWCQEEGAPAMTSRAFAARARELAGLASPKEMILSNQRKYYPGIGLLPEQERQAT
                     T"
     gene            complement(43182..44294)
                     /locus_tag="SFLA_RS33085"
                     /old_locus_tag="Sfla_6682"
     CDS             complement(43182..44294)
                     /locus_tag="SFLA_RS33085"
                     /old_locus_tag="Sfla_6682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_014158410.1"
                     /translation="MPADLRIYPSDSRDEGLLPSVADVPLATAKWCARQGWPVHPLAP
                     GRKTPAANCETCRQPGHSRAGCVCPSEGRWCHSFHAATLDQRRIDRWWGQNPQFGIGV
                     ACGPAGLVVVDIDAHATKSPGRDRILPGIPISDQVNLAGLTNGFHTIAVLAALRDMPS
                     PADDASTLRVRTPSGGLHVWYRVGDSRSWQCSSGSSPGRALAWQVDVRANGGYIVAPG
                     TTTAAGTYTPLGSVRRPAVLPDWLAQELERTGHLPAFDVPAPRAVPPRAQQAVIAAGG
                     GRNHTHNILASVLAPVEACGQVAEGAGFSDILNRAAYTLGGLVAASRLSQQEAEDLLL
                     QTAAAARPGQNHRAEQIIRSGMAAGLKRPLYPGSVR"
     gene            <44849..45655
                     /locus_tag="SFLA_RS33090"
                     /old_locus_tag="Sfla_6683"
                     /pseudo
     CDS             <44849..45655
                     /locus_tag="SFLA_RS33090"
                     /old_locus_tag="Sfla_6683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010063365.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase"
     gene            complement(45801..46112)
                     /locus_tag="SFLA_RS33095"
     CDS             complement(45801..46112)
                     /locus_tag="SFLA_RS33095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158412.1"
                     /translation="MTRGQWGCVAAPVGGLATGVLGSVLLSAAWRACDVGVNGAANGL
                     ALIFYGALLTIISAVWWGALVGYVGRWNLAVALLGGTAGAAVMVWIFVALLHVPNGYR
                     C"
     gene            complement(46109..47272)
                     /locus_tag="SFLA_RS33675"
                     /old_locus_tag="Sfla_6685"
     CDS             complement(46109..47272)
                     /locus_tag="SFLA_RS33675"
                     /old_locus_tag="Sfla_6685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158413.1"
                     /translation="MLSYQEVMTTDLSVLTKAAEKWETVAADLAKVGKRYGETVQKIT
                     LGQNWHGLSVEAAHTKFATTRREYTSAQTEAKSVAKILRDAHTGFVDLKKKVESARDD
                     AVAAGMAVSTAGRAAFDFTRLQDPAQERALRHDPDLKGAEESWTSHIAAAVRAVAEFD
                     SAVKQALEAVVVDGNLLDGTVGGFNATATPVIPPTGQERSEQKFTDAEKWIFEEMKRN
                     AKSDTVGTIKALLDEPEWYEFGRNYGSDINAAMVMWGAKVAPGQDWDHKPQLQQRYDL
                     QTIDDYYFKQPGTNREVFYDIYSNVHYGYVGRAAGFDTDTLIQGASLGETVLTGDDDQ
                     GDQITMRVGVDLYEKYGDDLTEEQLRQGINDAMDQMERAQRNGEDVPQVRTRK"
     gene            complement(47284..47664)
                     /locus_tag="SFLA_RS33105"
                     /old_locus_tag="Sfla_6686"
     CDS             complement(47284..47664)
                     /locus_tag="SFLA_RS33105"
                     /old_locus_tag="Sfla_6686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158414.1"
                     /translation="MAWDESSGGGTPAGPLVPGGGGLFGSSPAEKNAAANDIETELEP
                     DTKKFSDGAKESTNTAARTLNGWETASGLKKVVGTWDQQVRVLMGRLAAEKASLRNTS
                     GLFFQNDLGTGSELRGVRSSLDEL"
     gene            complement(47847..48130)
                     /locus_tag="SFLA_RS34910"
                     /pseudo
     CDS             complement(47847..48130)
                     /locus_tag="SFLA_RS34910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020572972.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(48359..49129)
                     /locus_tag="SFLA_RS33110"
                     /old_locus_tag="Sfla_6687"
     CDS             complement(48359..49129)
                     /locus_tag="SFLA_RS33110"
                     /old_locus_tag="Sfla_6687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018523448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158415.1"
                     /translation="MRALLLIALAAAAWAAWHWSRFPGKWDHAFSTRYASDRASLVTG
                     RRSLREVNKEAARAENSARKRAGAEEAKYQQDIQELENEIAGLLRPGLGSHVKGPIGD
                     LTLYKHAVKKTGENPVDIPLAGLTATFRSDPTYMIDLTLPGSRTHRTKYPRRREPGDE
                     ATPFFTAEQLSDFTLEIMNAAADESNFRACRDARLPRARKELEAAQNNSAARDEALQT
                     LQDVCAWQKSNPRRIEALANLEEKRRQWQQLTGKMPPK"
     gene            complement(49580..50263)
                     /locus_tag="SFLA_RS33115"
                     /old_locus_tag="Sfla_6689"
     CDS             complement(49580..50263)
                     /locus_tag="SFLA_RS33115"
                     /old_locus_tag="Sfla_6689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158417.1"
                     /translation="MSLAIEQLLADAGQAAHEPRRAFDVAAGLRRLARDAGYTAAPPD
                     PFIPPLAHAHHQLVIVSRWCLTHSGAAVHIERLAAELGEETSSEVRAPLKDLDVDGAH
                     IFACMLYLADHPESALFWWQLAAGAGHGIAAYCLYLRHLGLGESREARHWLQQLQRPL
                     DGPDDEFMTGLDRFTLYIRRHGSPNLVSTGGIEVEIERLADTGNTGGLVCRPDQQLAD
                     RLHELAGQH"
     gene            complement(50260..50784)
                     /locus_tag="SFLA_RS33120"
                     /old_locus_tag="Sfla_6690"
     CDS             complement(50260..50784)
                     /locus_tag="SFLA_RS33120"
                     /old_locus_tag="Sfla_6690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_014158418.1"
                     /translation="MTEDVRADGSSPVADAVLPLPLEFEAHYVTHQEAYHRYALFYLG
                     SNDAAEEAVHRVFYEILRHWDALLAESNLQQQTWAIMRRVVISQSLMSFRKKITLMHS
                     NIGLFAALSKLPARQFDVIVLRYIERYDTKRISWYLGITHSTVDYHCRKAKERLSELL
                     KLDIEPKNTKGKAE"
     gene            complement(51730..51921)
                     /locus_tag="SFLA_RS33680"
     CDS             complement(51730..51921)
                     /locus_tag="SFLA_RS33680"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049799148.1"
                     /translation="MPAVLWSRAGMAVSSRMKWRGECPAGSAVTWAPSRMRPLGSCGI
                     RVWPGMLWSAIQSARAALM"
     gene            <52593..52733
                     /locus_tag="SFLA_RS34915"
                     /old_locus_tag="Sfla_6692"
                     /pseudo
     CDS             <52593..52733
                     /locus_tag="SFLA_RS34915"
                     /old_locus_tag="Sfla_6692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611378.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            complement(52750..53322)
                     /locus_tag="SFLA_RS33130"
                     /old_locus_tag="Sfla_6693"
     CDS             complement(52750..53322)
                     /locus_tag="SFLA_RS33130"
                     /old_locus_tag="Sfla_6693"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158419.1"
                     /translation="MGFMESRTAAGLRIVEEWTAPDRLVPPTVIGQAPSIPFEDGRVE
                     VLRDFLDPLLQQKANADWYRLAVEGGLFSETDRRFLIALSPGRDRLSRWHCVELQSEW
                     DIMSKGADGLLGSAPYRPEFSMLSLDGNVLCFATTWEYAISTSVLKAPHRSHVLRHWA
                     EGLTDGSMDDMGDPNDLPLSVAARRWLDHH"
     gene            complement(53762..56065)
                     /locus_tag="SFLA_RS34920"
                     /old_locus_tag="Sfla_6694"
     CDS             complement(53762..56065)
                     /locus_tag="SFLA_RS34920"
                     /old_locus_tag="Sfla_6694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_014158420.1"
                     /translation="MSSVAVHHILGPSWRISHPRSSSGHNHPFPDITDSSSVASVPLA
