GenomeNet

Database: RefSeq
Entry: NC_016115
LinkDB: NC_016115
Original site: NC_016115 
LOCUS       NC_016115             130055 bp    DNA     linear   CON 14-MAY-2014
DEFINITION  Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete
            sequence.
ACCESSION   NC_016115
VERSION     NC_016115.1  GI:357415565
DBLINK      BioProject: PRJNA40839
            BioSample: SRS152855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Streptomyces pratensis ATCC 33331
  ORGANISM  Streptomyces pratensis ATCC 33331
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Streptomycineae; Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid2 of Streptomyces flavogriseus ATCC
            33331
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 130055)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 130055)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L.,
            Pitluck,S., Davenport,K., Detter,J.C., Han,C., Tapia,R., Land,M.,
            Hauser,L., Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I.,
            Brumm,P., Mead,D. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002477.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086230
            Source DNA available from David Mead (dmead@lucigen.com)
            Organism available from ATCC: ATCC 33331
            Contacts: David Mead (dmead@lucigen.com)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Streptomyces flavogriseus IAF 45 CD, ATCC
                                   33331
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Soil
            num_replicons       :: 3
            ref_biomaterial     :: ATCC 33331, DSM 40990
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Aerobe
            isol_growth_condt   :: 6773643
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi05916
            Type Strain         :: No
            Funding Program     :: DOE-GLBRC 2008
            Gene Calling Method :: Glimmer
            Isolation Site      :: Soil
            Isolation Comments  :: isolated by Waksman and Lechevalier
            Cell Shape          :: Filament-shaped
            Motility            :: Nonmotile
            Sporulation         :: Sporulating
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram+
            Diseases            :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..130055
                     /organism="Streptomyces pratensis ATCC 33331"
                     /mol_type="genomic DNA"
                     /strain="ATCC 33331"
                     /isolation_source="soil"
                     /culture_collection="ATCC:33331"
                     /db_xref="taxon:591167"
                     /plasmid="pSFLA02"
                     /collected_by="Waksman and Lechevalier"
     gene            459..992
                     /locus_tag="Sfla_6645"
                     /db_xref="GeneID:11372454"
     CDS             459..992
                     /locus_tag="Sfla_6645"
                     /inference="similar to AA sequence:KEGG:Avin_05530"
                     /note="KEGG: avn:Avin_05530 S-adenosylmethionine
                     synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927301.1"
                     /db_xref="GI:357415566"
                     /db_xref="GeneID:11372454"
                     /translation="MLPARVLAAAPSLLAVLALSGCSSLWLCTDTMAERGEAGVRVQV
                     QDTSGQPLGVTAEVVDWRIGPHPQVPSEGDRVHFRYRFDDADERSGPVVDACAVDKER
                     MVLVCQTISPSEARPEAGGDLTGDSWLDVEHPEHVAEVLLIPNDQSHAGGATCETDIK
                     DGGGTHPPESPGVGDQL"
     sig_peptide     459..542
                     /locus_tag="Sfla_6645"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.957) with cleavage site probability 0.739 at
                     residue 28"
     gene            1074..1361
                     /locus_tag="Sfla_6646"
                     /db_xref="GeneID:11372444"
     CDS             1074..1361
                     /locus_tag="Sfla_6646"
                     /inference="similar to AA sequence:KEGG:Namu_1787"
                     /note="KEGG: nml:Namu_1787 siderophore-interacting
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927302.1"
                     /db_xref="GI:357415567"
                     /db_xref="GeneID:11372444"
                     /translation="MIVSCASFTWCAGAGRSTVARWYAPRHEQPPERRHPERVVTIDR
                     VDYYDQAEVEAFWAAHQETVGTALLGVSGRRSGAGHGEKPRGGRPVSAERA"
     misc_feature    1209..>1355
                     /locus_tag="Sfla_6646"
                     /note="hypothetical protein; Provisional; Region:
                     PRK12839"
                     /db_xref="CDD:237223"
     gene            complement(2795..3424)
                     /locus_tag="Sfla_6647"
                     /pseudo
                     /db_xref="GeneID:11372445"
     gene            3423..4294
                     /locus_tag="Sfla_6648"
                     /pseudo
                     /db_xref="GeneID:11372446"
     gene            4450..6318
                     /locus_tag="Sfla_6649"
                     /db_xref="GeneID:11372447"
     CDS             4450..6318
                     /locus_tag="Sfla_6649"
                     /inference="similar to AA sequence:KEGG:nfa13900"
                     /note="KEGG: nfa:nfa13900 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927303.1"
                     /db_xref="GI:357415568"
                     /db_xref="GeneID:11372447"
                     /translation="MHLNSFNVSGFRSLTEVSDIPVRKPTILAGHNDGGKSALLDALA
                     FLLGKHALAEDDRTYLTIDGDEVSAPLRCEESIVEGVFTLDAWEQEQFDLPERIRLRR
                     CCGEDLISRLEVWQPIPADERLRDLSQHLVPALKELVKEFGLSPGSMRKPDLEQALRR
                     YGRDHAGSDGWVAAPTALDKRMPRYLPFDGKVAKPDEAVKTVLVGRFQSYMADPDLKG
                     RLSAIEDEVQDRLRIDAKSLCEHIEMRCPDLQKVSVDPDVSFQQGFKAAPLRVARRAG
                     EVVGLDRTGLGSNRRISLAIWEWTSELLAEEQGTAPAMSTCDEAPEPPPVQTIVVYDE
                     PDTHLDYIHQRKIMQLIRTQSKIPNVSVLVATHSMNLIDGVDISDVVHLKLEDHRTVV
                     ERLGTGLLHDAIDEHLGKIAATVGLRNSVLLHERCFLAVEGETEQRAFPLLFRLCEGL
                     SLQAAGIALWACFNNEGALHLARYLVKQGRTIMLVVDADSRNVSKGIFKTPKLTQFFG
                     TESRRYVTFLGEPDDAQQEKYNELEELFEDDVWARIANKVWARAGTPWQPADFTALRG
                     QGKFSGAVQEMLQEQSESGPGGKPDMMYELSMALDDPDDVPEQLRRVFERLRELAS"
     misc_feature    <5434..5562
                     /locus_tag="Sfla_6649"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    5434..5451
                     /locus_tag="Sfla_6649"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    5458..5469
                     /locus_tag="Sfla_6649"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    5536..5556
                     /locus_tag="Sfla_6649"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(6299..7078)
                     /locus_tag="Sfla_6650"
                     /db_xref="GeneID:11372448"
     CDS             complement(6299..7078)
                     /locus_tag="Sfla_6650"
                     /inference="similar to AA sequence:KEGG:Caci_2985"
                     /note="KEGG: cai:Caci_2985 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927304.1"
                     /db_xref="GI:357415569"
                     /db_xref="GeneID:11372448"
                     /translation="MATVDGPEPYGRPENSTPFATAPSRSHTSPPQARRNHIMYGCWK
                     AETPPSGPTHDLPPGHRVRRHHRAGLRTGDRRVCLGDRYFTLFSSPNSRRRAVVPNAG
                     APRSGPAAPRRDRAACSSRSLPCPDRPAHMGRCLERLLQTCRRVDGPRLLAGCHVDAV
                     GGWGGGVMSVVAGRMWSGEGVAMSTEGSDLRIPAPSGCRWCGIDEREHMQRWKPPAGW
                     HEWAPPTLEQRKERMQARRRQRPSGAGGGQATQGRLRTLAP"
     gene            complement(7173..7436)
                     /locus_tag="Sfla_6651"
                     /db_xref="GeneID:11372449"
     CDS             complement(7173..7436)
                     /locus_tag="Sfla_6651"
                     /inference="similar to AA sequence:KEGG:Krad_0489"
                     /note="KEGG: kra:Krad_0489 dTMP kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="dTMP kinase"
                     /protein_id="YP_004927305.1"
                     /db_xref="GI:357415570"
                     /db_xref="GeneID:11372449"
                     /translation="MGDMTIPFLPPLSALGAIQRVLLVTLLTPAVLLALTAAVPALIV
                     LPFLPGGTDRAIALLTAHTAYLTALLTGSRTLPPNTARRPRGS"
     gene            complement(7475..9160)
                     /locus_tag="Sfla_6652"
                     /db_xref="GeneID:11372450"
     CDS             complement(7475..9160)
                     /locus_tag="Sfla_6652"
                     /inference="similar to AA sequence:KEGG:Krad_4518"
                     /note="KEGG: kra:Krad_4518 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927306.1"
                     /db_xref="GI:357415571"
                     /db_xref="GeneID:11372450"
                     /translation="MPTYVETNVWLPACALAAVKAIAVRGGLSRDETVRQLLDEHLEA
                     QEHREPDMRLTHISTVLRYPPALGRQKHRWVPEFGGPLRLRLHPGVADRARTVSLRLP
                     GQFQRAHRDYQSRQLTDAVMTAIAVHEPFTDTYLDGLQPVLRHRAARGLWGLAVAATS
                     TAPELAVHEAVSRAEFPDKDESATGASAGGPGASSRPQQTGASSRLLRVAAALEGETG
                     WHSAVRFWVAANIARLLLTGPGRDAAERMLFEQGEQWRELRLDYRYANAATREELRRG
                     IGDWDDSGRGGGAVWRAERAVEVEDFEVWLVARGRAAERMNLPPGWLVRTPPTWRVSA
                     VGGHGAALREPYAGWVVAGRLLVFTSGGTPGVWPLTRGNGGRMRPVEGIEPVVAAAAG
                     LAPAQASTFIEAMLLDWSDDGEADLMRVPAVLRLPASQAYNFGYIDAAQRSSLMAQAR
                     VATLESMNHVLNHLHDDFYRARLEAARDSGSVRDFRRLARWARVHFSPSPATWPWPGG
                     PVAHEVVAGTRPEIVHWLATHAHRTTATLLQHSMGEAWNAAFDHRPPSFWTDM"
     gene            9409..9579
                     /locus_tag="Sfla_6653"
                     /pseudo
                     /db_xref="GeneID:11372451"
     gene            9701..10624
                     /locus_tag="Sfla_6654"
                     /db_xref="GeneID:11372452"
     CDS             9701..10624
                     /locus_tag="Sfla_6654"
                     /inference="similar to AA sequence:KEGG:JTY_3207"
                     /note="KEGG: mbt:JTY_3207 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927307.1"
                     /db_xref="GI:357415572"
                     /db_xref="GeneID:11372452"
                     /translation="MATDLISGTTRAHMREISAQLGPSRLRPCWDGSGFTPGPAKDTS
                     GGGGKNLFSSYVDHIGWSDPGQVSRALGVFESMLRVYRTVVESSYGTEDETPQQRWAA
                     KLEEARREFEYDGYQITDRLRIFGSGEGRPDHEMADAQLYAEALSLLRHARNQMERLP
                     STTRGKSEPEIRDVLLVALGAAFAGRCTAESLNGKGKTDLLLRIGDRNVLVGECKIWG
                     GSTDFREEDIPQLLGYLTRYDRHAVIPLFIRKARPEEIVAKAVKELAEHPRCVSAAVP
                     DHEGRQYTFVFRSLSATPWDVEVALIPFVIE"
     gene            10641..10829
                     /locus_tag="Sfla_6655"
                     /db_xref="GeneID:11372453"
     CDS             10641..10829
                     /locus_tag="Sfla_6655"
                     /inference="similar to AA sequence:KEGG:RHA1_ro03305"
                     /note="KEGG: rha:RHA1_ro03305 pyruvate dehydrogenase E1
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 component"
                     /protein_id="YP_004927308.1"
                     /db_xref="GI:357415573"
                     /db_xref="GeneID:11372453"
                     /translation="MPTRGAHSTIGRGWELSNDAVTRPEHLRDVSPQVSVQTDVSAFA
                     NEVDDLEFVWGPRIRLNW"
     gene            complement(10969..12177)
                     /locus_tag="Sfla_6656"
                     /db_xref="GeneID:11372443"
     CDS             complement(10969..12177)
                     /locus_tag="Sfla_6656"
                     /inference="similar to AA sequence:KEGG:PSEEN5052"
                     /note="KEGG: pen:PSEEN5052 type IV pili methyl-accepting
                     chemotaxis transducer PilJ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927309.1"
                     /db_xref="GI:357415574"
                     /db_xref="GeneID:11372443"