                     ATETSILSSHLMRGQELVCRRVAGVVLSWQEEKIPRMVGEYCIERRIGAGGMGVVFLA
                     VSPSGRQVAVKAIRGEFADDADYRARFRQEIEAARQVSGAFTASVVGADPDADPPWMA
                     TQYLNAPTLSDRVRKDGVLDENAVWQLGRGLAEALRDIHRVGLVHRDLKPSNVLLTED
                     GPRVIDFGIARVLNAEPVTRTGKILGSVSFMAPEQVSTPREVGVAADVFALGGVLTFA
                     ATGRGPFDGGTGAPPIAVAMKIVHDNPDLADLPSALCSIVDKCLSKNPASRPSPTELL
                     DLLRQEGEFKEKRKRLLRSANSSRPPRPARFYLSATAATIAVSAVVIAVTYAGGIEKD
                     GKTDTPTAQASPTTANPAVEKAAALRPKGWAVWEKPTTALARETGEPPSCGGTAGALV
                     CAEAGGVVERIDVASGQTMWSKQYDAENSPVGSVAGFAGKLVVVSDINGENLTGLDME
                     TGDQAWSARTAGTSSLVMQKSTVAMFHPTGNGTIIDLRDLRTGKRVKSRNLAPGEWHQ
                     IVDGGEEVLYLLTYAEDEGFIKSLSALDSATLQTTKVLATFDKDPGSLVAADGNSVSF
                     LLAGRNLTRVTTSDGTVTLLPLKEAFEGATQAQDNTLYISRADGTLTSYDLQTGRHSW
                     TTETGGESPARPVVADGRLYSLASDGRIASLDAKTGKIIWRSAARRNANRPIYGNPGS
                     HPEPVVLNGVVYTGATTGSIFAVAPPE"
     gene            complement(56062..56823)
                     /locus_tag="SFLA_RS33140"
                     /old_locus_tag="Sfla_6695"
     CDS             complement(56062..56823)
                     /locus_tag="SFLA_RS33140"
                     /old_locus_tag="Sfla_6695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF721 domain-containing protein"
                     /protein_id="WP_014158421.1"
                     /translation="MSGNETAGVDLSRAALGAAMEAARKNGTGPKVKRKPQAVTMVRR
                     DGREAMGLGTAIGALVTERAWELPAAGATLQERWAAIAPELAGHVAAVSYDPDSGWLT
                     VCPESSAWATKARMEQTRVIAAATRAAGRTVVRALRILPRDVAPAPGPAAVLADSAPA
                     APTGPARTRETACEGYRSALAAHQEVAPPRRVGPGIAAAVERQTAAIRELSCRAFPET
                     DIAVLNDAPAPIEPARAERAVPEPSRAPQAAGEVP"
     gene            complement(56820..57212)
                     /locus_tag="SFLA_RS33145"
     CDS             complement(56820..57212)
                     /locus_tag="SFLA_RS33145"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826051.1"
                     /translation="MGAGPGPAGHAKARRAEAAAAQPADDVPAAPVAPVAMPAPRPAP
                     AVVPGAEPEFADADDDQEFVLEELTREQVLDWRNRAAADHQLVFDHIDRYGELSAQRL
                     FTRAFVSQVQRLSGLGHLDVDYTTWGQA"
     gene            58378..58773
                     /locus_tag="SFLA_RS33150"
                     /old_locus_tag="Sfla_6697"
     CDS             58378..58773
                     /locus_tag="SFLA_RS33150"
                     /old_locus_tag="Sfla_6697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158422.1"
                     /translation="MKVAVELVGARVTRTAFDYQVRISFTDHEPDGRVRLDGELVIET
                     PITVTDAVGTQAILLPGTGTALAPLLGLFTKAVTKAEVTGLGTLSLGFDDGTRLSIDP
                     DPDYESWSLTGSGLEPVLVGPGGETDWQH"
     gene            58878..59468
                     /locus_tag="SFLA_RS33155"
                     /old_locus_tag="Sfla_6698"
     CDS             58878..59468
                     /locus_tag="SFLA_RS33155"
                     /old_locus_tag="Sfla_6698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158423.1"
                     /translation="MTTAPDAPPHTVLPYGPGNRWTFTYEGNGYVKTEELALYAEPNG
                     STLTDDYLANKISTEALWQMWVDEWADSYHKQWPNLYRPGEVHISWYVTTPDITGTFE
                     GASHITDWRTLPGQLDADRGQEDFLTHYTHPTHVVTGERLNWLRLPVVDRGWNSGASN
                     KGGFIQQATGWKPSPLQPTMDVRQIGAAAGLYVPPL"
     gene            complement(59940..61325)
                     /locus_tag="SFLA_RS33160"
                     /old_locus_tag="Sfla_6699"
     CDS             complement(59940..61325)
                     /locus_tag="SFLA_RS33160"
                     /old_locus_tag="Sfla_6699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaB domain protein helicase domain protein"
                     /protein_id="WP_014158424.1"
                     /translation="MSSTHDLPAQHPAAHLEEPRLHTDQAAFLRTPPQSLEAEQATLG
                     TLMTSMGASQRYFAETLETGILAEEYYKPAHTVIHRAICDLHKAGEPADVVTVAAELV
                     KRGELSKVGGAPYLHACIQAVPTTANGPRYAEIVRAKAYRRAAIESAQKILQYAYSEE
                     GDEADVRGLVEQELTAIVAGTPGLRDAPPLVDDIYLDYVAELEEIQNGRQLGLSYGIT
                     DLDAMTSGMHPQNVTVIAAQSGVGKSTLALNAAVAAAKNGATVMFSSLEMSSTELMHK
                     IVAAEGSLALHHLTRIDGLTSEDWKKVERLGRELFRTLPLRIHRPDHASLRDIESAAR
                     ACARKDGLDVLVVDYLQLVEIEQTRNITREQAVAAVSRGLKNLSVDLKCHVIALSQLN
                     DDGMVRESRAIKNDASVMIKVERPDMDEPESPRAGEVDFVIEKNRFGPRATVSAAAQL
                     HYSRFIDMQSA"
     gene            complement(61402..62490)
                     /locus_tag="SFLA_RS33165"
                     /old_locus_tag="Sfla_6700"
     CDS             complement(61402..62490)
                     /locus_tag="SFLA_RS33165"
                     /old_locus_tag="Sfla_6700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158425.1"
                     /translation="MEEIHETGAITHRGPVASVQVHAHMEFGPYALTAPLDTKIVIQL
                     MFMLAEQTRQGPDAGLLRVTPLTVLERLRELGVRAGNGSALVGKNAVYDSFARLREKG
                     YIRRITPRDEKGRPTGTAYEFYDWPSWNPDAPNETEIADSALFPQVSTTSGNAGTGNA
                     GSHVAQKGAKQQSVQVKSTSGIAGSGIAGSGIAGSAFPQVKSTSGNAGNPPHPPEEVT
                     TSSPNPLTDTTGLGSLPSPREEGEAGYAEEDLQAAADVLQLLPDPWTQGKLNASKLAP
                     KLLGVMAEQGWPGIHTVDRALLTRQLTKNPHKITNPYRLLAGDRIPNLPRYAVVATTP
                     APGSTADGWCPKHPKYRAGNRCIPCVTA"
     gene            complement(62493..62666)
                     /locus_tag="SFLA_RS34925"
                     /old_locus_tag="Sfla_6701"
     CDS             complement(62493..62666)
                     /locus_tag="SFLA_RS34925"
                     /old_locus_tag="Sfla_6701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158426.1"
                     /translation="MHRPHHPERRPSAISSAAQAPTERGVRDADGESPLLLDDVTRAL
                     AFLDRNGALSGEV"
     gene            complement(63025..63711)
                     /locus_tag="SFLA_RS33170"
                     /old_locus_tag="Sfla_6702"
     CDS             complement(63025..63711)
                     /locus_tag="SFLA_RS33170"
                     /old_locus_tag="Sfla_6702"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_014158427.1"
                     /translation="MNADEAVLLDDTLVNCLEARLGELLRAGRANTLNLEGRFEISRI
                     SASLSGQLRSAPRAILMAGMPGAGKTTLARAFEQAGMVRLCPDEEMFRRYGHYGRDFP
                     RGQFRVREAPVLKEIALELQEHLAAGRDVVVDHGFWTPEERGQWAASAMEAGGSPVLV
                     YLPVPHEVRWERIRERNARALIDANSIEFSEEDLQRFAGRFHPPTADEQHIVYDGDPS
                     AVLDLVGLRR"
     gene            complement(63711..64466)
                     /locus_tag="SFLA_RS33175"
                     /old_locus_tag="Sfla_6703"
     CDS             complement(63711..64466)
                     /locus_tag="SFLA_RS33175"
                     /old_locus_tag="Sfla_6703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014158428.1"
                     /translation="MPGQQRADNRPPYARIAGHYRDLISSGELAPGELLPSIRALADQ
                     WQVSTATADRAMKLLRDEKLVNGIPGVGTEVMARPVSLASGSERHDRSSRTKSSWGVG
                     EKSSGHTAAMVAAPEDVAHALGINPGDDVVRRSRVYRDAHGIVSHSTSWIPAEFAQVL
                     PELARSERLKGGLSLDLIAEATGRQVTHRVDEETARIATPDDLKLLELDAETVAAILV
                     LTARFLDADDELLEYGVDLGAPGRTRRTMSEVL"
     gene            64793..65701
                     /locus_tag="SFLA_RS33685"
                     /old_locus_tag="Sfla_6704"
     CDS             64793..65701
                     /locus_tag="SFLA_RS33685"
                     /old_locus_tag="Sfla_6704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158429.1"
                     /translation="MASRTRTERPSRTRTRRTNGRPALALSTIPAQELNLLPGEMSLV
                     CRDCKTWCPITGLKTPKMAPHRRPEEQGAHRCPSSNQLLEANVTFDEWREQLMTVEAT
                     ATYRRAPRQHHKPLPEPFTPVHRLAARERTSLVHLFVLLEQARHALCAHRTACTGCRG
                     GGRCATGRDLEISFRETQATCTIAREQQMRSDRLNAQRARAVRTGQERTRAYVLDKAH
                     QIDQLRRAVPQGALPTEGPEVPLIHLAPRQAAAQPEEGQIKCEHCGATESGLADAVAA
                     GWHRVTRRPHCGRCAQRFPAWTRTSF"
     gene            65884..66432
                     /locus_tag="SFLA_RS33185"
                     /old_locus_tag="Sfla_6705"
     CDS             65884..66432
                     /locus_tag="SFLA_RS33185"
                     /old_locus_tag="Sfla_6705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcriptional regulator"
                     /protein_id="WP_014158430.1"
                     /translation="MHRMTSTQARHTRRAVLQAAVDAGARCHGADSDPDLFFRADDEG
                     LAAWRARRTKAIRLCTGCPVRAACEELALRDGDGRPDADEMVRAGLTGRELAAVRAAH
                     TERLAAAVEADRDTEGRRLDTLTTQLQREASTNPDSNRNGGVRLMAARTAAQNDRLRA
                     LAAQIRQIRTARRVRAGWGAAA"
     gene            66429..66713
                     /locus_tag="SFLA_RS33190"
                     /old_locus_tag="Sfla_6706"
     CDS             66429..66713
                     /locus_tag="SFLA_RS33190"
                     /old_locus_tag="Sfla_6706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158431.1"
                     /translation="MSTTTLIPWAGRAADVGREIGRQDDRGGDDGRGYERDETDRFHQ
                     YVHGLVLHGDTRAHTAGRRARRTLAGMAPGYKRQPILQPVRPLVFGSETS"
     gene            66924..67115
                     /locus_tag="SFLA_RS34930"
     CDS             66924..67115
                     /locus_tag="SFLA_RS34930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007445997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559929.1"
                     /translation="MPVPAARAAQHLAARAATVCGLAHPLTHILLAAAATAAAQAWDA
                     GHRVTDLHPARPERKTPGG"
     gene            67299..67625
                     /locus_tag="SFLA_RS33195"
                     /old_locus_tag="Sfla_6709"
     CDS             67299..67625
                     /locus_tag="SFLA_RS33195"
                     /old_locus_tag="Sfla_6709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158434.1"
                     /translation="MTPTLNLDSFRDQHGDPTRWSTADIDSYLVLGDIAPPEPLPYTY
                     AEMQAMAADYQRSANDQKAIADRLAGEGHDTAASIWRRGARGARELAAAARMGWPAFE
                     AHLNGW"
     gene            68186..70093
                     /locus_tag="SFLA_RS33200"
                     /old_locus_tag="Sfla_6710"
     CDS             68186..70093
                     /locus_tag="SFLA_RS33200"
                     /old_locus_tag="Sfla_6710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2637 domain-containing protein"
                     /protein_id="WP_014158435.1"
                     /translation="MTLTDWPRTAVGPDPEPSSPTPVSETPAVVSGTPGIVSETPGLV
                     SQPTNGTETEPSGGPLTGTQRLAIGAIVAAALVLAGIGLYLSFAHVADFAHQELRFGS
                     LDKGRLFAVGVDVGIMVMIAVDLLMAWLKRPITWVRYPVWLLTCATVVLNAASAAPQD
                     EAPWALMDYIAAFAHGVVPVLFIMIVEVGRDSIDRMVRPKRAERDSIPWIRWTLAPIA
                     TSKIFRRMRLWGVTSYPEMVRRDQDLIAYEQWLKRKHKGDLHKAKDDELLPMKMAPYG
                     YTVDEALALPGQQDEAARKRAEKAERERLDAETRSQIAEAEAEADRLRAKGKVELVQA
                     EVDGQTGQARAHAKAQVSAAERAAELEREALDNAVIAEGRARKAQAERKEAEDRQAEA
                     QADLETAGLERQAAEQRRIAAEADQIAAAEAQAIETQTIAEARRAAAKADLERAGLER
                     QAAQNRKEAAEADRVAAAEAQAIETQAIAEARKAAAEADRAAAETEKVAAETRRAAAE
                     TDRKTAEENQRREAALADIVRARKAAAEADRAAAETRQAAAEIERRAVEIEDEAKLSG
                     RQRAVRKVARMALTAGLTPDGLAPEDLHRELCERISIAAVQQQLDVSSTDTASKYRTE
                     AAALLADGYRP"
     gene            70216..70689
                     /locus_tag="SFLA_RS33205"
                     /old_locus_tag="Sfla_6711"
     CDS             70216..70689
                     /locus_tag="SFLA_RS33205"
                     /old_locus_tag="Sfla_6711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158436.1"
                     /translation="MNSNEPSTAPLRDVAQNAEATARYLADMQRVLLDMGANLEILQR
                     ETRVHCRSTSVEGDRWYHAKLRALPVEKALKDVLKSLNSLTDGLEKSAYKRRSHDEAV
                     VNTGKARKEKALEKVRKNNPQQIQPASNPGESGDSGQNPGYGGPASIYDLGKRSA"
     gene            70686..70916
                     /locus_tag="SFLA_RS33210"
                     /old_locus_tag="Sfla_6712"
     CDS             70686..70916
                     /locus_tag="SFLA_RS33210"
                     /old_locus_tag="Sfla_6712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158437.1"
                     /translation="MTRPLLKAEIKAQRSRDYLIAQRTAFIEKHGEDLGAFYFLIMLV
                     QTHGRKALKRGDTAALRSLAHDLHALYLKHTA"
     gene            71069..73054
                     /locus_tag="SFLA_RS34935"
                     /old_locus_tag="Sfla_6713"
     CDS             71069..73054
                     /locus_tag="SFLA_RS34935"
                     /old_locus_tag="Sfla_6713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158438.1"
                     /translation="MSSDDTEGQLINFPVAGDVLNRPPELPDPGRLFPQVREEPESPP
                     ESPEETTMELPAIPRPMAPEMALRSDGLSAPDIDGESGEGGDSEFAHHRSLAERLGDW
                     LEYRIALGQSRIESEAPFREAEIARKVELLNAKTAREVGLLEQHNKLRAAQLKARADQ
                     TAARGKSDAAGTKGGGGRGGSGLGGDKGGRKTGPQGPAPRQQPKPQQPTKSPAPAPKQ
                     QPQKPAPPKQQPQKQQTPQKQGPAPKDPRKSPGPKKQPRNQTPPKQQPQKQAPGPAPK
                     PTPQKPGPVSKEQPRRDDKNRPKVDLSKGKGGGTKPPGLGADGKGSKVPGPGGKTPPV
                     LGSDGAKGGPKAWPGAKGPGGGSKGADGPSGGPNGKGAPDPKGSSGGTGTGGKKAPKQ
                     GPGRPAEGPKSGPGPQGPSGSSKAAGGAAGGRAAGGPGATKNGPGPGPGPGPGPGPGG
                     ASADGPGCPGNRTETPEWPGHETRKKPPPPPAGGQDYPDAVIVEPAALPPAPEPHTAR
                     PGTTRPTVQEPHMTQPRTTASAQSGMAAQHRTDITFDQYLVEIANIALAASADQERAE
                     ELAAALGKVADALRDMATDLVGDHNIDTKVTNLISDLADAAGRMKAQAERCAQTCEIA
                     AEAARLAAVGVARTYGEDMQAMDDAGLTHASSAAHHD"
     gene            73072..73488
                     /locus_tag="SFLA_RS33225"
                     /old_locus_tag="Sfla_6714"
     CDS             73072..73488
                     /locus_tag="SFLA_RS33225"
                     /old_locus_tag="Sfla_6714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158439.1"
                     /translation="MSSELSPRPATTPAPADGDNRYKSVQLKLKKLAAAMDSSSDELG
                     SLQREMRANAERTEALAVDIANAHLDTRFVELTNTVAIALGGAAHDVSKLHQNAQDVA
                     QTTHETQRTHSTLYSALDDIRSSRKERTPKPGFFAR"
     gene            73596..75701
                     /locus_tag="SFLA_RS33230"
                     /old_locus_tag="Sfla_6715"
     CDS             73596..75701
                     /locus_tag="SFLA_RS33230"
                     /old_locus_tag="Sfla_6715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158440.1"
                     /translation="MSVPRSVALERIAYTLAAPVLAAAPNLSPDGSVNTGMLLAGAAG
                     VGGALLAVKSREGTGRKLVRLSPVVFGAAVDAAAMYTTGWGWDAALAAAWAAAGWWLL
                     PLSRSARRHHRPALAPIPQPARTAPATAAPPVVDDGADPFTRDVRLLWERAGNPGRTI
                     VAHADRHPVTSHDLTMLLRAAEPGRPITGLSEAGVAAAFGVDDDPDVVRFAQVVRQPG
                     RQGGPGWLEVHLTPDEAARRRKAPTEHEWWADRIGATSGPVPGSDFVKKVRDTERKVT
                     HYIAQVPDEQGEPRVNLHALAAALKTKYDEGRLFVTIDGNQVLVSLWDSSPLAQVFPA
                     TRELLTPDKDGRWVTGYLGNGQPARNRVYTDRGAAHGLFVAPSGGGKTQLMGLHVAAD