                     /translation="MQDSAVVGTRRSRIADFLRQLDPDVRMALHFDDAAVIGADLLIS
                     MCRALLDTGSDQPWQDRLESTLEEFDLSDVETGLDSILEKFQNTDMAISWLTSFKGVN
                     YNAFALRLLGARDFKRLVDVVKEDGAIVALAVRRALRGAMPFAVAWSDAISNMTENQR
                     KAVSKADILGLDLVQIVIMVDEAFGTKFISTLPMELTTATTDDLVGWRPDDMTEIVST
                     IRHRVAESSAKRLERENSQLVRKIRGAKDALAHSEDGISQAANSLIELIDRILRNAFT
                     KEQVMAWVVANLPNEPGLTYPDERGVDQPNKRAEILCFVYRGGPTAREAHEYDNGQGP
                     SLIHDVLARVIVATRTSLQGFKHGDAGTQEEKEQLLSLLAGLEGALLLGLSISQIGIK
                     EGELPNNLEA"
     gene            complement(12328..12567)
                     /locus_tag="Sfla_6657"
                     /db_xref="GeneID:11372329"
     CDS             complement(12328..12567)
                     /locus_tag="Sfla_6657"
                     /inference="similar to AA sequence:KEGG:SCO0558"
                     /note="KEGG: sco:SCO0558 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927310.1"
                     /db_xref="GI:357415575"
                     /db_xref="GeneID:11372329"
                     /translation="MRSRCTAGATPTTTAPAGCRAALVGGPLHVLLLDITGGAADELQ
                     TGVALMTGLGQSGGRAPYDLRPGGRNRRAQFGDTS"
     sig_peptide     complement(12502..12567)
                     /locus_tag="Sfla_6657"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.929) with cleavage site probability 0.813 at
                     residue 22"
     gene            complement(12671..13510)
                     /locus_tag="Sfla_6658"
                     /db_xref="GeneID:11372425"
     CDS             complement(12671..13510)
                     /locus_tag="Sfla_6658"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: stp:Strop_4179 transposase, IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004927311.1"
                     /db_xref="GI:357415576"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11372425"
                     /translation="MTERRRYPSDLSDARWELVEPVLTAWRAERRGRGLDIGRPPNHD
                     LRSLLDAVLYVNRTGIPWRYLPHDYPHWNTVYAYFARWQEEGVFDQLNSLLRRQVRRQ
                     EGRDDEPTACVIDSQSIKTSTNVPATGQGIDAGKKIVGRKRSIVIDTVGLLLGVLVTA
                     ASVQDSTAGRTLIERIAAEHPTIRKTWVDGGYRQHLVEHAATLGIDMHIVRRDTATRG
                     FTVLPRRWTVERTLGWLMNHRRLARDYEAHPHRSEAMIHVAMINLMTRRLSAESTPTW
                     RGA"
     misc_feature    complement(<13196..13495)
                     /locus_tag="Sfla_6658"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(13235..13480)
                     /locus_tag="Sfla_6658"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    complement(12719..13195)
                     /locus_tag="Sfla_6658"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(12713..12952)
                     /locus_tag="Sfla_6658"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            13793..14646
                     /locus_tag="Sfla_6659"
                     /pseudo
                     /db_xref="GeneID:11372426"
     gene            complement(14669..15073)
                     /locus_tag="Sfla_6660"
                     /db_xref="GeneID:11372330"
     CDS             complement(14669..15073)
                     /locus_tag="Sfla_6660"
                     /inference="similar to AA sequence:KEGG:SGR_6667"
                     /note="manually curated;
                     KEGG: sgr:SGR_6667 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927312.1"
                     /db_xref="GI:357415577"
                     /db_xref="GeneID:11372330"
                     /translation="MISDNFPIGGSFRELEYGSPDGPSIRTAVRLAAPKHEGDLVQYL
                     HAGSTLVATPSAAPDVLSESGAIIGGLHLLTDGHWLWYSDLAHYVRRYHVELDPAFIE
                     HARGNNWSAPQISDERLEAMVTLLIGDEKEPD"
     gene            complement(15120..15569)
                     /locus_tag="Sfla_6661"
                     /pseudo
                     /db_xref="GeneID:11372331"
     gene            15854..18530
                     /locus_tag="Sfla_6662"
                     /pseudo
                     /db_xref="GeneID:11372332"
     gene            18764..20188
                     /locus_tag="Sfla_6663"
                     /db_xref="GeneID:11372333"
     CDS             18764..20188
                     /locus_tag="Sfla_6663"
                     /inference="protein motif:PFAM:PF06054"
                     /note="PFAM: Competence CoiA family protein;
                     KEGG: sma:SAV_344 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Competence CoiA family protein"
                     /protein_id="YP_004927313.1"
                     /db_xref="GI:357415578"
                     /db_xref="InterPro:IPR010330"
                     /db_xref="GeneID:11372333"
                     /translation="MPFTALHAGLGRLDATLPDLGHQLDWAQVYKARPRPPLVCPQCE
                     WGLHAKVSRYGVRFFCHDPGRPPSCELSNESWEHHMLKLELAGAIREAGWFAELEVPA
                     ADGSWRADVMASSVDGTQRMAWEAQLSAITDEDIEYRTERYRAEGIRVCWVSPHKKPP
                     QWISVVPAVRVRSPEGRGQSWVVDDGLAGFDFTAGGWAFREEQLQRFVRWVLGGQVVS
                     VESYPRYRRVPRVVDGKRLRFRRGRWWTSLQSADAQTRHESMRRRQEAAKEEREARQR
                     KREEAAERRRKELEEKERIQRAQEAERRAKKAAEESRIRMEVWEREWAEEKARREREK
                     AEKAQRLAREEAEREERERQALEAATVWWGRLSTQQKEELLAAVTERAWREEKLWVTV
                     PENPLMDPAYAYGVPLYTQGKRRRSLYGIVRPCPELLAASPRAREEHALVRNTQEATE
                     LQEAGCEGRITHFDLPEHEQLSMY"
     misc_feature    18860..>19222
                     /locus_tag="Sfla_6663"
                     /note="Competence protein CoiA-like family; Region: CoiA;
                     cl11541"
                     /db_xref="CDD:264414"
     misc_feature    19517..>19711
                     /locus_tag="Sfla_6663"
                     /note="Synaphin protein; Region: Synaphin; pfam05835"
                     /db_xref="CDD:253412"
     gene            complement(20195..21016)
                     /locus_tag="Sfla_6664"
                     /db_xref="GeneID:11372427"
     CDS             complement(20195..21016)
                     /locus_tag="Sfla_6664"
                     /inference="similar to AA sequence:KEGG:APE_1708"
                     /note="KEGG: ape:APE_1708 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927314.1"
                     /db_xref="GI:357415579"
                     /db_xref="GeneID:11372427"
                     /translation="MPKKKRRPRHPAHLAHTPTTRRVSEPDQEREYVDEFQPLLDRYP
                     TVQDAVQAAEAGESVEWTGSIGGLPMRHRVVLAPEQLMVEQAILAGWPLDYMIRCAWF
                     QCDAHVDTEKAVLKTLDELHELTRPLLEEQVRAVRPDYEAVVLSAFAEPSDRGVPIFG
                     WRARYPVIEGLTWQSTRDTAAWNLSGCFDAIDPIVDIPELGRPAIAARLSCNGAPLMV
                     CKGCDLPLTDRHPRWTRVWVGPDGPRCEEPAVSDDGAQAGWDEEDFGYPHRPRPA"
     gene            complement(21181..22005)
                     /locus_tag="Sfla_6665"
                     /db_xref="GeneID:11372334"
     CDS             complement(21181..22005)
                     /locus_tag="Sfla_6665"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: sco:SCP1.209c hypothetical protein;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004927315.1"
                     /db_xref="GI:357415580"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11372334"
                     /translation="MPDRRGRPMAPIGDPNHGVGRLARALRDGRSRRGLSRRQLAVEI
                     DRSVTTIQRAEAGDVRPTLLVSQQIADACGIDHDEIEALWRKAARLGRGHRVTDAPRL
                     KLVRTSADLAAALRRVWEENGEPSSRHMEERAEARAREFAPLSRMSAWRIRERKQPVT
                     SVRQLYAYLIACEVPEGTFPAWAKAWQRAKRDDRWTPKIVPAPHPSHPRRRVTPSEAV
                     DFMIRSGLRPIDPYPGHAAPWTAQCMACSSISRVRYSKVKTGAGGCRVCRRNQMAA"
     misc_feature    complement(21757..21945)
                     /locus_tag="Sfla_6665"
                     /note="Helix-turn-helix domain; Region: HTH_31; pfam13560"
                     /db_xref="CDD:257877"
     gene            complement(22019..22276)
                     /locus_tag="Sfla_6666"
                     /db_xref="GeneID:11372335"
     CDS             complement(22019..22276)
                     /locus_tag="Sfla_6666"
                     /inference="similar to AA sequence:KEGG:MAB_1627"
                     /note="KEGG: mab:MAB_1627 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927316.1"
                     /db_xref="GI:357415581"
                     /db_xref="GeneID:11372335"
                     /translation="MSSPQSVSACVTGTRRRLGLGESAVIIVIIVMTALLITRGTPLT
                     EAATILGSSGLLAVLVTRYAQAGPRTAVMRRVGALLFPAQA"
     gene            complement(23389..24204)
                     /locus_tag="Sfla_6667"
                     /db_xref="GeneID:11372336"
     CDS             complement(23389..24204)
                     /locus_tag="Sfla_6667"
                     /inference="similar to AA sequence:KEGG:Krad_4657"
                     /note="KEGG: kra:Krad_4657 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927317.1"
                     /db_xref="GI:357415582"
                     /db_xref="GeneID:11372336"
                     /translation="MLCMGEALSLADIMENNPVDQVGEHLLAAAATLLYQQGDTEAAI
                     TATDVLAVDMSLWNSDEYEPDEYRMYFTVEPQLVDQFTDQVVARIVDGIHAVMPRRGC
                     AVRIESIEVCPVVPVPSMDWRKQLRTANGPTPTNQARKVRLEPRDQHPIQDDLHFTNE
                     WEHGLYQVLKARQATLPDNETIGIMPLGKMRLLGSTREPDFLITYKGRAGVIEVDGPH
                     HGKPGRASSDHSRDNLMIHAGVEWVSRLDVQDVGTKAEVEKFVDNFLARLVRQ"
     gene            24465..25289
                     /locus_tag="Sfla_6668"
                     /db_xref="GeneID:11372337"
     CDS             24465..25289
                     /locus_tag="Sfla_6668"
                     /inference="protein motif:SMART:SM00670"
                     /note="SMART: Nucleotide binding protein PINc;
                     KEGG: cai:Caci_8618 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotide binding protein PINc"
                     /protein_id="YP_004927318.1"
                     /db_xref="GI:357415583"
                     /db_xref="InterPro:IPR006596"
                     /db_xref="GeneID:11372337"
                     /translation="MMVTPIPGARLELVLQLLREAHTKAQNLGNFTSAEECLLNYLTW
                     TTEQARLLGSHVRAKDVEVLFFTPVYWALLNGAGHMEGRLVPKVSIGLVNQEVRQRTE
                     DLDLAVSSIRDAVRRWRGDVSTLVLDTSFFIEHEDKLEDADLFTLADFEGLVRVAVPM
                     TVVDEMDRLKEARVSGHARWRARYGLAVLDRLLTGPAKLGSVEVEVLPDPSGHVRLPD
                     EDDEIVDRALALGTMAAGPVTLVTYDTGMALRAKIAGVPCLKLPKELGPEPERPKD"
     misc_feature    24837..25238
                     /locus_tag="Sfla_6668"
                     /note="PIN domain; Region: PIN_4; pfam13638"
                     /db_xref="CDD:257948"
     misc_feature    order(24846..24848,25122..25124,25194..25196)
                     /locus_tag="Sfla_6668"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     gene            25733..26180
                     /locus_tag="Sfla_6669"
                     /pseudo
                     /db_xref="GeneID:11372338"
     gene            complement(26337..27185)
                     /locus_tag="Sfla_6670"
                     /db_xref="GeneID:11372428"
     CDS             complement(26337..27185)
                     /locus_tag="Sfla_6670"
                     /inference="similar to AA sequence:KEGG:Micau_6014"
                     /note="KEGG: mau:Micau_6014 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927319.1"
                     /db_xref="GI:357415584"
                     /db_xref="GeneID:11372428"
                     /translation="MARVPENVDAQQLHVAARRVLLDGLTALSDQLDALTVVGAQAVY
                     LRTPEAALRTSFTSDGDISIDPDRLQNVPLLDQALLEAGFELLRDNQPGLWARTQRIG
                     GQEVPIEFDLLMAKGLAPKIGSRSVKIPPHGVMSARWVPGLEVAAVDRSPMTITSLEA
                     ADARTIIVNVAGPAALLVAKAFKINDRLKQADARPERLTHKDAGDVLRIIRAIPVAQV
                     TASFAKLREDPRVGEITQEGLQLLQDLFGGPTTPGVGMAVQALSGDLPEATVRALAPA
                     YVSRLM"
     gene            complement(27230..28381)