                     ALFGAVVMLATEAPDEKTAALGEHTARYGVGALYMIRLLRVMVALMEIRGQMRWDDGK
                     VHEWDPKLPGCPYRMLSAYLDEFLSAARNGDYGAEIMDLAELVSVKGRKYGVGLKVAG
                     QSVYVQDGFTQLLCENLRENCIPVVLKVAPKKITDMFRALGIPSENTPDPLPRSFSPA
                     EAGRIERVMAGQPEPPSDSNTGGAGWIIEGKQPDILRTLFMDFKAGIDDFFPDTIATL
                     TDHEIRELELRDLWFDWTEPPRPGEFGPEPDDEDGDDTAPKKRGGGKPRSGQKSGPRR
                     DAVNSPRQALDAIRTFTNA"
     gene            75788..76309
                     /locus_tag="SFLA_RS33235"
                     /old_locus_tag="Sfla_6716"
     CDS             75788..76309
                     /locus_tag="SFLA_RS33235"
                     /old_locus_tag="Sfla_6716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158441.1"
                     /translation="MPTTHIQSIPTLPTRAPAVLSLEARLAAVEAAMTVALDEAAVAY
                     EVRTAHIPTTPVADVVTLPLTPTLTPTNPYASPVANLLQRAQQRLLADGWCAGSQIRE
                     DGARCLYGAIRAEAAGDRSLEARGLEVLMDAIRSQFSDADSVPTFNDSWANGRVPMQM
                     LGQAAALADSCGQ"
     gene            76527..77767
                     /locus_tag="SFLA_RS33240"
                     /pseudo
     CDS             76527..77767
                     /locus_tag="SFLA_RS33240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006379116.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            78421..78723
                     /locus_tag="SFLA_RS33250"
     CDS             78421..78723
                     /locus_tag="SFLA_RS33250"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826057.1"
                     /translation="MEGVPLEESEARRRAEEFGRTLTDRWDEWAFELNLWTIPAVTGV
                     YGFTWSPTAKDELGRQIRVGGNWPILVDRETGACRVVQGSNEMATLRGTSGVRTAR"
     gene            <78962..79162
                     /locus_tag="SFLA_RS34940"
                     /old_locus_tag="Sfla_6719"
                     /pseudo
     CDS             <78962..79162
                     /locus_tag="SFLA_RS34940"
                     /old_locus_tag="Sfla_6719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_639677.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            79258..>79644
                     /locus_tag="SFLA_RS33255"
                     /pseudo
     CDS             79258..>79644
                     /locus_tag="SFLA_RS33255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010273746.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane plasmid transfer protein"
     gene            80056..80421
                     /locus_tag="SFLA_RS33260"
                     /old_locus_tag="Sfla_6721"
     CDS             80056..80421
                     /locus_tag="SFLA_RS33260"
                     /old_locus_tag="Sfla_6721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158444.1"
                     /translation="MRRGTSEYEAAQEAMAEILLERARNGDWPIQYGKLSKLLADEGH
                     NIPAHSVEMDHLLADVSHQESTDGTKAMLSAMVVLKEKGEPGAGFYRLAREEFGRKGD
                     NVTIWGEEMKLLAHDFRQC"
     gene            complement(80497..80688)
                     /locus_tag="SFLA_RS34945"
                     /old_locus_tag="Sfla_6722"
     CDS             complement(80497..80688)
                     /locus_tag="SFLA_RS34945"
                     /old_locus_tag="Sfla_6722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158445.1"
                     /translation="MILHFASPDPLGRWPQGFLGEAVRWTENPVSSLRSWDHAGNDRA
                     LQAPTEDREFCGEPAMKLL"
     gene            complement(80685..81653)
                     /locus_tag="SFLA_RS34950"
                     /old_locus_tag="Sfla_6723"
     CDS             complement(80685..81653)
                     /locus_tag="SFLA_RS34950"
                     /old_locus_tag="Sfla_6723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158446.1"
                     /translation="MKSRSRLTHDEAKAEMIARGVWPIEPYRGTNKPWRSVCMTCGEV
                     SSPRRSSVINMGQGGCDKECKGKRVSASKRTSHAIATDVIRGWGWEPQEPYPGAGKQW
                     ACECITCGVAALKTYYVVKNGLGRCTSCSGRALSHEEARRRMVEAGVEPLAPYSGSRR
                     RAWKSRCRECRSILDPGPSLANIERGQGGCGNCATYGFNPTAPAYVYLLGHKSLRALK
                     WGIANSERRIINHGYGGWAVLARWNSATGTEAHAVERQIKQWAKDTGLRPAVAASDMR
                     YHGYSETVSLAQVSLDTVWCQIVKIAEREPDVVQPAVIKSLQSGSR"
     gene            complement(82652..83005)
                     /locus_tag="SFLA_RS33265"
                     /old_locus_tag="Sfla_6724"
     CDS             complement(82652..83005)
                     /locus_tag="SFLA_RS33265"
                     /old_locus_tag="Sfla_6724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158447.1"
                     /translation="MDLSATGEPVMTHEDPQVRVGVHIGQGTCILIRDGIDFAAYHAW
                     VEFAAPDQKSWTAEKVEFSAKRPDGESVGLTVDLLNDACDGPRDGVPDAIWKVVALAA
                     TSAGDVGIRYTAPTS"
     gene            complement(83109..83345)
                     /locus_tag="SFLA_RS33270"
                     /old_locus_tag="Sfla_6725"
     CDS             complement(83109..83345)
                     /locus_tag="SFLA_RS33270"
                     /old_locus_tag="Sfla_6725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158448.1"
                     /translation="MGRAAVMTRADGEQRRRAVPISVSNFLVLLRETLPEFPGSLAAA
                     VVTTAAAAAYRAVRITRPRRPEPTSAESFARSHR"
     gene            complement(83448..84782)
                     /locus_tag="SFLA_RS33275"
                     /old_locus_tag="Sfla_6726"
     CDS             complement(83448..84782)
                     /locus_tag="SFLA_RS33275"
                     /old_locus_tag="Sfla_6726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158449.1"
                     /translation="MLQTVFNGRGEFVLIALAAVTIAALVGYFAARKFLDRPWAYAGL
                     FATLAAELSVTIFFPSPGHVSGQCVLNRNYNEPFATEQGLLNVAMFLPIGLFGVLALR
                     RVFPVFLGGALLSVATELGQALAPWVGRSCDSGDVLTNTLGAGIGALIGWAIVRAVRG
                     EVHSLRSAGKPAVVVFAVGFIVCAVVWKAWITPLAVDSTSLQIAGGDEKAQAQQVLAA
                     AFDDHVDIKNVQLQSGQNDAPDLLMITLESGFAELSWPDKEQLTVSLESTSQPGPGSF
                     AVPGAGAAPESADDALRIATKYAKERFPWGLEDSHVKSFPVGDDAEFGWMVSWRSRVD
                     GVLMPMRLDVQINRAGRVSALLTRHAEDFTSIPPRKVSEKQAAATASKYAGGAKTAAG
                     NLLAIRREGEWRAQWVIPVSSGTDSYPVYVDAETGKVDERASLVQGLPTAPN"
     gene            complement(84852..85307)
                     /locus_tag="SFLA_RS34955"
                     /old_locus_tag="Sfla_6727"
     CDS             complement(84852..85307)
                     /locus_tag="SFLA_RS34955"
                     /old_locus_tag="Sfla_6727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158450.1"
                     /translation="MNVFAHKIVRSAAVAGLTLASMGGTGAAQASTSAPSGDVSIQES
                     CPSSGQVGYGRVCTSLSSGRLFHDKTQGSGPVTVRTWYEKNSGGSSISAKLGFNYAGT
                     TTWGSTFTQSPGTTKSASWSRNWSSDCYSTIGMMSVTGQGTYQTPSGTC"
     gene            complement(85700..86065)
                     /locus_tag="SFLA_RS33285"
                     /old_locus_tag="Sfla_6728"
     CDS             complement(85700..86065)
                     /locus_tag="SFLA_RS33285"
                     /old_locus_tag="Sfla_6728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158451.1"
                     /translation="MQFRGIAMPDGLPRSGTISNLEKNRVLLDWLRWQVGQTERRIRE
                     LETQEAQERERRERARAEMSWKIQPQRSSSIALLHRGGCATYPDRVGLISREDAKVAL
                     AEPDIEPCQVCRPDTGLLS"
     gene            complement(86082..86324)
                     /locus_tag="SFLA_RS33290"
                     /old_locus_tag="Sfla_6729"
     CDS             complement(86082..86324)
                     /locus_tag="SFLA_RS33290"
                     /old_locus_tag="Sfla_6729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158452.1"
                     /translation="MERFPFPDDLVRAQQEWHNTYRALACSRPRRATELRRRLLALSV
                     RIHCHPFWSTPPGRTPAARVDLRQRTRGGRRTESAA"
     gene            complement(86375..86812)
                     /locus_tag="SFLA_RS33295"
                     /old_locus_tag="Sfla_6730"
     CDS             complement(86375..86812)
                     /locus_tag="SFLA_RS33295"
                     /old_locus_tag="Sfla_6730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158453.1"
                     /translation="MQRMIISAALAAALVPLAAASAVSAPTAAQAYVDKRVRNCAGKA
                     SDCRPGAVAHYWYKRGSSARGVGWVYASREGARTGTARWLFKKPGDTWKTGGAWKRAG
                     RVGGTFAETSWGRDGHTGPVYPRGTRICVQFRGLPTKACVSLK"
     gene            87065..87730
                     /locus_tag="SFLA_RS33300"
                     /old_locus_tag="Sfla_6732"
     CDS             87065..87730
                     /locus_tag="SFLA_RS33300"
                     /old_locus_tag="Sfla_6732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_014158455.1"
                     /translation="MINNVARSLAAAVLTLVPLLAAAPVQAAEVTTLADGVHALPLAA
                     ESRTGYERSSFKHWVDADKDSCNTRMEVLIAESRIAPTIEAGCKVTAGSWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLGSDRSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTVDQPEADALTTLAESCGQQPLDFEPATD
                     PSK"
     gene            complement(87859..88590)
                     /locus_tag="SFLA_RS33305"
                     /old_locus_tag="Sfla_6733"
     CDS             complement(87859..88590)
                     /locus_tag="SFLA_RS33305"
                     /old_locus_tag="Sfla_6733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014140644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_014158456.1"
                     /translation="MRRSRVAALAAVVLSATLISCNPQLADDKPNGSTPTSTGSAASP
                     APGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPEQGDRCKLAGGVWMSYYDEVEVTDAKKLDIDHMVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     VEKTALLDLAKDCTDTVVEFEEAAE"
     gene            88865..89341
                     /locus_tag="SFLA_RS33310"
                     /old_locus_tag="Sfla_6734"
     CDS             88865..89341
                     /locus_tag="SFLA_RS33310"
                     /old_locus_tag="Sfla_6734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158457.1"
                     /translation="MSAWLTPDQVASGALSLGYAMMIAALQGMTCDTSLLYGHGANAF
                     ATYPGLTRGKKANHLWLPLAVIESEDTRARLGDARTEEERLERAVDAFARYLGQSRPD
                     AMVSDLLHEPPAPAPVVVLSPNRTPTPSGPARHAPGRPPSTTNASTKPNHSSVSTS"
     gene            complement(89760..90410)
                     /locus_tag="SFLA_RS33695"
                     /old_locus_tag="Sfla_6735"
     CDS             complement(89760..90410)
                     /locus_tag="SFLA_RS33695"
                     /old_locus_tag="Sfla_6735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158458.1"
                     /translation="MLIVNAVLETPDTVDFSLWPVADLPPYQFMALSGGMSPLEVGSA
                     LAMLADYNSRTGDDDRPVMDASEAIRRLLETDKVIAPGGLRFHDTRINAIVQPGCCCG
                     LEDWREWLDVAGGETLWLGHDPSPRLEHADGSVQLWPDGGDAQETPPGQPIDIVAGDL
                     PGILHTVQEGLQGFLALTMKWAARQSPTLAADLAARLDADLVISAPLPGTSGQHVP"
     gene            90541..91164
                     /locus_tag="SFLA_RS33320"
                     /old_locus_tag="Sfla_6736"
     CDS             90541..91164
                     /locus_tag="SFLA_RS33320"
                     /old_locus_tag="Sfla_6736"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158459.1"
                     /translation="MGQSRPDAMVSDLLHEPPAPAVMPSPTRTHAVRASAARARSTTV
                     HDQRQRAAQPQREYRLTDAQKQRLADMQEERELAGVRAWNRRPYGDRTDQELTRLIAN
                     GPVDARREDRAAAAAEESERALLQEIAEAEAGGTSLGQIEVAPIYVLLDQADEHLAAA
                     RVEQAREQAPPRSPRPPTNTFGSSGPLTARAASRCAWRAPPARSTPS"
     gene            91128..91670
                     /locus_tag="SFLA_RS33325"
                     /old_locus_tag="Sfla_6737"
     CDS             91128..91670
                     /locus_tag="SFLA_RS33325"
                     /old_locus_tag="Sfla_6737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158460.1"
                     /translation="MAGTSRKEHTQLTKQAEAARAAAWREGADARVAARQAAADAWKV
                     LRDSPYVTVLGATERQAPDVDTLATRLAEMRETKVPARAQQKDTGDEKRVARCHGQAT
                     TARENAAMYRAVAADARTEKTLRAQIAEQHPRLHESEVRARTELQQARDARTTRVAAQ
                     SSRSYQPPSQARSGPSRGRR"
     gene            complement(91807..92067)
                     /locus_tag="SFLA_RS33330"
     CDS             complement(91807..92067)
                     /locus_tag="SFLA_RS33330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158461.1"
                     /translation="MTTPTNDDGTTSSHNQVQPAPPVQVASGSGPLLTSHAALILLTA
                     VMVGGAVAVLTYLSASNGAAAALAGLMGAGASTPVLHTLIGS"
     gene            92526..92789
                     /locus_tag="SFLA_RS33335"
                     /old_locus_tag="Sfla_6739"
     CDS             92526..92789
                     /locus_tag="SFLA_RS33335"
                     /old_locus_tag="Sfla_6739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015575441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826063.1"
                     /translation="MTQAPRVFGTEHDAPTTGQQPGHTYRELVGGPLDGQLIEVTGWT
                     DEEITTGARLITPHSAYGPGGRASYGPTFSRPDGPWVWEGDLP"
     gene            92902..93192
                     /locus_tag="SFLA_RS33340"
                     /old_locus_tag="Sfla_6740"
     CDS             92902..93192
                     /locus_tag="SFLA_RS33340"
                     /old_locus_tag="Sfla_6740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158463.1"
                     /translation="MSCTCAEGFTVQLHDGGTRYPVVPVDQHTEISYYFDARCTRCRS
                     KYEAPFARVDSKGQALTDQMQDVPVVDRVWFSKQCGPFTCGCGEESQAGDPA"
     gene            complement(93971..94417)
                     /locus_tag="SFLA_RS34960"
     CDS             complement(93971..94417)
                     /locus_tag="SFLA_RS34960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014677547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559927.1"
                     /translation="MRLSGMPVIAGVVGVVLALGLSVAPAQAGESSAAVDCGYTGDWS
                     SDGGAYAEFSLDCFVGTGGPSTAGIYVVGTLHDYAKDGLGPRLYGQGLTSSGSWGSTQ
                     ELARNSNGYDGPPADISKSIGAYGFNARFKVCNGGVNANCSGWFGG"
     gene            94857..95864
                     /locus_tag="SFLA_RS33345"
                     /old_locus_tag="Sfla_6741"
     CDS             94857..95864
                     /locus_tag="SFLA_RS33345"
                     /old_locus_tag="Sfla_6741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_014158464.1"
                     /translation="MLRIHFTSKDLARVTLGYNSSLPVSEAVMSLQALRRGSGPKFSA
                     WRHHLAGKQLPARVSLLGSLVPASGWAPDFLTPGPEHASPTTGAFDVIRATPRRRLAA
                     ELHRLSSHHRLPAWTHLLADGDREALDTVTDTLAAYYDVAVTPYADRMRAVLDADHAW
                     RVHTMARLGVGAVLAGLHPQVRWEEPVLELAGFAGQGQVDFHLEGRGLLLSAHIFCGS
                     RPRALLNEVGTPVLVYAPVWNLQSDSLVAAPADARPHVSTALAALLGRTRAAVLEALA
                     TPAGHNTKQLAERLAISPASASEHVAALRAAGLVTSLRHANMVRHTATTLGKNLISTA
                     T"
     gene            <96102..96293
                     /locus_tag="SFLA_RS34965"
                     /pseudo