                     /locus_tag="Sfla_6671"
                     /db_xref="GeneID:11372339"
     CDS             complement(27230..28381)
                     /locus_tag="Sfla_6671"
                     /inference="similar to AA sequence:KEGG:Amir_7067"
                     /note="KEGG: ami:Amir_7067 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927320.1"
                     /db_xref="GI:357415585"
                     /db_xref="GeneID:11372339"
                     /translation="MDSKSDEEVGSPGRLFDAALERLRGLFGEGWAVEAVPGFQQDPS
                     DWYSDRMIEIRSADMGHTARYVVDLKSSLTPRTVDTELLSKLRLVRQVNSFTSLLVMA
                     PWMSPKTQDLLRIHGISYVDLTGNIWIRADRPAIFIYTEGQSRAPRSASQPSSAVTLS
                     GSKVDRLVRILADVRPPYRASDLAAATKLSLAYVSRLLGTLEDQLLIQREGRTIHSVN
                     WQGLLRARAEHSNLLNLNPYSGFIAPNGVDYLLRQMRDDDFTSRRLFAITGSYAAREV
                     APLSVGGQLMIYIRPDHFSDELVDHLGLLEVKQQADVLFLDAHDPVVFKQSRIVGGLP
                     HVALSQLALDCLSGPGRLPAEGEAVLERMSAHEQWRNLDIHTIKEWWAA"
     misc_feature    complement(<27779..28234)
                     /locus_tag="Sfla_6671"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2186); Region: DUF2186; cl19875"
                     /db_xref="CDD:268228"
     gene            complement(28769..29737)
                     /locus_tag="Sfla_6672"
                     /db_xref="GeneID:11372429"
     CDS             complement(28769..29737)
                     /locus_tag="Sfla_6672"
                     /inference="protein motif:PFAM:PF00239"
                     /note="KEGG: sro:Sros_4727 site-specific recombinase DNA
                     invertase Pin;
                     PFAM: Resolvase domain;
                     SMART: Resolvase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Resolvase domain protein"
                     /protein_id="YP_004927321.1"
                     /db_xref="GI:357415586"
                     /db_xref="GO:0000150"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="GeneID:11372429"
                     /translation="MTVPQEASPSDADNVERHPCPRCTAEPGSPCRSRSGAVAGTYHT
                     GRFTKVPRLAKLLRVPTPADRGPGQPWRPGTPVPLALAPDTPTADIRIGYARCSTLTQ
                     ELQSQLDALAKHGIDRDKVFSEKISTRVRVRPQFEAALTLARQIKAHAPHCRVIFTVY
                     EMKRLGRDAAELTALADHLTAHGLVLEMLAGPLPGMYDPSGPGRLLFAFFAAMAETER
                     ENIRESTLEGLDAAARKGKHGGRPPVITDDMLHTVLRRRTNGESVEQIQPDLIIPTGK
                     RKGQAPSVASIYRALAEHEKQQAYPEAVEQAHADFVNLQPRDRGPA"
     misc_feature    complement(29054..29467)
                     /locus_tag="Sfla_6672"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(<28937..29464)
                     /locus_tag="Sfla_6672"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(order(29237..29239,29246..29251,29444..29446,
                     29450..29452))
                     /locus_tag="Sfla_6672"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(29444..29446)
                     /locus_tag="Sfla_6672"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29087..29089,29099..29104,29108..29113,
                     29252..29254))
                     /locus_tag="Sfla_6672"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29081..29083,29090..29092,29099..29104,
                     29111..29116,29123..29125,29216..29221,29234..29236))
                     /locus_tag="Sfla_6672"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29066..29068,29078..29080,29087..29089,
                     29099..29101,29108..29113,29120..29125,29150..29158))
                     /locus_tag="Sfla_6672"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29066..29068,29078..29080,29087..29089,
                     29099..29101,29108..29110,29156..29158))
                     /locus_tag="Sfla_6672"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29063..29068,29084..29086))
                     /locus_tag="Sfla_6672"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            29961..31043
                     /locus_tag="Sfla_6673"
                     /db_xref="GeneID:11372430"
     CDS             29961..31043
                     /locus_tag="Sfla_6673"
                     /inference="similar to AA sequence:KEGG:SAV_818"
                     /note="KEGG: sma:SAV_818 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927322.1"
                     /db_xref="GI:357415587"
                     /db_xref="GeneID:11372430"
                     /translation="MLDRDLLRASRLAGYGIVSTQLSLLSDHRLGEVVAAATPLGSGI
                     GGRSAELDVNGTRVFVKRIPLTDIELRPENVRSTANIFELPMFYQYGVGSAGFGAWRE
                     LAVHTMTTNWVLGDEYAGFPLMYHWRVLPDSPPEGFTDEFGGLEGAVAHWEGSPAVRD
                     RLEAIGQSSCSLVVFLEHVPHTLAGWLADHRKPAVSEGGDGSPFRWVEKALMDGADFM
                     SSRGLVHFDAHFANILTDGRQLYFADFGLALSSRFDLSSGESSFLSDHLAYDRCYTAS
                     HLLQYHLLDGVRGDTERKAFLHDWIAGRRPGDVPPAITAIIDRHARPTVVVDSFFHRL
                     FTESKQTPFPATEIEQQLRTGTTTPS"
     misc_feature    30441..>30785
                     /locus_tag="Sfla_6673"
                     /note="Serine/threonine protein kinase [General function
                     prediction only / Signal transduction mechanisms /
                     Transcription / DNA replication, recombination, and
                     repair]; Region: SPS1; COG0515"
                     /db_xref="CDD:223589"
     misc_feature    <30480..>30704
                     /locus_tag="Sfla_6673"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    order(30483..30485,30489..30497,30504..30506,30510..30512,
                     30639..30641,30645..30647,30651..30656,30660..30662,
                     30690..30692,30699..30701)
                     /locus_tag="Sfla_6673"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(30483..30485,30489..30497,30504..30506,30639..30641,
                     30645..30647,30651..30656,30660..30662,30690..30692)
                     /locus_tag="Sfla_6673"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(30504..30506,30510..30512,30639..30641,30645..30647,
                     30651..30653,30699..30701)
                     /locus_tag="Sfla_6673"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    30687..30704
                     /locus_tag="Sfla_6673"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(31244..38650)
                     /locus_tag="Sfla_6674"
                     /pseudo
                     /db_xref="GeneID:11372340"
     gene            31723..32796
                     /locus_tag="Sfla_6675"
                     /db_xref="GeneID:11372341"
     CDS             31723..32796
                     /locus_tag="Sfla_6675"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein; integrase domain
                     protein SAM domain protein;
                     KEGG: rop:ROP_pROB01-04990 putative transposase for
                     insertion sequence element"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004927323.1"
                     /db_xref="GI:357415588"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="GeneID:11372341"
                     /translation="MGTVLLDEKWPVLGRHEQAAGWLQVWSDLGRAPRTIDAYARGLA
                     EYLEMCERENVDPLTANRAHIAVYVRELTSRPSRRGANVVSIDSGSGLANATIQQRLV
                     PVRLFYDFLMEDGQRDSNPVGRGRYTPGRRHRGGHERGLVPRLTKMPWIPAEQQWLDI
                     LAVAAAEPVRNRVMLALAYDAALRREELCSLRTDDLDPAHRTLRVRAETTKNRLERVV
                     PYSAPTGVLLSGYLAHRATVSRARGPLFLSESRRNHAQPLSLWTWSKVVRRIALAADV
                     PRFSTHTTRHLCLTDLARMGWELHAIATFAGHRHTDSTLTYIHLSGRDLADKLSRGME
                     QIHGWRVQMLARLGEQATGTVAL"
     misc_feature    31798..32703
                     /locus_tag="Sfla_6675"
                     /note="Site-specific recombinase XerD [DNA replication,
                     recombination, and repair]; Region: XerD; COG4974"
                     /db_xref="CDD:227308"
     misc_feature    31798..32067
                     /locus_tag="Sfla_6675"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_1; cl12235"
                     /db_xref="CDD:245915"
     misc_feature    32200..32679
                     /locus_tag="Sfla_6675"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(32272..32277,32353..32355,32563..32568,32671..32673)
                     /locus_tag="Sfla_6675"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(32272..32274,32353..32355,32566..32568,32575..32577,
                     32644..32646,32671..32673)
                     /locus_tag="Sfla_6675"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(32272..32274,32566..32568,32575..32577,32644..32646,
                     32671..32673)
                     /locus_tag="Sfla_6675"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(32272..32274,32575..32577,32671..32673)
                     /locus_tag="Sfla_6675"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            32793..35156
                     /locus_tag="Sfla_6676"
                     /db_xref="GeneID:11372342"
     CDS             32793..35156
                     /locus_tag="Sfla_6676"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein;
                     KEGG: rop:ROP_pROB01-05000 putative transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004927324.1"
                     /db_xref="GI:357415589"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:11372342"
                     /translation="MTAAISAAASETAATPSWPWPIDLARYDRRPALTERERAALTSL
                     GWEVRRRRGYAPDRVEWPAISRLLRPLDDARAALRWCPDTPSHRRAVTDAIGLVLRRC
                     LEDGTSLWAWSADDWVRLIAPGHKEFEAAWPGWIDGSVRPYVAAFAYLLGDFTDFHRI
                     GGFIRRSLAWRVFGQEPVEETIAQVAATLQGWGYHPSNGAFGQFRTVLVQIMLINRSP
                     LLQDMTTDALQRARESPALPSGARRGNLHGVHRAIAALGHAGPPPKPIHAVMPDLEGV
                     PEPWAAMVERWHDTSTLTPKVRGGFRSIVAKAGRWLAAEHPEIVEPGQWTRETCAAWV
                     AALDRMTVGEHVQRRAGLDKRGGKPLSPRTKAGYLTATRTFFRDCQEWEWIPRRFDPV
                     RALATPRSVAALIGPNPRVIADDIWAKLLWAGLNVDPEDFPTNTYGLCYPIELIRAVT
                     LTWLFGGLRSDEISRLRTGCIRWQHDGFPIPGDSDEVLARDAVCLLDVPTHKTGTSFT
                     KPIDPLLGKAIEAWQDARPQQPKMLDRKTGEQVDFLFAHRAKRLANTYINTAVIPSLC
                     RKAGVPTADVRGNITSHRARSTIASQLYNAKEPMTLFELQAWLGHRSPESTQHYAKIT
                     PNTLARAYNDAGYFERNVRTIEVLVDRDAVTSGAAASGEPWQYYDLGHGFCTYTFFEQ
                     CPHRMACARCDFYTPKATSKGQLLEAKDNLQRMLASVPLSDEERAAVDDGQAALDQLL
                     ERLVDVPTPAGATPREIGAPATATLLPIVAVNQGASAECRPAMRAPR"
     misc_feature    34128..34658
                     /locus_tag="Sfla_6676"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(34167..34172,34296..34298,34536..34541,34650..34652)
                     /locus_tag="Sfla_6676"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(34167..34169,34296..34298,34539..34541,34548..34550,
                     34623..34625,34650..34652)
                     /locus_tag="Sfla_6676"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(34167..34169,34539..34541,34548..34550,34623..34625,
                     34650..34652)
                     /locus_tag="Sfla_6676"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(34167..34169,34548..34550,34650..34652)
                     /locus_tag="Sfla_6676"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(35137..35859)
                     /locus_tag="Sfla_6677"
                     /db_xref="GeneID:11372343"
     CDS             complement(35137..35859)
                     /locus_tag="Sfla_6677"
                     /inference="similar to AA sequence:KEGG:Krad_3402"
                     /note="KEGG: kra:Krad_3402 GCN5-related
                     N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="YP_004927325.1"
                     /db_xref="GI:357415590"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:11372343"
                     /translation="MSIDPLLARARGLWEELASVPVSFASTGGVRVVVSPESRMCPSG
                     WVGVVVLGNSAIVTAPSQDTAKTVRDALAKLPVGALAGAHSVRGVLPVARVLGPAALA
                     YVSDNGFRPVADRRLTVQLVPGEHPDLRELENLAGADDSDEAGLNEITSPAFVIRERG