     CDS             <96102..96293
                     /locus_tag="SFLA_RS34965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010361226.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            96290..96848
                     /locus_tag="SFLA_RS33350"
                     /pseudo
     CDS             96290..96848
                     /locus_tag="SFLA_RS33350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010361227.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
     gene            complement(96903..97898)
                     /locus_tag="SFLA_RS33355"
                     /old_locus_tag="Sfla_6743"
     CDS             complement(96903..97898)
                     /locus_tag="SFLA_RS33355"
                     /old_locus_tag="Sfla_6743"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158465.1"
                     /translation="MQDDLLVVGFDLETRREVHVSEREPEHWKRLGYGGAGQLVCFYC
                     FHGFEAPAGTRVPLVTRGRLGGKVRRHFAHPPGQAPTGGHGPETVWHITTKHLLAAWA
                     RSRPGVDRVRLEQWTEDHDRRADVEVLLQDGTKVALEAQRKLMTDDGWRARHRDYARQ
                     GVVDVWFWRPRVHFPHVVLDEGLPVWFYSVSKREAATSLGRPHARVHRWWQVPDLAVF
                     GLHHPPCALDELERVTIPLGALGLGPGGAVLPEDLQKRVLDSQRETREEAKRRKDSEA
                     RYARAARESQERAARAPAPVPLPPLPPVPAGGLRCEVCRRPLDPLLARTRRHILC"
     gene            98514..99203
                     /locus_tag="SFLA_RS33360"
                     /old_locus_tag="Sfla_6744"
     CDS             98514..99203
                     /locus_tag="SFLA_RS33360"
                     /old_locus_tag="Sfla_6744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018847772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_041826065.1"
                     /translation="MTEPTYLHTTRVAYDTVAENYAKLVPSAFEDDLYGRAMISTFAE
                     LTRALDSGPVADLGCGPGHVTAHLQSLGVTAFGIDLSPETVAVARRRHPELQFDEGSM
                     TDLDLADGSLGGVIAWYSIVHTPPELLPVIFAEFHRVLASAGHLLIAFKAGDRLRHLE
                     NAYGHELSLDVYWVSPDRIAELLAQAGLMVDARLIREPNEQEKPRQGQQAYLLARKPV
                     EQGARAADTIA"
     gene            complement(99240..>99605)
                     /locus_tag="SFLA_RS33365"
                     /pseudo
     CDS             complement(99240..>99605)
                     /locus_tag="SFLA_RS33365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018528747.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase"
     gene            complement(99708..100898)
                     /locus_tag="SFLA_RS33370"
                     /old_locus_tag="Sfla_6746"
     CDS             complement(99708..100898)
                     /locus_tag="SFLA_RS33370"
                     /old_locus_tag="Sfla_6746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158467.1"
                     /translation="MSNDWEWVELGVLADFVGYGITRPGRQDPKGVPMLRAGDIANGR
                     IRATGPMLISRDVDGANPQTRLRLGDVVVVLVGRVGEAASVTGEHEDWNTARSVAVVR
                     CAAPALAEWVRVWLTAPAARAWCVAHASGSAQATLGLAKLRRLPVPMPPLGVQDRVLR
                     TVKTIEARIEANERIAETAVALADAHFAVATADRRNWPQHRFKDVVKARTGAAAKPSE
                     PVSEGAGTAWAAPADVMRSPLPYLDQTAERVAEGADGDHEVCPPDTVLVAPKAGEVQA
                     AVNRMPVVAGRGVLAVRPHGPFDGWWLLHEIRSRSGELSALGQGTAGRELSARAFLYA
                     AVSWPPVEARGRFVRLAAPLHARALTAVRENRSLRLLLAESLRREVPATLPAVAFATV
                     PASR"
     gene            complement(100895..102280)
                     /locus_tag="SFLA_RS33375"
                     /old_locus_tag="Sfla_6747"
     CDS             complement(100895..102280)
                     /locus_tag="SFLA_RS33375"
                     /old_locus_tag="Sfla_6747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_014158468.1"
                     /translation="METTEYSQVVGKALDKLRGPLDIQDAQQLLLAVIFLRCVSDIPA
                     GGASGDRPQWRQLAELGSSLAGDHELTWALKQALDAWTSSYLDGGRPMSESIPDHLVA
                     GPLLREVLGLVDRADRLVELYEECLERFSNNKKGGNYFTPRHLVRLLVEMLAPRQGEQ
                     VFDPACGSGGFLVESARYVQEHGGSSAAVGLVGRDINPRARQVAWMNLTARGLEADLG
                     SRPVNSLWADDTPAGAFDVVFVNPPFNLKLARDDLRYDSRWRYGEPPRSNANFAWIQH
                     VVSKLTTRGRAAMLLPDGATFTSGAAAGIRRGLVADDLVSAVVALPAGLFPHTSISAS
                     AWIFSREKPAERRGQVLFVDARKQGNLVGRGRRTLSEGAIESIADTYRSWYAESYQDR
                     PGWCRSATVEEIAAQEFNLQAVRYVGAPAEAPAPQSAEQRVAELTRELYGHFADAARL
                     ETEIRDILGEL"
     gene            complement(102286..102483)
                     /locus_tag="SFLA_RS34970"
                     /old_locus_tag="Sfla_6748"
     CDS             complement(102286..102483)
                     /locus_tag="SFLA_RS34970"
                     /old_locus_tag="Sfla_6748"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158469.1"
                     /translation="MNQSPGRRVHRICTAGSLSLNVALSAGVVMYGLGSSSGEAIAAG
                     GGAFVAVMALALAIISALQLD"
     gene            102725..103753
                     /locus_tag="SFLA_RS33700"
                     /old_locus_tag="Sfla_6749"
     CDS             102725..103753
                     /locus_tag="SFLA_RS33700"
                     /old_locus_tag="Sfla_6749"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158470.1"
                     /translation="MADRPSGPLTPTRAPKRNRRRSGPPSVLDFPPVPNGVDYLRSVV
                     THLNPATGGSPRDIKYAVLHLQAAAEVLLKARLSREHWSLIFADPRTATSDAYAEAKF
                     TSCTTGAAVERLRNIAGVSISDKEADALDKLADDRNALQHYGLTFNAKVIEARAATVL
                     DFLVRFIDEHLEPELRKSGPLYLEMEVVRRGLKDIQSFVTKRMNRLRGNELKDAENRT
                     LRCPDCQQLAMLAEAGRSRCCFCGKAWPAYDLADLLRTDEQPEPLDQCPGCYVPTLAD
                     NAVFADGKPTLFCTNCAGRFAPAELGNCAACGCYCSTSDTGGQDLCIFCAEDIRRQEQ
                     EDHERFWM"
     gene            103794..104885
                     /locus_tag="SFLA_RS33385"
                     /old_locus_tag="Sfla_6750"
     CDS             103794..104885
                     /locus_tag="SFLA_RS33385"
                     /old_locus_tag="Sfla_6750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014158471.1"
                     /translation="MTTTPPAPVPGPRATLTAFRRDPRELWPEYARKLYDHLAAHYGE
                     DDPLPTLAASWIAHQRSLNTQKSYARGFRIFEEFAREHGAHPLTVSFPLADTFRLYLE
                     TTPTWVRVKGGRRGEMVRAGEPYSDASRANALSASSSFYSYLDIVSDTPLKNPFDAVR
                     RPVIDPGYSPTPGYTEAQWAALVVTARDHHRVAAYRKRAYAILLLLYTCCLRIDSLLS
                     AKVEHLGYDQGHHVIKVKVKGGSWRNKPIPPIAWDALQDYLDGRKTGWLICTASGGQL
                     DEPAVWQLLQSLAKRAGLPPRGPHGVKGDAVTHALAKKDARPDKIQRWADHHDSRTTQ
                     RYNRRKDNLDSPGYGIGADLAETLADTPT"
     gene            complement(105047..105370)
                     /locus_tag="SFLA_RS33390"
                     /old_locus_tag="Sfla_6751"
     CDS             complement(105047..105370)
                     /locus_tag="SFLA_RS33390"
                     /old_locus_tag="Sfla_6751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158472.1"
                     /translation="MTVTQADLNALSVAHPNLNANGYGSSAFAPQPVRLDEVQAAYAW
                     IAEQTWLTVPAESSYSLKHVMERVTGMYVTNGAFIAAALLHAPAGLEVQLDDLNPAIG
                     IKVEG"
     gene            complement(105471..>105805)
                     /locus_tag="SFLA_RS33395"
                     /pseudo
     CDS             complement(105471..>105805)
                     /locus_tag="SFLA_RS33395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_628097.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            105978..106855
                     /locus_tag="SFLA_RS34975"
                     /old_locus_tag="Sfla_6753"
                     /pseudo
     CDS             105978..106855
                     /locus_tag="SFLA_RS34975"
                     /old_locus_tag="Sfla_6753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008739403.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            complement(106950..107684)
                     /locus_tag="SFLA_RS33405"
     CDS             complement(106950..107684)
                     /locus_tag="SFLA_RS33405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014158473.1"
                     /translation="MGRPEKPIRTLNPHLLMLATHLRETREEAGLTYAELAARTRHNW
                     SATTLQRAASGERIPRLEVVEAYVLACGARSAERARRLWRHARSYEHGADYTNAPRPR
                     LVESAADLRAALRATYYKAGAMPLREMERRAGLGRLPRTTVRRMLDGATMLDQEQLRS
                     FLTVCDVPERDHQDWLDAWTRVWKRNTVDGLYERSFADEMIVRLAVTTKAMGRQLMGP
                     PLARQRNIRRTLSPFAEGNLGTTQAG"
     gene            complement(107693..107926)
                     /locus_tag="SFLA_RS33410"
                     /old_locus_tag="Sfla_6755"
     CDS             complement(107693..107926)
                     /locus_tag="SFLA_RS33410"
                     /old_locus_tag="Sfla_6755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158474.1"
                     /translation="MSRRRHAAGVRLPAPHRLTGTETAVIIVIILTSTALAWGGMDPN
                     ILVQLLASVLLLSVGSVVTLRFVRRAPLPLSRV"
     gene            108609..108884
                     /locus_tag="SFLA_RS33415"
     CDS             108609..108884
                     /locus_tag="SFLA_RS33415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041826071.1"
                     /translation="MAAVEDILDAIGTLGGAGPELALILTVVAATTNGARRHLGLTMD
                     DQERSRLLPRRCCSRPAPRAPRPAARRGRRGLSPRLPGPRCLGIPQR"
     gene            complement(109019..109810)
                     /locus_tag="SFLA_RS33420"
                     /old_locus_tag="Sfla_6756"
     CDS             complement(109019..109810)
                     /locus_tag="SFLA_RS33420"
                     /old_locus_tag="Sfla_6756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158475.1"
                     /translation="MTTAAFSDDDGDPLEELRDTQDAVRRAADAVSASFADLLAPQRE
                     VARLARETLMPAIDASRFINEVLAPQRAFQGQMRAMMQDITSMQRLVVPNPLDGVLAQ
                     IRENQQQYQDTFSRLTDGLVPRIDTSFLDGLLHDTVPWQGLSGPGRDILAGVLDDARA
                     SVEAGEEREVPEEMVTELEEQAAQFATSAPGLLPPAAQKYLFAVFTAGMVMTTLMYVS
                     VVSDAGNAVLDEVYQHGELAIIVFTAACLAWDRRQRNRGDDGGGD"
     gene            <110014..110199
                     /locus_tag="SFLA_RS33425"
                     /pseudo
     CDS             <110014..110199
                     /locus_tag="SFLA_RS33425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009338907.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            110485..111699
                     /locus_tag="SFLA_RS33430"
                     /old_locus_tag="Sfla_6758"
     CDS             110485..111699
                     /locus_tag="SFLA_RS33430"
                     /old_locus_tag="Sfla_6758"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_014158476.1"
                     /translation="MASPYPGGEREKLVSKLPATLRQALKVRAAQLSTDVQDAVAAGI
                     QAWRDHPDQLPAVDTAGAESFGTYLPEGLYDGFKADCRTREVSYIQGLAQSVALWLAQ
                     NPAASAQPVRRLIVCNQKGGVGKTSVAAGLAQALAEGAEHILKAALAAGLSNEDAQSL
                     AQAGGQRVLLVDYDPQGHLSHQLGLKAIPAGEESLVTHMLHRDQAQHSLLDLTIPIDG
                     ERFGDQLHILPAAFDAFLLDSGLTIFRGPRHAALERALAPIEEHFDVIVIDSPPSLGL
                     SMDAGLYYGRQREDERPAASGLIIPVEAEDTSAQAYGMLINQVDSLARDYDIQIDQLG
                     LVVNKFDSRRGYIATSSRDKWMQLGTPPVLAVVPDLKEQREAVRLQKALLAYAPTSEQ
                     SHAMRQIAKGLK"
     gene            111702..112802
                     /locus_tag="SFLA_RS33435"
                     /old_locus_tag="Sfla_6759"
     CDS             111702..112802
                     /locus_tag="SFLA_RS33435"
                     /old_locus_tag="Sfla_6759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_014158477.1"
                     /translation="MSKADSLGGSATFEAVAQPISSRAASFARFAGQDAPTGPGNTPT
                     EAATASPRLPITAIARNPYNPREELKAIEEMADSLTSRGIIQPLTVVTRSAFLAAHPG
                     QDEALGTAQYVVVDGNRRLAGAKVAGIDDVPVHIDDSLADDADTLLETALTAAVQHED
                     LDPLDEAKALQRLVEVHGSQRAVARSLGKSSGWVTQRLALLKLTPDLQQAVEDKKLPV
                     EVARTVGQLPEQQQGGAAEAALVKREQKKATRKRGAYAVSTPAGSAAGPAKTAVPTAP
                     SATSSSHQASTPAQHDLGADHMPWADGAAVMDTVFARLNPAQRSAFILRYFQISRGVE
                     DVVADMYGDLTPENRAALAVILDQVATQLRKA"
     gene            complement(112950..116567)
                     /locus_tag="SFLA_RS33440"
                     /old_locus_tag="Sfla_6760"
     CDS             complement(112950..116567)
                     /locus_tag="SFLA_RS33440"
                     /old_locus_tag="Sfla_6760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_014158478.1"
                     /translation="MVWDKKPGVAASATGAARADSGGLANSGVLHVEKLYQYAPTVEA
                     PSTEEVTAAVEAYAQRVREVFGRLDLEVLTPLSEQGEHPVVELREVFVPPLVRADPPA
                     VELPRELMRRLMEHGEITELGDLPPGADKGALARIREAYRQRPPKQVLHVLADGDVER
                     TALLGDPGAGKSTLARYLALTLTSPVMPEPLSALAGKLPIVVELRRYADERWRDRTFE
                     DFLEHLHSLEGMSVPRPVLDVLLQQQRVVMVFDGLDELFDPAVRNETSRRIGAFAARH
                     PGVRIVVTSRVIGYQRAILDGAGFKHYMLQDLDEDQIGEFARLWYTNACPHDASLAQN
                     LVERVTSAVAHSRPVRELAGNPLLLTILAIIGRRQTLPRDRQGVYKHAVTVLVAHWDR
                     DAKQLTTTGAPEALEVLGADERLELLRLLARRMQDGQGGIAGNHIHARDLEAVFGEYL
                     SEYELPPVQAKAAARGMVAQLRERNFILSRYGGEVYGFVHRAFLEYLAAADIAHRYKE
                     DREWTPEELITSVVEQRADDPAWHEVILLVIGQIPERDAARAIDRLLYMHQQCANRNN
                     RMLVLTIRALAEVRKIGALAPQSRAVVDSLRSAVSHSHYPGAAELQASLPALGTFNEY
                     WTGRQRYLHWFLLLGQHQVKTYDSATVASALYLSLSEPSVLAHFSPSADVRRSSLQHV
                     VDHLDDPTATLALLLDRATTDPHEGPRFIALQLLAERFAKEPGTLALLLDRATTDPHE
                     NPRCTALQLLAERFANEPRTLALLLDRATTDPHENPRCTALQSLAERFANEPRTLALL
                     LDRATTDPHENPRCTALQSLAEHFANEPGTLPLLTDHATDPHEKLRYTALQLLAEHFA
                     NEPGTLPLLTDHATDPHPTPRYIVFQLLAQHFANEPGTLPLLTDHATTDPHPTPRFLA
                     LHLLAQSFAKEPGTLALLLDRATTDPHEDPRDIALNLLAQSFANEPCTLALLLDRATT
                     DPHENPRYTALQLLAEHFTKEPGTLALLLDRATTDPHEEPRYTALQLLADHFANEPGT
                     LALLLDRATTDPHEEPRCTALQLLADHFANEPGTLALLLDRATTDPHEEPRYTAFELL
                     TQRFLEQPETLVFLQGRTRTEREPVLRARAFRALAAALPSGDVYEVGTSALEDDHSDV
                     RAGGAWILAFGCPNDPRGRAVLRDHAQSDPHADVRTAASDALRAAEVLSAQEWKLGSA
                     I"
     gene            117149..119215
                     /locus_tag="SFLA_RS33445"
     CDS             117149..119215
                     /locus_tag="SFLA_RS33445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NB-ARC domain protein"
                     /protein_id="WP_014158479.1"
                     /translation="MKWRRTGQSPSSHASKGNSVRSASVKGSSDPIPADDGAAEKGPH
                     EPATSAAPGTEPAVHLERSGNASASAAQAVAISGHVGHLTVSQSPPRAPVQWPLRLGS
                     VPPLASAFQDRTEVRDQIDQARVSHDTVVLSQVLAGGGGVGKTQLAAVYAHQSLAAGV
                     ELVVWVDASETEQVIARYAQAAYWVQAAEGPAGKAEQDARAFLQWLATTSRSWLLVLD
                     DVTDLEGLQPWWPPPSSGGGGRVLATTRRHDALLSGGGRAVVNIDTYNAEEADTYLSE
                     RLRVANAVHLLDAQAGKVAEALGYLPLALAHAAAYMVNEDVPCTDYLHRFNDSTVRMS
                     ALLPRQADTEGYGRRVAAALMLSLDIAQQCEPVGLAIPALRLASVLDPAGHPRSFWTS
                     EAATRYLSAHRLGPISAARSSDDVQAEGRSVIRLLHRYGLLIDDAQAGPRAVRVHALT