                     QIVAAAGYRSWPSRTAHVSVLTAPAWQGRGLARATGSGAVAHALTAGLLPQWRARVPA
                     SRRVALALGFRELGAQLSVELA"
     misc_feature    complement(35164..>35430)
                     /locus_tag="Sfla_6677"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            39341..39793
                     /locus_tag="Sfla_6678"
                     /db_xref="GeneID:11372344"
     CDS             39341..39793
                     /locus_tag="Sfla_6678"
                     /inference="similar to AA sequence:KEGG:SRU_0609"
                     /note="KEGG: sru:SRU_0609 IS5 family transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927326.1"
                     /db_xref="GI:357415591"
                     /db_xref="GeneID:11372344"
                     /translation="MDQEAMRSAVVGALSDVEAVKEKLTGLLAEIDGTASSVSIPRQG
                     LWTKEQVGLLWGRASHLTGVHALFQTTAEQAGTTVTFTSLIERSGLDERQQRNEHARL
                     SRLASELFGEKRWPIENWQGGYNTHSGKSEMLYRMDPQIAEWWLTLVD"
     gene            complement(39966..40754)
                     /locus_tag="Sfla_6679"
                     /db_xref="GeneID:11372345"
     CDS             complement(39966..40754)
                     /locus_tag="Sfla_6679"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11;
                     KEGG: amd:AMED_3698 SAM-dependent methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="YP_004927327.1"
                     /db_xref="GI:357415592"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:11372345"
                     /translation="MAGYGALSDVYEWLIGDDKLTPAKAAAVYYSDVVGSLLPNARVL
                     DCACGTGQLAVGLASLGLDVVAADASSGMVRRTEKAADEQDVSLRALRASWDELPDHL
                     ADSTFDLVFCVGNSLGHAEGSVGRLTALEAMSRLLNPGGRLVLHSRNWELVRSAGSRV
                     DVRDRLIRRNDREAVVSYYWQIEQRWEQEHFLEIVVAQIEPDGAVQACSERLSIWPYR
                     YVDLVAQLRSVGLTVQSTTFDPESDEYLVVASRDQVRGKSEPTR"
     misc_feature    complement(40317..40631)
                     /locus_tag="Sfla_6679"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(40416..40418,40470..40478,40548..40553,
                     40599..40619))
                     /locus_tag="Sfla_6679"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(41258..41659)
                     /locus_tag="Sfla_6680"
                     /db_xref="GeneID:11372431"
     CDS             complement(41258..41659)
                     /locus_tag="Sfla_6680"
                     /inference="similar to AA sequence:KEGG:SCP1.197"
                     /note="KEGG: sco:SCP1.197 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927328.1"
                     /db_xref="GI:357415593"
                     /db_xref="GeneID:11372431"
                     /translation="MSSLITEDEISHEIELVWLEETTDLDYVRQSLDRLPTRRGKPPY
                     HRDGRMIGYALLGPKAKASRSSGTFRRRVFWLLPHDRDTQPEGLYATGAPAEAVDPRT
                     LAAGTKGYKTERSEGGPPSTAMQELGITLPL"
     gene            complement(41656..43185)
                     /locus_tag="Sfla_6681"
                     /db_xref="GeneID:11372346"
     CDS             complement(41656..43185)
                     /locus_tag="Sfla_6681"
                     /inference="protein motif:TFAM:TIGR01613"
                     /note="TIGRFAM: phage/plasmid primase, P4 family;
                     PFAM: primase P4;
                     KEGG: sco:SCP1.196 putative DNA primase/helicase;
                     SMART: primase P4"
                     /codon_start=1
                     /transl_table=11
                     /product="phage/plasmid primase, P4 family"
                     /protein_id="YP_004927329.1"
                     /db_xref="GI:357415594"
                     /db_xref="InterPro:IPR006500"
                     /db_xref="InterPro:IPR014015"
                     /db_xref="InterPro:IPR014818"
                     /db_xref="GeneID:11372346"
                     /translation="MTSPGNDNMLFHFDPQLVAAQIREQATLPLPAQALAPPATAAAG
                     EATQHGLLPDTLTDRGNAKLFVKLYANDYRHVPGMGWYRWDTTRWQIDEDDTVVWAAG
                     DLAESIASSDPRGLYTTQALQQHRRRALSTTGMNAMLTQAKSAPGMVLNAARLDADAY
                     ALCTPDGIVDLRTGLLKTPDPNKDFHSRSTSVGPRPSPTPRWNRFLTDTFGDDAEGTE
                     MIEFLQLLLGYSVTGDVGGQVLPFLFGSGKNGKSVLLDVLMKLLGDYADAAPPGFLMA
                     RPYEGHPTDLAELHGRRVIVCSEVKHGDKFDEARVKLLTGGDRIKARRMRQDFFSFQP
                     THKLWLLGNHRPEVGTGGFAFWRRMRLIPFTRVVSDDRKIDNLADILVTEEGPGILGW
                     LIDGARRYLAGDKDLTGPERVRIATTAYAETEDHTGRFFEECCTLGPELRAEQTGLYT
                     AYRTWCQEEGAPAMTSRAFAARARELAGLASPKEMILSNQRKYYPGIGLLPEQERQAT
                     T"
     misc_feature    complement(41683..43026)
                     /locus_tag="Sfla_6681"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14709"
                     /db_xref="CDD:173172"
     misc_feature    complement(42553..43002)
                     /locus_tag="Sfla_6681"
                     /note="D5 N terminal like; Region: D5_N; pfam08706"
                     /db_xref="CDD:254987"
     misc_feature    complement(41779..42708)
                     /locus_tag="Sfla_6681"
                     /note="phage/plasmid primase, P4 family, C-terminal
                     domain; Region: primase_Cterm; TIGR01613"
                     /db_xref="CDD:130674"
     gene            complement(43182..44294)
                     /locus_tag="Sfla_6682"
                     /db_xref="GeneID:11372347"
     CDS             complement(43182..44294)
                     /locus_tag="Sfla_6682"
                     /inference="protein motif:PFAM:PF09250"
                     /note="PFAM: Bifunctional DNA primase/polymerase;
                     KEGG: sen:SACE_1124 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional DNA primase/polymerase"
                     /protein_id="YP_004927330.1"
                     /db_xref="GI:357415595"
                     /db_xref="InterPro:IPR015330"
                     /db_xref="GeneID:11372347"
                     /translation="MPADLRIYPSDSRDEGLLPSVADVPLATAKWCARQGWPVHPLAP
                     GRKTPAANCETCRQPGHSRAGCVCPSEGRWCHSFHAATLDQRRIDRWWGQNPQFGIGV
                     ACGPAGLVVVDIDAHATKSPGRDRILPGIPISDQVNLAGLTNGFHTIAVLAALRDMPS
                     PADDASTLRVRTPSGGLHVWYRVGDSRSWQCSSGSSPGRALAWQVDVRANGGYIVAPG
                     TTTAAGTYTPLGSVRRPAVLPDWLAQELERTGHLPAFDVPAPRAVPPRAQQAVIAAGG
                     GRNHTHNILASVLAPVEACGQVAEGAGFSDILNRAAYTLGGLVAASRLSQQEAEDLLL
                     QTAAAARPGQNHRAEQIIRSGMAAGLKRPLYPGSVR"
     misc_feature    complement(43560..44186)
                     /locus_tag="Sfla_6682"
                     /note="Prim_Pol: Primase-polymerase (primpol) domain of
                     the type found in bifunctional replicases from archaeal
                     plasmids, including ORF904 protein of the crenarchaeal
                     plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol).
                     These primpol domains belong to the...; Region: Prim_Pol;
                     cd04859"
                     /db_xref="CDD:240129"
     misc_feature    complement(order(43677..43679,43761..43763,43950..43952,
                     43956..43958,44154..44156))
                     /locus_tag="Sfla_6682"
                     /note="polymerase nucleotide-binding site; other site"
                     /db_xref="CDD:240129"
     misc_feature    complement(order(43638..43640,43656..43658,44139..44141,
                     44151..44153))
                     /locus_tag="Sfla_6682"
                     /note="DNA-binding residues [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:240129"
     misc_feature    complement(order(43656..43658,43677..43679,43761..43763,
                     43767..43772,43779..43781,43950..43952,43956..43958,
                     43992..43994))
                     /locus_tag="Sfla_6682"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240129"
     misc_feature    complement(order(43677..43679,43761..43763,43950..43952,
                     43956..43958))
                     /locus_tag="Sfla_6682"
                     /note="primase nucleotide-binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:240129"
     gene            44864..45655
                     /locus_tag="Sfla_6683"
                     /db_xref="GeneID:11372348"
     CDS             44864..45655
                     /locus_tag="Sfla_6683"
                     /inference="protein motif:PFAM:PF07228"
                     /note="KEGG: sgr:SGR_2493 hypothetical protein;
                     manually curated;
                     PFAM: Stage II sporulation protein E; ATP-binding region
                     ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein serine/threonine phosphatase"
                     /protein_id="YP_004927331.1"
                     /db_xref="GI:357415596"
                     /db_xref="GO:0004721"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="GeneID:11372348"
                     /translation="MATCLYAVYDPVAHRITIANAGHPPPVLLHLGGRAEVLRVPPGA
                     PIGVGGVDFEAVELDAPAGATLLLYTDGLVESRLRDVWTGIEILRERLATTAQLTGPD
                     HSPPLEALCDDVLDMLGPGDRDDDIALLAARFDGIAPSDVAYWFLEPEDAAPGRARRL
                     ARRALSRWGLDDLSDEVELLVSEVVTNAIRFTARPVTLRLRRTDILRCEVGDDAPQLP
                     RQRRARETDEGGRGLFLVNRLARRWGATRLSTGKVVWFEMTLPPR"
     misc_feature    <44864..45268
                     /locus_tag="Sfla_6683"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     misc_feature    45401..45601
                     /locus_tag="Sfla_6683"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(45410..45412,45422..45424,45431..45433,45491..45493,
                     45497..45499,45503..45505,45509..45514,45557..45562)
                     /locus_tag="Sfla_6683"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    45422..45424
                     /locus_tag="Sfla_6683"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(45503..45505,45509..45511,45557..45559)
                     /locus_tag="Sfla_6683"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(45801..46112)
                     /locus_tag="Sfla_6684"
                     /db_xref="GeneID:11372349"
     CDS             complement(45801..46112)
                     /locus_tag="Sfla_6684"
                     /inference="similar to AA sequence:KEGG:KP1_0571"
                     /note="KEGG: kpu:KP1_0571 putative sulfate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927332.1"
                     /db_xref="GI:357415597"
                     /db_xref="GeneID:11372349"
                     /translation="MTRGQWGCVAAPVGGLATGVLGSVLLSAAWRACDVGVNGAANGL
                     ALIFYGALLTIISAVWWGALVGYVGRWNLAVALLGGTAGAAVMVWIFVALLHVPNGYR
                     C"
     sig_peptide     complement(46026..46112)
                     /locus_tag="Sfla_6684"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.859) with cleavage site probability 0.773 at
                     residue 29"
     gene            complement(46109..47272)
                     /locus_tag="Sfla_6685"
                     /db_xref="GeneID:11372432"
     CDS             complement(46109..47272)
                     /locus_tag="Sfla_6685"
                     /inference="similar to AA sequence:KEGG:Haur_3851"
                     /note="KEGG: hau:Haur_3851 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927333.1"
                     /db_xref="GI:357415598"
                     /db_xref="GeneID:11372432"
                     /translation="MLSYQEVMTTDLSVLTKAAEKWETVAADLAKVGKRYGETVQKIT
                     LGQNWHGLSVEAAHTKFATTRREYTSAQTEAKSVAKILRDAHTGFVDLKKKVESARDD
                     AVAAGMAVSTAGRAAFDFTRLQDPAQERALRHDPDLKGAEESWTSHIAAAVRAVAEFD
                     SAVKQALEAVVVDGNLLDGTVGGFNATATPVIPPTGQERSEQKFTDAEKWIFEEMKRN
                     AKSDTVGTIKALLDEPEWYEFGRNYGSDINAAMVMWGAKVAPGQDWDHKPQLQQRYDL
                     QTIDDYYFKQPGTNREVFYDIYSNVHYGYVGRAAGFDTDTLIQGASLGETVLTGDDDQ