                     ARAVREHTPSDALPDIVKTAADALAELWWTVPPIYREERAVLRTNIDSLDGHAGDLLW
                     EVEGHHLLRWAGRSLTGYGLATAAVHYWQQLTATSERLLGRTHPHTLAVRRDLAVAYF
                     RADNPKQGFAMLQEDFHHQEHVLSLARPTAGEAGTTSQLEGTGTAIELLEDTLAARER
                     LLGPEDPAALNARVQLALAYRHAGMTKNATLTLSALTTDTPQRTRQPGQRAPAHRLQR
                     WWERKR"
     gene            119974..120327
                     /locus_tag="SFLA_RS34980"
                     /old_locus_tag="Sfla_6762"
     CDS             119974..120327
                     /locus_tag="SFLA_RS34980"
                     /old_locus_tag="Sfla_6762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014152175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559928.1"
                     /translation="MPWVREYVRRDGTRVKAHARWAAGGRREMSIVVIAGLAVIALGN
                     PSSSADGPEKTPRPASPSVYPVKFPKTRKSTAKPRPQPTVSYPIRFPQASKTAARPRP
                     RSTVTYPIPWDRSAR"
     gene            120324..121031
                     /locus_tag="SFLA_RS33450"
                     /old_locus_tag="Sfla_6763"
     CDS             120324..121031
                     /locus_tag="SFLA_RS33450"
                     /old_locus_tag="Sfla_6763"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_014158481.1"
                     /translation="MTARRPAPRRRPRRSPARSRKRKQAHTGGEILVGVVVIGWLSSQ
                     LMHWLAAHPWVPLLLALLAGAGAFIWFRSRVQAQALLHTQVRALRYPMAALDGLQHRQ
                     FEHAIRDLMLRDGCADAVQVGGAGDNGADVKATDPYGRRWVIQCKHRRAGLAGAAVGT
                     PDLHVLNGTGRPVHKGDVIVLVTNGRFTKPATEFARSQRLHLVDRHTLATWAAGSQPL
                     WELLRAVPPPRRPTTLS"
     gene            121177..121422
                     /locus_tag="SFLA_RS33455"
                     /old_locus_tag="Sfla_6764"
     CDS             121177..121422
                     /locus_tag="SFLA_RS33455"
                     /old_locus_tag="Sfla_6764"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158482.1"
                     /translation="MESFPFPDDLIHAQQAWHATYRQLATPRPRHTAALRRRLLALSV
                     RIQWHPFWSTPSGRLPAARAELKRLARHHGQLEARTA"
     gene            complement(121569..125354)
                     /locus_tag="SFLA_RS33715"
                     /old_locus_tag="Sfla_6765"
     CDS             complement(121569..125354)
                     /locus_tag="SFLA_RS33715"
                     /old_locus_tag="Sfla_6765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide TPR_1 repeat-containing
                     protein"
                     /protein_id="WP_014158483.1"
                     /translation="MSGSGTRRLSRGELIRQRAKARFVGRRAQLALFTENLSKDPLSE
                     EAPADFLFHVRGVGGVGKSTLLRQWQEAARRAEAVTAVVDENDVHGVQQAMVELARQL
                     AEQAGPCKEFDKAVEQYRREQAAQADPMLVEGEASVSSRMVTQAALGAASLIPGAGVV
                     TAMANPDAAAQGLDRIRAASRTRAQRRGGQGDETGMSRAFVCELERLCRRQRWVVLFF
                     DTWEQTAQYLDGWLLRLLDEEFGPVPANVIVVLAGRDELSEREWAPLRDQVADVPLEV
                     FTEAETRSLLTSRGVTDVGVVEAVLQLSMGLPLLVELLALARPRTSEDVDAGGNLADV
                     AVERFVQWITDPEKREAVRACALPLQLNEDVFTEAAGPGAEGLWEWLRGQPFISGRGD
                     YKHYHAVVRASMIRQQRTHSPQGWTSAHLRLAETHATWRAAVEARLPEAKRWDDAEWR
                     RHRLDETYHRLCAHPGTYLTDALEQVVQAAGQETAVLRQWIETLEQAAQDTADTTLFA
                     WTGRLRDTLTGDDPRLTCLEVLLSHSQLSSESRSWAHTHRGILLYRSDQDEEALTEFD
                     RAIAHNARNALAWARRGEEHRLLGNEDQAVADLTAALELEPTNAWALGSRGETHQQAG
                     RNQEAVADLTAALELDPTLTWALGARGDTHRQAGRYDEAVTDYTAALELDPTLTWALG
                     ARGETHRQAGRYDEAVTDYTAALELDPTYATALGARGQAHQQAGRHEQAVTDLTAALE
                     LDPTYAAALGARGDTHRLAGRYDEAVTDLTAALELDPTYAAALGARGDTHRQAGRYDE
                     AVTDYTAALELDPTYATALGARGETHRQAGRYDEAVTDLTATLELDPTYAAALGSRGD
                     AHKQASRYDEAVTDYTAALELDPTYATALGSRGDAHRQAGRYDEAVTDLTAALELDPT
                     NAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQAGRYEQAVAD
                     YTAALELDPTNAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQ
                     AGRYEQAVADYTAALELDPTDDWALAQRGETHRQAGRYEQAITDYTAALELDPTDAWA
                     LGSRGQAHQQAGRYEQAVTDLTAALELDPTLDWALASRSQAHRQAGHREEARMDVEQA
                     TEAHPDDLECAFEKLMLETVEGRFEAFREQWRQLLTSPVNPQDETKASYLRLFRTVLI
                     EPEAGVPEATTGVLATHPSEGDIADAVRYLAELSVLEGEVGERARQCHDLIMRRPSS"
     gene            126318..127103
                     /locus_tag="SFLA_RS34985"
                     /old_locus_tag="Sfla_6766"
     CDS             126318..127103
                     /locus_tag="SFLA_RS34985"
                     /old_locus_tag="Sfla_6766"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158484.1"
                     /translation="MTRPSGQTPDRSLTDGRTDDPAPSPGASRRAGRPSGALERFYGP
                     GARLSAKTADRAVFAVFPGQDRHPAPHPHRHPARFDRNAPPPHDGRVAVGMTVQTGQG
                     GGGHDGQNGRGWRSSHQRAHVWLWVRYRSGGGPGESGAAAGPCQEIPEAVRTATGPTA
                     RHRPDPPGTPCRASQPARIHPPPPRPDIRWRPAERPLAVRWEPSSNRWLDGSQTGASG
                     PPADRQRTPSGPSSGFARLTPRHPKVLSGSPDDVDEAAGLPVR"
     gene            127422..127601
                     /locus_tag="SFLA_RS33465"
                     /old_locus_tag="Sfla_6767"
     CDS             127422..127601
                     /locus_tag="SFLA_RS33465"
                     /old_locus_tag="Sfla_6767"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014140614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014140614.1"
                     /translation="MPTSDRPLLLLLLVLVVGLVLGALAYLSYEHPALTEPLTLVLAG
                     AAVLVPCIALTVTRR"
     gene            127598..127795
                     /locus_tag="SFLA_RS34990"
                     /old_locus_tag="Sfla_6768"
     CDS             127598..127795
                     /locus_tag="SFLA_RS34990"
                     /old_locus_tag="Sfla_6768"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158485.1"
                     /translation="MSLKGRPYDGDNNSDNIPDNNSDDNGDNNGDTRKSAVLAQPQVK
                     PRFSCGEYSDFPLFSRSALLW"
     gene            128553..129395
                     /locus_tag="SFLA_RS33470"
                     /old_locus_tag="Sfla_6769"
     CDS             128553..129395
                     /locus_tag="SFLA_RS33470"
                     /old_locus_tag="Sfla_6769"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019065501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_078559931.1"
                     /translation="MTDEQWALVEPLLPPARVGPKGGRREKHPRRRIVDAIFYVVRTG
                     CAWRQLPKDFAPWPTVYWYFTWWHDDGTVERIHDALRGKVREADGRNAEPSAGLIDSQ
                     SVRTADTVPVASRGFDAGKKVKGRKRFIVTDTLGLLLAVHVVAAGVQDRDGARRPLLW
                     TRLDHPGVKKIWADQRFAGRLVDWVTQILGRELEIVRKDPDQRGFQVQPKRWAVERTF
                     SWLTAHRRLARDYEASPARSETMIRWAMIGIMVRRLTRTGPATRPGPRPLTRVSAAGH
                     ATGW"
     gene            complement(129405..129806)
                     /locus_tag="SFLA_RS33475"
                     /old_locus_tag="Sfla_6770"
     CDS             complement(129405..129806)
                     /locus_tag="SFLA_RS33475"
                     /old_locus_tag="Sfla_6770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014158487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014158487.1"
                     /translation="MVSDARVPFVGDFRELEQGSPDGPSLRSAVKAEASVSARELVKY
                     LRSGALLAATTTLVRDVLATDNPVIGGLHLLTDGHWLWYSDLAHYVEHYHAALDPQFI
                     AHAQANGWTVPQLDDADLLALEAVLLGDDTN"
CONTIG      join(CP002477.1:1..130055)
//
DBGET integrated database retrieval system