                     GDQITMRVGVDLYEKYGDDLTEEQLRQGINDAMDQMERAQRNGEDVPQVRTRK"
     misc_feature    complement(46223..46525)
                     /locus_tag="Sfla_6685"
                     /note="Putative toxin 60; Region: Toxin_60; pfam15607"
                     /db_xref="CDD:259738"
     gene            complement(47284..47664)
                     /locus_tag="Sfla_6686"
                     /db_xref="GeneID:11372350"
     CDS             complement(47284..47664)
                     /locus_tag="Sfla_6686"
                     /inference="similar to AA sequence:KEGG:SGR_1417"
                     /note="KEGG: sgr:SGR_1417 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927334.1"
                     /db_xref="GI:357415599"
                     /db_xref="GeneID:11372350"
                     /translation="MAWDESSGGGTPAGPLVPGGGGLFGSSPAEKNAAANDIETELEP
                     DTKKFSDGAKESTNTAARTLNGWETASGLKKVVGTWDQQVRVLMGRLAAEKASLRNTS
                     GLFFQNDLGTGSELRGVRSSLDEL"
     gene            complement(48359..49129)
                     /locus_tag="Sfla_6687"
                     /db_xref="GeneID:11372351"
     CDS             complement(48359..49129)
                     /locus_tag="Sfla_6687"
                     /inference="similar to AA sequence:KEGG:KPK_0939"
                     /note="KEGG: kpe:KPK_0939 ImcF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927335.1"
                     /db_xref="GI:357415600"
                     /db_xref="GeneID:11372351"
                     /translation="MRALLLIALAAAAWAAWHWSRFPGKWDHAFSTRYASDRASLVTG
                     RRSLREVNKEAARAENSARKRAGAEEAKYQQDIQELENEIAGLLRPGLGSHVKGPIGD
                     LTLYKHAVKKTGENPVDIPLAGLTATFRSDPTYMIDLTLPGSRTHRTKYPRRREPGDE
                     ATPFFTAEQLSDFTLEIMNAAADESNFRACRDARLPRARKELEAAQNNSAARDEALQT
                     LQDVCAWQKSNPRRIEALANLEEKRRQWQQLTGKMPPK"
     sig_peptide     complement(49082..49129)
                     /locus_tag="Sfla_6687"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.962) with cleavage site probability 0.958 at
                     residue 16"
     gene            complement(49308..49481)
                     /locus_tag="Sfla_6688"
                     /db_xref="GeneID:11372352"
     CDS             complement(49308..49481)
                     /locus_tag="Sfla_6688"
                     /inference="similar to AA sequence:KEGG:Hoch_4377"
                     /note="KEGG: hoh:Hoch_4377 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927336.1"
                     /db_xref="GI:357415601"
                     /db_xref="GeneID:11372352"
                     /translation="MKRKPNPPAPRPNRRTATARRWAAHRRTITAHLLRGASYGAGTG
                     AVGLIFWWIEQRW"
     gene            complement(49580..50263)
                     /locus_tag="Sfla_6689"
                     /db_xref="GeneID:11372353"
     CDS             complement(49580..50263)
                     /locus_tag="Sfla_6689"
                     /inference="similar to AA sequence:KEGG:SAV_212"
                     /note="KEGG: sma:SAV_212 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927337.1"
                     /db_xref="GI:357415602"
                     /db_xref="GeneID:11372353"
                     /translation="MSLAIEQLLADAGQAAHEPRRAFDVAAGLRRLARDAGYTAAPPD
                     PFIPPLAHAHHQLVIVSRWCLTHSGAAVHIERLAAELGEETSSEVRAPLKDLDVDGAH
                     IFACMLYLADHPESALFWWQLAAGAGHGIAAYCLYLRHLGLGESREARHWLQQLQRPL
                     DGPDDEFMTGLDRFTLYIRRHGSPNLVSTGGIEVEIERLADTGNTGGLVCRPDQQLAD
                     RLHELAGQH"
     gene            complement(50260..50784)
                     /locus_tag="Sfla_6690"
                     /db_xref="GeneID:11372354"
     CDS             complement(50260..50784)
                     /locus_tag="Sfla_6690"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="KEGG: sma:SAV_213 ECF subfamily RNA polymerase
                     sigma factor;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: Sigma-70 region 4 type 2"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor, sigma-70 family"
                     /protein_id="YP_004927338.1"
                     /db_xref="GI:357415603"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0016987"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:11372354"
                     /translation="MTEDVRADGSSPVADAVLPLPLEFEAHYVTHQEAYHRYALFYLG
                     SNDAAEEAVHRVFYEILRHWDALLAESNLQQQTWAIMRRVVISQSLMSFRKKITLMHS
                     NIGLFAALSKLPARQFDVIVLRYIERYDTKRISWYLGITHSTVDYHCRKAKERLSELL
                     KLDIEPKNTKGKAE"
     misc_feature    complement(50305..50718)
                     /locus_tag="Sfla_6690"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    complement(50317..50469)
                     /locus_tag="Sfla_6690"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(50326..50328,50332..50337,50341..50349,
                     50353..50358,50362..50364,50392..50397,50413..50415,
                     50443..50445))
                     /locus_tag="Sfla_6690"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            51428..52252
                     /locus_tag="Sfla_6691"
                     /pseudo
                     /db_xref="GeneID:11372355"
     gene            52575..52730
                     /locus_tag="Sfla_6692"
                     /pseudo
                     /db_xref="GeneID:11372356"
     gene            complement(52750..53322)
                     /locus_tag="Sfla_6693"
                     /db_xref="GeneID:11372357"
     CDS             complement(52750..53322)
                     /locus_tag="Sfla_6693"
                     /inference="similar to AA sequence:KEGG:Micau_1995"
                     /note="KEGG: mau:Micau_1995 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927339.1"
                     /db_xref="GI:357415604"
                     /db_xref="GeneID:11372357"
                     /translation="MGFMESRTAAGLRIVEEWTAPDRLVPPTVIGQAPSIPFEDGRVE
                     VLRDFLDPLLQQKANADWYRLAVEGGLFSETDRRFLIALSPGRDRLSRWHCVELQSEW
                     DIMSKGADGLLGSAPYRPEFSMLSLDGNVLCFATTWEYAISTSVLKAPHRSHVLRHWA
                     EGLTDGSMDDMGDPNDLPLSVAARRWLDHH"
     gene            complement(53762..56065)
                     /locus_tag="Sfla_6694"
                     /db_xref="GeneID:11372358"
     CDS             complement(53762..56065)
                     /locus_tag="Sfla_6694"
                     /inference="protein motif:PFAM:PF00069"
                     /note="KEGG: sco:SCO3344 serine/threonine protein kinase;
                     PFAM: Serine/threonine-protein kinase-like domain;
                     SMART: Pyrrolo-quinoline quinone beta-propeller repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_004927340.1"
                     /db_xref="GI:357415605"
                     /db_xref="GO:0004672"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="InterPro:IPR018391"
                     /db_xref="GeneID:11372358"
                     /translation="MSSVAVHHILGPSWRISHPRSSSGHNHPFPDITDSSSVASVPLA
                     ATETSILSSHLMRGQELVCRRVAGVVLSWQEEKIPRMVGEYCIERRIGAGGMGVVFLA
                     VSPSGRQVAVKAIRGEFADDADYRARFRQEIEAARQVSGAFTASVVGADPDADPPWMA
                     TQYLNAPTLSDRVRKDGVLDENAVWQLGRGLAEALRDIHRVGLVHRDLKPSNVLLTED
                     GPRVIDFGIARVLNAEPVTRTGKILGSVSFMAPEQVSTPREVGVAADVFALGGVLTFA
                     ATGRGPFDGGTGAPPIAVAMKIVHDNPDLADLPSALCSIVDKCLSKNPASRPSPTELL
                     DLLRQEGEFKEKRKRLLRSANSSRPPRPARFYLSATAATIAVSAVVIAVTYAGGIEKD
                     GKTDTPTAQASPTTANPAVEKAAALRPKGWAVWEKPTTALARETGEPPSCGGTAGALV
                     CAEAGGVVERIDVASGQTMWSKQYDAENSPVGSVAGFAGKLVVVSDINGENLTGLDME
                     TGDQAWSARTAGTSSLVMQKSTVAMFHPTGNGTIIDLRDLRTGKRVKSRNLAPGEWHQ
                     IVDGGEEVLYLLTYAEDEGFIKSLSALDSATLQTTKVLATFDKDPGSLVAADGNSVSF
                     LLAGRNLTRVTTSDGTVTLLPLKEAFEGATQAQDNTLYISRADGTLTSYDLQTGRHSW
                     TTETGGESPARPVVADGRLYSLASDGRIASLDAKTGKIIWRSAARRNANRPIYGNPGS
                     HPEPVVLNGVVYTGATTGSIFAVAPPE"
     misc_feature    complement(55064..55813)
                     /locus_tag="Sfla_6694"
                     /note="Protein kinase domain; Region: Pkinase; pfam00069"
                     /db_xref="CDD:249558"
     misc_feature    complement(55055..55795)
                     /locus_tag="Sfla_6694"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(55325..55336,55385..55387,55394..55396,
                     55424..55426,55430..55435,55439..55441,55445..55447,
                     55556..55558,55562..55564,55574..55585,55631..55633,
                     55727..55729,55733..55735,55769..55771,55781..55795))
                     /locus_tag="Sfla_6694"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(55394..55396,55424..55426,55430..55435,
                     55439..55441,55445..55447,55562..55564,55574..55585,
                     55631..55633,55727..55729,55733..55735,55769..55771,
                     55781..55795))
                     /locus_tag="Sfla_6694"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(55325..55336,55385..55387,55433..55435,
                     55439..55441,55445..55447,55556..55558,55562..55564,
                     55781..55783))
                     /locus_tag="Sfla_6694"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(55325..55336,55379..55399))
                     /locus_tag="Sfla_6694"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(53894..54706)
                     /locus_tag="Sfla_6694"
                     /note="PQQ-like domain; Region: PQQ_2; pfam13360"
                     /db_xref="CDD:257688"
     misc_feature    complement(<53777..54667)
                     /locus_tag="Sfla_6694"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    complement(order(53780..53782,53900..53902,53909..53917,
                     53924..53926,53930..53932,54020..54022,54029..54037,
                     54044..54046,54050..54052,54227..54235,54242..54244,
                     54248..54250,54401..54403,54410..54418,54425..54427,
                     54434..54436,54524..54526,54533..54541,54548..54550,
                     54554..54556,54656..54658,54665..54667))
                     /locus_tag="Sfla_6694"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199833"
     misc_feature    complement(order(53948..53950,54182..54184,54287..54292,
                     54341..54343,54479..54481,54503..54505,54635..54637))
                     /locus_tag="Sfla_6694"
                     /note="active site"
                     /db_xref="CDD:199833"
     gene            complement(56062..56823)
                     /locus_tag="Sfla_6695"
                     /db_xref="GeneID:11372359"
     CDS             complement(56062..56823)
                     /locus_tag="Sfla_6695"
                     /inference="protein motif:PFAM:PF05258"
                     /note="PFAM: protein of unknown function DUF721;
                     KEGG: sma:SAP1p34 putative Tra3-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF721"
                     /protein_id="YP_004927341.1"
                     /db_xref="GI:357415606"
                     /db_xref="InterPro:IPR007922"
                     /db_xref="GeneID:11372359"
                     /translation="MSGNETAGVDLSRAALGAAMEAARKNGTGPKVKRKPQAVTMVRR
                     DGREAMGLGTAIGALVTERAWELPAAGATLQERWAAIAPELAGHVAAVSYDPDSGWLT
                     VCPESSAWATKARMEQTRVIAAATRAAGRTVVRALRILPRDVAPAPGPAAVLADSAPA
                     APTGPARTRETACEGYRSALAAHQEVAPPRRVGPGIAAAVERQTAAIRELSCRAFPET
                     DIAVLNDAPAPIEPARAERAVPEPSRAPQAAGEVP"
     misc_feature    complement(56407..56670)
                     /locus_tag="Sfla_6695"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; pfam05258"
                     /db_xref="CDD:253119"
     gene            complement(56820..57760)
                     /locus_tag="Sfla_6696"
                     /pseudo
                     /db_xref="GeneID:11372360"
     gene            58378..58773
                     /locus_tag="Sfla_6697"
                     /db_xref="GeneID:11372361"
     CDS             58378..58773
                     /locus_tag="Sfla_6697"
                     /inference="similar to AA sequence:KEGG:Ndas_4457"
                     /note="KEGG: nda:Ndas_4457 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927342.1"
                     /db_xref="GI:357415607"
                     /db_xref="GeneID:11372361"
                     /translation="MKVAVELVGARVTRTAFDYQVRISFTDHEPDGRVRLDGELVIET
                     PITVTDAVGTQAILLPGTGTALAPLLGLFTKAVTKAEVTGLGTLSLGFDDGTRLSIDP
                     DPDYESWSLTGSGLEPVLVGPGGETDWQH"
     gene            58878..59468
                     /locus_tag="Sfla_6698"
                     /db_xref="GeneID:11372362"
     CDS             58878..59468
                     /locus_tag="Sfla_6698"
                     /inference="similar to AA sequence:KEGG:Achl_4109"
                     /note="KEGG: ach:Achl_4109 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927343.1"
                     /db_xref="GI:357415608"
                     /db_xref="GeneID:11372362"
                     /translation="MTTAPDAPPHTVLPYGPGNRWTFTYEGNGYVKTEELALYAEPNG
                     STLTDDYLANKISTEALWQMWVDEWADSYHKQWPNLYRPGEVHISWYVTTPDITGTFE
                     GASHITDWRTLPGQLDADRGQEDFLTHYTHPTHVVTGERLNWLRLPVVDRGWNSGASN
                     KGGFIQQATGWKPSPLQPTMDVRQIGAAAGLYVPPL"
     gene            complement(59940..61325)
                     /locus_tag="Sfla_6699"
                     /db_xref="GeneID:11372363"
     CDS             complement(59940..61325)
                     /locus_tag="Sfla_6699"
                     /inference="protein motif:PFAM:PF00772"
                     /note="KEGG: sgr:SGR_3669 putative replicative DNA
                     helicase;
                     PFAM: DnaB domain protein helicase domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaB domain protein helicase domain protein"
                     /protein_id="YP_004927344.1"
                     /db_xref="GI:357415609"
                     /db_xref="GO:0003678"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007693"
                     /db_xref="InterPro:IPR007694"
                     /db_xref="GeneID:11372363"
                     /translation="MSSTHDLPAQHPAAHLEEPRLHTDQAAFLRTPPQSLEAEQATLG
                     TLMTSMGASQRYFAETLETGILAEEYYKPAHTVIHRAICDLHKAGEPADVVTVAAELV
                     KRGELSKVGGAPYLHACIQAVPTTANGPRYAEIVRAKAYRRAAIESAQKILQYAYSEE
                     GDEADVRGLVEQELTAIVAGTPGLRDAPPLVDDIYLDYVAELEEIQNGRQLGLSYGIT
                     DLDAMTSGMHPQNVTVIAAQSGVGKSTLALNAAVAAAKNGATVMFSSLEMSSTELMHK
                     IVAAEGSLALHHLTRIDGLTSEDWKKVERLGRELFRTLPLRIHRPDHASLRDIESAAR
                     ACARKDGLDVLVVDYLQLVEIEQTRNITREQAVAAVSRGLKNLSVDLKCHVIALSQLN
                     DDGMVRESRAIKNDASVMIKVERPDMDEPESPRAGEVDFVIEKNRFGPRATVSAAAQL
                     HYSRFIDMQSA"
     misc_feature    complement(59952..61235)
                     /locus_tag="Sfla_6699"
                     /note="replicative DNA helicase; Region: DnaB; TIGR00665"
                     /db_xref="CDD:233080"
     misc_feature    complement(60915..61235)
                     /locus_tag="Sfla_6699"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:250122"
     misc_feature    complement(59976..60674)
                     /locus_tag="Sfla_6699"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(60594..60602,60612..60617))
                     /locus_tag="Sfla_6699"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(60279..60284,60528..60533,60537..60539,
                     60594..60602,60612..60614))
                     /locus_tag="Sfla_6699"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(60282..60296)
                     /locus_tag="Sfla_6699"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(61402..62490)
                     /locus_tag="Sfla_6700"
                     /db_xref="GeneID:11372364"
     CDS             complement(61402..62490)
                     /locus_tag="Sfla_6700"
                     /inference="similar to AA sequence:KEGG:LmjF19.1170"
                     /note="KEGG: lma:LmjF19.1170 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927345.1"
                     /db_xref="GI:357415610"
                     /db_xref="GeneID:11372364"
                     /translation="MEEIHETGAITHRGPVASVQVHAHMEFGPYALTAPLDTKIVIQL
                     MFMLAEQTRQGPDAGLLRVTPLTVLERLRELGVRAGNGSALVGKNAVYDSFARLREKG
                     YIRRITPRDEKGRPTGTAYEFYDWPSWNPDAPNETEIADSALFPQVSTTSGNAGTGNA
                     GSHVAQKGAKQQSVQVKSTSGIAGSGIAGSGIAGSAFPQVKSTSGNAGNPPHPPEEVT
                     TSSPNPLTDTTGLGSLPSPREEGEAGYAEEDLQAAADVLQLLPDPWTQGKLNASKLAP
                     KLLGVMAEQGWPGIHTVDRALLTRQLTKNPHKITNPYRLLAGDRIPNLPRYAVVATTP
                     APGSTADGWCPKHPKYRAGNRCIPCVTA"
     misc_feature    complement(61798..>62100)
                     /locus_tag="Sfla_6700"
                     /note="Herpes virus major outer envelope glycoprotein
                     (BLLF1); Region: Herpes_BLLF1; pfam05109"
                     /db_xref="CDD:253014"
     gene            complement(62493..62666)
                     /locus_tag="Sfla_6701"
                     /db_xref="GeneID:11372365"
     CDS             complement(62493..62666)
                     /locus_tag="Sfla_6701"
                     /inference="similar to AA sequence:KEGG:Tint_2989"
                     /note="KEGG: tin:Tint_2989 ABC transporter related
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="YP_004927346.1"
                     /db_xref="GI:357415611"
                     /db_xref="GeneID:11372365"
                     /translation="MHRPHHPERRPSAISSAAQAPTERGVRDADGESPLLLDDVTRAL
                     AFLDRNGALSGEV"
     gene            complement(63025..63711)
                     /locus_tag="Sfla_6702"
                     /db_xref="GeneID:11372433"
     CDS             complement(63025..63711)
                     /locus_tag="Sfla_6702"
                     /inference="similar to AA sequence:KEGG:SCP1.90c"
                     /note="KEGG: sco:SCP1.90c putative ATP/GTP-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="YP_004927347.1"
                     /db_xref="GI:357415612"
                     /db_xref="GeneID:11372433"
                     /translation="MNADEAVLLDDTLVNCLEARLGELLRAGRANTLNLEGRFEISRI
                     SASLSGQLRSAPRAILMAGMPGAGKTTLARAFEQAGMVRLCPDEEMFRRYGHYGRDFP
                     RGQFRVREAPVLKEIALELQEHLAAGRDVVVDHGFWTPEERGQWAASAMEAGGSPVLV
                     YLPVPHEVRWERIRERNARALIDANSIEFSEEDLQRFAGRFHPPTADEQHIVYDGDPS
                     AVLDLVGLRR"
     misc_feature    complement(63085..63546)
                     /locus_tag="Sfla_6702"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     misc_feature    complement(63100..63537)
                     /locus_tag="Sfla_6702"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     gene            complement(63711..64466)
                     /locus_tag="Sfla_6703"
                     /db_xref="GeneID:11372434"
     CDS             complement(63711..64466)
                     /locus_tag="Sfla_6703"
                     /inference="protein motif:PFAM:PF07702"
                     /note="KEGG: sco:SCP1.91c GntR family transcriptional
                     regulator;
                     PFAM: UbiC transcription regulator-associated
                     domain-containing protein; regulatory protein GntR HTH;
                     SMART: UbiC transcription regulator-associated
                     domain-containing protein; regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="YP_004927348.1"
                     /db_xref="GI:357415613"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0003700"
                     /db_xref="GO:0030528"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011663"
                     /db_xref="GeneID:11372434"
                     /translation="MPGQQRADNRPPYARIAGHYRDLISSGELAPGELLPSIRALADQ
                     WQVSTATADRAMKLLRDEKLVNGIPGVGTEVMARPVSLASGSERHDRSSRTKSSWGVG
                     EKSSGHTAAMVAAPEDVAHALGINPGDDVVRRSRVYRDAHGIVSHSTSWIPAEFAQVL
                     PELARSERLKGGLSLDLIAEATGRQVTHRVDEETARIATPDDLKLLELDAETVAAILV
                     LTARFLDADDELLEYGVDLGAPGRTRRTMSEVL"
     misc_feature    complement(63768..64451)
                     /locus_tag="Sfla_6703"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    complement(64242..64436)
                     /locus_tag="Sfla_6703"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(64248..64259,64263..64268,64296..64298,
                     64305..64310,64314..64328,64350..64355,64359..64361,
                     64428..64430,64434..64436))
                     /locus_tag="Sfla_6703"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(63735..64130)
                     /locus_tag="Sfla_6703"
                     /note="UTRA domain; Region: UTRA; cl17743"
                     /db_xref="CDD:266805"
     gene            64793..65701
                     /locus_tag="Sfla_6704"
                     /db_xref="GeneID:11372366"
     CDS             64793..65701
                     /locus_tag="Sfla_6704"
                     /inference="similar to AA sequence:KEGG:SAV_7529"
                     /note="KEGG: sma:SAV_7529 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927349.1"
                     /db_xref="GI:357415614"
                     /db_xref="GeneID:11372366"
                     /translation="MASRTRTERPSRTRTRRTNGRPALALSTIPAQELNLLPGEMSLV
                     CRDCKTWCPITGLKTPKMAPHRRPEEQGAHRCPSSNQLLEANVTFDEWREQLMTVEAT
                     ATYRRAPRQHHKPLPEPFTPVHRLAARERTSLVHLFVLLEQARHALCAHRTACTGCRG
                     GGRCATGRDLEISFRETQATCTIAREQQMRSDRLNAQRARAVRTGQERTRAYVLDKAH
                     QIDQLRRAVPQGALPTEGPEVPLIHLAPRQAAAQPEEGQIKCEHCGATESGLADAVAA
                     GWHRVTRRPHCGRCAQRFPAWTRTSF"
     gene            65884..66432
                     /locus_tag="Sfla_6705"
                     /db_xref="GeneID:11372367"
     CDS             65884..66432
                     /locus_tag="Sfla_6705"
                     /inference="protein motif:PFAM:PF02467"
                     /note="PFAM: transcription factor WhiB;
                     KEGG: sma:SAV_4997 WhiB-family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription factor WhiB"
                     /protein_id="YP_004927350.1"
                     /db_xref="GI:357415615"
                     /db_xref="InterPro:IPR003482"
                     /db_xref="GeneID:11372367"
                     /translation="MHRMTSTQARHTRRAVLQAAVDAGARCHGADSDPDLFFRADDEG
                     LAAWRARRTKAIRLCTGCPVRAACEELALRDGDGRPDADEMVRAGLTGRELAAVRAAH
                     TERLAAAVEADRDTEGRRLDTLTTQLQREASTNPDSNRNGGVRLMAARTAAQNDRLRA
                     LAAQIRQIRTARRVRAGWGAAA"
     misc_feature    65971..>66117
                     /locus_tag="Sfla_6705"
                     /note="Transcription factor WhiB; Region: Whib; pfam02467"
                     /db_xref="CDD:111373"
     gene            66429..66713
                     /locus_tag="Sfla_6706"
                     /db_xref="GeneID:11372368"
     CDS             66429..66713
                     /locus_tag="Sfla_6706"
                     /inference="similar to AA sequence:KEGG:SCP1.93"
                     /note="KEGG: sco:SCP1.93 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927351.1"
                     /db_xref="GI:357415616"
                     /db_xref="GeneID:11372368"
                     /translation="MSTTTLIPWAGRAADVGREIGRQDDRGGDDGRGYERDETDRFHQ
                     YVHGLVLHGDTRAHTAGRRARRTLAGMAPGYKRQPILQPVRPLVFGSETS"
     gene            66713..66811
                     /locus_tag="Sfla_6707"
                     /db_xref="GeneID:11372435"
     CDS             66713..66811
                     /locus_tag="Sfla_6707"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927352.1"
                     /db_xref="GI:357415617"
                     /db_xref="GeneID:11372435"
                     /translation="MITITASLTDAEREELSRKNAEQNKRSEANRR"
     gene            67108..67278
                     /locus_tag="Sfla_6708"
                     /db_xref="GeneID:11372369"
     CDS             67108..67278
                     /locus_tag="Sfla_6708"
                     /inference="similar to AA sequence:KEGG:SCP1.94"
                     /note="KEGG: sco:SCP1.94 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927353.1"
                     /db_xref="GI:357415618"
                     /db_xref="GeneID:11372369"
                     /translation="MADSLHTRYMTASDTWRVHRKSCPPCQNGRHCEDGEPLHERFVR
                     LQSAYLNHLRNR"
     gene            67299..67625
                     /locus_tag="Sfla_6709"
                     /db_xref="GeneID:11372370"
     CDS             67299..67625
                     /locus_tag="Sfla_6709"
                     /inference="similar to AA sequence:KEGG:Achl_2990"
                     /note="KEGG: ach:Achl_2990 flagellar motor switch protein
                     FliG"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927354.1"
                     /db_xref="GI:357415619"
                     /db_xref="GeneID:11372370"
                     /translation="MTPTLNLDSFRDQHGDPTRWSTADIDSYLVLGDIAPPEPLPYTY
                     AEMQAMAADYQRSANDQKAIADRLAGEGHDTAASIWRRGARGARELAAAARMGWPAFE
                     AHLNGW"
     gene            68186..70093
                     /locus_tag="Sfla_6710"
                     /db_xref="GeneID:11372371"
     CDS             68186..70093
                     /locus_tag="Sfla_6710"
                     /inference="protein motif:PFAM:PF10935"
                     /note="PFAM: Protein of unknown function DUF2637;
                     KEGG: sma:SAV_7525 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF2637"
                     /protein_id="YP_004927355.1"
                     /db_xref="GI:357415620"
                     /db_xref="InterPro:IPR021235"
                     /db_xref="GeneID:11372371"
                     /translation="MTLTDWPRTAVGPDPEPSSPTPVSETPAVVSGTPGIVSETPGLV
                     SQPTNGTETEPSGGPLTGTQRLAIGAIVAAALVLAGIGLYLSFAHVADFAHQELRFGS
                     LDKGRLFAVGVDVGIMVMIAVDLLMAWLKRPITWVRYPVWLLTCATVVLNAASAAPQD
                     EAPWALMDYIAAFAHGVVPVLFIMIVEVGRDSIDRMVRPKRAERDSIPWIRWTLAPIA
                     TSKIFRRMRLWGVTSYPEMVRRDQDLIAYEQWLKRKHKGDLHKAKDDELLPMKMAPYG
                     YTVDEALALPGQQDEAARKRAEKAERERLDAETRSQIAEAEAEADRLRAKGKVELVQA
                     EVDGQTGQARAHAKAQVSAAERAAELEREALDNAVIAEGRARKAQAERKEAEDRQAEA
                     QADLETAGLERQAAEQRRIAAEADQIAAAEAQAIETQTIAEARRAAAKADLERAGLER
                     QAAQNRKEAAEADRVAAAEAQAIETQAIAEARKAAAEADRAAAETEKVAAETRRAAAE
                     TDRKTAEENQRREAALADIVRARKAAAEADRAAAETRQAAAEIERRAVEIEDEAKLSG
                     RQRAVRKVARMALTAGLTPDGLAPEDLHRELCERISIAAVQQQLDVSSTDTASKYRTE
                     AAALLADGYRP"
     misc_feature    68423..68893
                     /locus_tag="Sfla_6710"
                     /note="Protein of unknown function (DUF2637); Region:
                     DUF2637; pfam10935"
                     /db_xref="CDD:256204"
     misc_feature    <69056..69361
                     /locus_tag="Sfla_6710"
                     /note="core domain of the SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region: SPFH_like;
                     cl19107"
                     /db_xref="CDD:267460"
     gene            70216..70689
                     /locus_tag="Sfla_6711"
                     /db_xref="GeneID:11372372"
     CDS             70216..70689
                     /locus_tag="Sfla_6711"
                     /inference="similar to AA sequence:KEGG:SAP1p45"
                     /note="KEGG: sma:SAP1p45 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927356.1"
                     /db_xref="GI:357415621"
                     /db_xref="GeneID:11372372"
                     /translation="MNSNEPSTAPLRDVAQNAEATARYLADMQRVLLDMGANLEILQR
                     ETRVHCRSTSVEGDRWYHAKLRALPVEKALKDVLKSLNSLTDGLEKSAYKRRSHDEAV
                     VNTGKARKEKALEKVRKNNPQQIQPASNPGESGDSGQNPGYGGPASIYDLGKRSA"
     gene            70686..70916
                     /locus_tag="Sfla_6712"
                     /db_xref="GeneID:11372373"
     CDS             70686..70916
                     /locus_tag="Sfla_6712"
                     /inference="similar to AA sequence:KEGG:sce5645"
                     /note="KEGG: scl:sce5645 carbohydrate ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter"
                     /protein_id="YP_004927357.1"
                     /db_xref="GI:357415622"
                     /db_xref="GeneID:11372373"
                     /translation="MTRPLLKAEIKAQRSRDYLIAQRTAFIEKHGEDLGAFYFLIMLV
                     QTHGRKALKRGDTAALRSLAHDLHALYLKHTA"
     gene            71069..73054
                     /locus_tag="Sfla_6713"
                     /db_xref="GeneID:11372374"
     CDS             71069..73054
                     /locus_tag="Sfla_6713"
                     /inference="similar to AA sequence:KEGG:SAP1p47"
                     /note="KEGG: sma:SAP1p47 putative ATP/GTP-binding
                     Gly/Ala-rich protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP/GTP-binding Gly/Ala-rich protein"
                     /protein_id="YP_004927358.1"
                     /db_xref="GI:357415623"
                     /db_xref="GeneID:11372374"
                     /translation="MSSDDTEGQLINFPVAGDVLNRPPELPDPGRLFPQVREEPESPP
                     ESPEETTMELPAIPRPMAPEMALRSDGLSAPDIDGESGEGGDSEFAHHRSLAERLGDW
                     LEYRIALGQSRIESEAPFREAEIARKVELLNAKTAREVGLLEQHNKLRAAQLKARADQ
                     TAARGKSDAAGTKGGGGRGGSGLGGDKGGRKTGPQGPAPRQQPKPQQPTKSPAPAPKQ
                     QPQKPAPPKQQPQKQQTPQKQGPAPKDPRKSPGPKKQPRNQTPPKQQPQKQAPGPAPK
                     PTPQKPGPVSKEQPRRDDKNRPKVDLSKGKGGGTKPPGLGADGKGSKVPGPGGKTPPV
                     LGSDGAKGGPKAWPGAKGPGGGSKGADGPSGGPNGKGAPDPKGSSGGTGTGGKKAPKQ
                     GPGRPAEGPKSGPGPQGPSGSSKAAGGAAGGRAAGGPGATKNGPGPGPGPGPGPGPGG
                     ASADGPGCPGNRTETPEWPGHETRKKPPPPPAGGQDYPDAVIVEPAALPPAPEPHTAR
                     PGTTRPTVQEPHMTQPRTTASAQSGMAAQHRTDITFDQYLVEIANIALAASADQERAE
                     ELAAALGKVADALRDMATDLVGDHNIDTKVTNLISDLADAAGRMKAQAERCAQTCEIA
                     AEAARLAAVGVARTYGEDMQAMDDAGLTHASSAAHHD"
     misc_feature    <71789..>71977
                     /locus_tag="Sfla_6713"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14954"
                     /db_xref="CDD:184918"
     misc_feature    <72014..72538
                     /locus_tag="Sfla_6713"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            73072..73488
                     /locus_tag="Sfla_6714"
                     /db_xref="GeneID:11372375"
     CDS             73072..73488
                     /locus_tag="Sfla_6714"
                     /inference="similar to AA sequence:KEGG:SAP1p48"
                     /note="KEGG: sma:SAP1p48 putative TraB protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TraB protein"
                     /protein_id="YP_004927359.1"
                     /db_xref="GI:357415624"
                     /db_xref="GeneID:11372375"
                     /translation="MSSELSPRPATTPAPADGDNRYKSVQLKLKKLAAAMDSSSDELG
                     SLQREMRANAERTEALAVDIANAHLDTRFVELTNTVAIALGGAAHDVSKLHQNAQDVA
                     QTTHETQRTHSTLYSALDDIRSSRKERTPKPGFFAR"
     gene            73596..75701
                     /locus_tag="Sfla_6715"
                     /db_xref="GeneID:11372376"
     CDS             73596..75701
                     /locus_tag="Sfla_6715"
                     /inference="similar to AA sequence:KEGG:SCP1.102"
                     /note="KEGG: sco:SCP1.102 putative plasmid transfer
                     protein, (ATP/GTP-binding)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid transfer protein,
                     (ATP/GTP-binding)"
                     /protein_id="YP_004927360.1"
                     /db_xref="GI:357415625"
                     /db_xref="GeneID:11372376"
                     /translation="MSVPRSVALERIAYTLAAPVLAAAPNLSPDGSVNTGMLLAGAAG
                     VGGALLAVKSREGTGRKLVRLSPVVFGAAVDAAAMYTTGWGWDAALAAAWAAAGWWLL
                     PLSRSARRHHRPALAPIPQPARTAPATAAPPVVDDGADPFTRDVRLLWERAGNPGRTI
                     VAHADRHPVTSHDLTMLLRAAEPGRPITGLSEAGVAAAFGVDDDPDVVRFAQVVRQPG
                     RQGGPGWLEVHLTPDEAARRRKAPTEHEWWADRIGATSGPVPGSDFVKKVRDTERKVT
                     HYIAQVPDEQGEPRVNLHALAAALKTKYDEGRLFVTIDGNQVLVSLWDSSPLAQVFPA
                     TRELLTPDKDGRWVTGYLGNGQPARNRVYTDRGAAHGLFVAPSGGGKTQLMGLHVAAD
                     ALFGAVVMLATEAPDEKTAALGEHTARYGVGALYMIRLLRVMVALMEIRGQMRWDDGK
                     VHEWDPKLPGCPYRMLSAYLDEFLSAARNGDYGAEIMDLAELVSVKGRKYGVGLKVAG
                     QSVYVQDGFTQLLCENLRENCIPVVLKVAPKKITDMFRALGIPSENTPDPLPRSFSPA
                     EAGRIERVMAGQPEPPSDSNTGGAGWIIEGKQPDILRTLFMDFKAGIDDFFPDTIATL
                     TDHEIRELELRDLWFDWTEPPRPGEFGPEPDDEDGDDTAPKKRGGGKPRSGQKSGPRR
                     DAVNSPRQALDAIRTFTNA"
     gene            75788..76309
                     /locus_tag="Sfla_6716"
                     /db_xref="GeneID:11372377"
     CDS             75788..76309
                     /locus_tag="Sfla_6716"
                     /inference="similar to AA sequence:KEGG:SAV_7518"
                     /note="KEGG: sma:SAV_7518 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927361.1"
                     /db_xref="GI:357415626"
                     /db_xref="GeneID:11372377"
                     /translation="MPTTHIQSIPTLPTRAPAVLSLEARLAAVEAAMTVALDEAAVAY
                     EVRTAHIPTTPVADVVTLPLTPTLTPTNPYASPVANLLQRAQQRLLADGWCAGSQIRE
                     DGARCLYGAIRAEAAGDRSLEARGLEVLMDAIRSQFSDADSVPTFNDSWANGRVPMQM
                     LGQAAALADSCGQ"
     gene            76527..77767
                     /locus_tag="Sfla_6717"
                     /pseudo
                     /db_xref="GeneID:11372378"
     gene            complement(78001..78144)
                     /locus_tag="Sfla_6718"
                     /db_xref="GeneID:11372379"
     CDS             complement(78001..78144)
                     /locus_tag="Sfla_6718"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927362.1"
                     /db_xref="GI:357415627"
                     /db_xref="GeneID:11372379"
                     /translation="MRRHLLMEALTVLAALAPAQTAWLEKHGVVTDEIALDFGHAFRM
                     VER"
     sig_peptide     complement(78079..78144)
                     /locus_tag="Sfla_6718"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.939) with cleavage site probability 0.682 at
                     residue 22"
     gene            78950..79162
                     /locus_tag="Sfla_6719"
                     /db_xref="GeneID:11372380"
     CDS             78950..79162
                     /locus_tag="Sfla_6719"
                     /inference="similar to AA sequence:KEGG:SCP1.104"
                     /note="KEGG: sco:SCP1.104 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927363.1"
                     /db_xref="GI:357415628"
                     /db_xref="GeneID:11372380"
                     /translation="MFTCTPTLAKEAALDRAMAKRSTCPRCRRRYHHCLPLRIIGSCL
                     ECWDGTPADPHSYIAPEPDTVILRAA"
     gene            79258..79726
                     /locus_tag="Sfla_6720"
                     /pseudo
                     /db_xref="GeneID:11372381"
     gene            80056..80421
                     /locus_tag="Sfla_6721"
                     /db_xref="GeneID:11372382"
     CDS             80056..80421
                     /locus_tag="Sfla_6721"
                     /inference="similar to AA sequence:KEGG:SCAB_82051"
                     /note="KEGG: scb:SCAB_82051 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927364.1"
                     /db_xref="GI:357415629"
                     /db_xref="GeneID:11372382"
                     /translation="MRRGTSEYEAAQEAMAEILLERARNGDWPIQYGKLSKLLADEGH
                     NIPAHSVEMDHLLADVSHQESTDGTKAMLSAMVVLKEKGEPGAGFYRLAREEFGRKGD
                     NVTIWGEEMKLLAHDFRQC"
     gene            complement(80497..80688)
                     /locus_tag="Sfla_6722"
                     /db_xref="GeneID:11372383"
     CDS             complement(80497..80688)
                     /locus_tag="Sfla_6722"
                     /inference="similar to AA sequence:KEGG:Haur_2224"
                     /note="KEGG: hau:Haur_2224 YD repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927365.1"
                     /db_xref="GI:357415630"
                     /db_xref="GeneID:11372383"
                     /translation="MILHFASPDPLGRWPQGFLGEAVRWTENPVSSLRSWDHAGNDRA
                     LQAPTEDREFCGEPAMKLL"
     gene            complement(80685..81653)
                     /locus_tag="Sfla_6723"
                     /db_xref="GeneID:11372384"
     CDS             complement(80685..81653)
                     /locus_tag="Sfla_6723"
                     /inference="similar to AA sequence:KEGG:P9215_16891"
                     /note="KEGG: pmh:P9215_16891 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927366.1"
                     /db_xref="GI:357415631"
                     /db_xref="GeneID:11372384"
                     /translation="MKSRSRLTHDEAKAEMIARGVWPIEPYRGTNKPWRSVCMTCGEV
                     SSPRRSSVINMGQGGCDKECKGKRVSASKRTSHAIATDVIRGWGWEPQEPYPGAGKQW
                     ACECITCGVAALKTYYVVKNGLGRCTSCSGRALSHEEARRRMVEAGVEPLAPYSGSRR
                     RAWKSRCRECRSILDPGPSLANIERGQGGCGNCATYGFNPTAPAYVYLLGHKSLRALK
                     WGIANSERRIINHGYGGWAVLARWNSATGTEAHAVERQIKQWAKDTGLRPAVAASDMR
                     YHGYSETVSLAQVSLDTVWCQIVKIAEREPDVVQPAVIKSLQSGSR"
     gene            complement(82652..83005)
                     /locus_tag="Sfla_6724"
                     /db_xref="GeneID:11372385"
     CDS             complement(82652..83005)
                     /locus_tag="Sfla_6724"
                     /inference="similar to AA sequence:KEGG:HRM2_16700"
                     /note="KEGG: dat:HRM2_16700 formate--tetrahydrofolate
                     ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927367.1"
                     /db_xref="GI:357415632"
                     /db_xref="GeneID:11372385"
                     /translation="MDLSATGEPVMTHEDPQVRVGVHIGQGTCILIRDGIDFAAYHAW
                     VEFAAPDQKSWTAEKVEFSAKRPDGESVGLTVDLLNDACDGPRDGVPDAIWKVVALAA
                     TSAGDVGIRYTAPTS"
     gene            complement(83109..83345)
                     /locus_tag="Sfla_6725"
                     /db_xref="GeneID:11372386"
     CDS             complement(83109..83345)
                     /locus_tag="Sfla_6725"
                     /inference="similar to AA sequence:KEGG:BAV3075"
                     /note="KEGG: bav:BAV3075 putative ubiquinone biosynthesis
                     protein UbiB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927368.1"
                     /db_xref="GI:357415633"
                     /db_xref="GeneID:11372386"
                     /translation="MGRAAVMTRADGEQRRRAVPISVSNFLVLLRETLPEFPGSLAAA
                     VVTTAAAAAYRAVRITRPRRPEPTSAESFARSHR"
     gene            complement(83448..84782)
                     /locus_tag="Sfla_6726"
                     /db_xref="GeneID:11372387"
     CDS             complement(83448..84782)
                     /locus_tag="Sfla_6726"
                     /inference="protein motif:PFAM:PF04892"
                     /note="PFAM: VanZ family protein;
                     KEGG: kra:Krad_3089 VanZ family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="YP_004927369.1"
                     /db_xref="GI:357415634"
                     /db_xref="InterPro:IPR006976"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="GeneID:11372387"
                     /translation="MLQTVFNGRGEFVLIALAAVTIAALVGYFAARKFLDRPWAYAGL
                     FATLAAELSVTIFFPSPGHVSGQCVLNRNYNEPFATEQGLLNVAMFLPIGLFGVLALR
                     RVFPVFLGGALLSVATELGQALAPWVGRSCDSGDVLTNTLGAGIGALIGWAIVRAVRG
                     EVHSLRSAGKPAVVVFAVGFIVCAVVWKAWITPLAVDSTSLQIAGGDEKAQAQQVLAA
                     AFDDHVDIKNVQLQSGQNDAPDLLMITLESGFAELSWPDKEQLTVSLESTSQPGPGSF
                     AVPGAGAAPESADDALRIATKYAKERFPWGLEDSHVKSFPVGDDAEFGWMVSWRSRVD
                     GVLMPMRLDVQINRAGRVSALLTRHAEDFTSIPPRKVSEKQAAATASKYAGGAKTAAG
                     NLLAIRREGEWRAQWVIPVSSGTDSYPVYVDAETGKVDERASLVQGLPTAPN"
     misc_feature    complement(84333..84653)
                     /locus_tag="Sfla_6726"
                     /note="VanZ like family; Region: VanZ; cl01971"
                     /db_xref="CDD:261134"
     gene            complement(84852..85307)
                     /locus_tag="Sfla_6727"
                     /db_xref="GeneID:11372388"
     CDS             complement(84852..85307)
                     /locus_tag="Sfla_6727"
                     /inference="similar to AA sequence:KEGG:DDB_G0274587"
                     /note="KEGG: ddi:DDB_G0274587 nuclear pore protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927370.1"
                     /db_xref="GI:357415635"
                     /db_xref="GeneID:11372388"
                     /translation="MNVFAHKIVRSAAVAGLTLASMGGTGAAQASTSAPSGDVSIQES
                     CPSSGQVGYGRVCTSLSSGRLFHDKTQGSGPVTVRTWYEKNSGGSSISAKLGFNYAGT
                     TTWGSTFTQSPGTTKSASWSRNWSSDCYSTIGMMSVTGQGTYQTPSGTC"
     sig_peptide     complement(85215..85307)
                     /locus_tag="Sfla_6727"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.977 at
                     residue 31"
     gene            complement(85700..86065)
                     /locus_tag="Sfla_6728"
                     /db_xref="GeneID:11372436"
     CDS             complement(85700..86065)
                     /locus_tag="Sfla_6728"
                     /inference="similar to AA sequence:KEGG:SCAB_32531"
                     /note="KEGG: scb:SCAB_32531 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927371.1"
                     /db_xref="GI:357415636"
                     /db_xref="GeneID:11372436"
                     /translation="MQFRGIAMPDGLPRSGTISNLEKNRVLLDWLRWQVGQTERRIRE
                     LETQEAQERERRERARAEMSWKIQPQRSSSIALLHRGGCATYPDRVGLISREDAKVAL
                     AEPDIEPCQVCRPDTGLLS"
     gene            complement(86082..86324)
                     /locus_tag="Sfla_6729"
                     /db_xref="GeneID:11372389"
     CDS             complement(86082..86324)
                     /locus_tag="Sfla_6729"
                     /inference="similar to AA sequence:KEGG:SCAB_0211"
                     /note="KEGG: scb:SCAB_0211 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927372.1"
                     /db_xref="GI:357415637"
                     /db_xref="GeneID:11372389"
                     /translation="MERFPFPDDLVRAQQEWHNTYRALACSRPRRATELRRRLLALSV
                     RIHCHPFWSTPPGRTPAARVDLRQRTRGGRRTESAA"
     gene            complement(86375..86812)
                     /locus_tag="Sfla_6730"
                     /db_xref="GeneID:11372390"
     CDS             complement(86375..86812)
                     /locus_tag="Sfla_6730"
                     /inference="similar to AA sequence:KEGG:sce3347"
                     /note="KEGG: scl:sce3347 protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927373.1"
                     /db_xref="GI:357415638"
                     /db_xref="GeneID:11372390"
                     /translation="MQRMIISAALAAALVPLAAASAVSAPTAAQAYVDKRVRNCAGKA
                     SDCRPGAVAHYWYKRGSSARGVGWVYASREGARTGTARWLFKKPGDTWKTGGAWKRAG
                     RVGGTFAETSWGRDGHTGPVYPRGTRICVQFRGLPTKACVSLK"
     sig_peptide     complement(86717..86812)
                     /locus_tag="Sfla_6730"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.495 at
                     residue 32"
     gene            complement(86865..87017)
                     /locus_tag="Sfla_6731"
                     /db_xref="GeneID:11372437"
     CDS             complement(86865..87017)
                     /locus_tag="Sfla_6731"
                     /inference="similar to AA sequence:KEGG:4351951"
                     /note="KEGG: osa:4351951 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927374.1"
                     /db_xref="GI:357415639"
                     /db_xref="GeneID:11372437"
                     /translation="MTSPWRLVSPTTTLQAHQAHHSDGDEPGYADLQVLIRDVSHTRP
                     KKDDFG"
     gene            87065..87730
                     /locus_tag="Sfla_6732"
                     /db_xref="GeneID:11372391"
     CDS             87065..87730
                     /locus_tag="Sfla_6732"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sgr:SGR_7055t hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004927375.1"
                     /db_xref="GI:357415640"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11372391"
                     /translation="MINNVARSLAAAVLTLVPLLAAAPVQAAEVTTLADGVHALPLAA
                     ESRTGYERSSFKHWVDADKDSCNTRMEVLIAESRIAPTIEAGCKVTAGSWYSYYDGLT
                     LTAPGGLDIDHMVPLAEAWDSGASQWTPARREAYANDLGSDRSLVAVTAKTNRSKADQ
                     DPSTWLPPLADARCTYAADWVATKLRWGLTVDQPEADALTTLAESCGQQPLDFEPATD
                     PSK"
     sig_peptide     87065..87148
                     /locus_tag="Sfla_6732"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 28"
     misc_feature    87263..87670
                     /locus_tag="Sfla_6732"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            complement(87859..88590)
                     /locus_tag="Sfla_6733"
                     /db_xref="GeneID:11372392"
     CDS             complement(87859..88590)
                     /locus_tag="Sfla_6733"
                     /inference="protein motif:PFAM:PF09352"
                     /note="PFAM: Domain of unknown function DUF1994;
                     KEGG: sco:SCP1.323c putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1994"
                     /protein_id="YP_004927376.1"
                     /db_xref="GI:357415641"
                     /db_xref="InterPro:IPR018532"
                     /db_xref="GeneID:11372392"
                     /translation="MRRSRVAALAAVVLSATLISCNPQLADDKPNGSTPTSTGSAASP
                     APGGPEPGAGALTLAAAIEAIPDGDERRDGYERDSFRHWIDEDDDGCETRAEVLLEEA
                     TTKPEQGDRCKLAGGVWMSYYDEVEVTDAKKLDIDHMVPLAEAWDSGAYDWTPERRQA
                     YANDLGSDRSLVAVTAKTNRSKADRDPAQWLPPAKSAHCTYAADWTAAKLRWKLNADK
                     VEKTALLDLAKDCTDTVVEFEEAAE"
     sig_peptide     complement(88510..88590)
                     /locus_tag="Sfla_6733"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.989 at
                     residue 27"
     misc_feature    complement(87910..88314)
                     /locus_tag="Sfla_6733"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            88865..89341
                     /locus_tag="Sfla_6734"
                     /db_xref="GeneID:11372393"
     CDS             88865..89341
                     /locus_tag="Sfla_6734"
                     /inference="similar to AA sequence:KEGG:Snas_3615"
                     /note="KEGG: sna:Snas_3615 TrwC relaxase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927377.1"
                     /db_xref="GI:357415642"
                     /db_xref="GeneID:11372393"
                     /translation="MSAWLTPDQVASGALSLGYAMMIAALQGMTCDTSLLYGHGANAF
                     ATYPGLTRGKKANHLWLPLAVIESEDTRARLGDARTEEERLERAVDAFARYLGQSRPD
                     AMVSDLLHEPPAPAPVVVLSPNRTPTPSGPARHAPGRPPSTTNASTKPNHSSVSTS"
     misc_feature    <89189..>89335
                     /locus_tag="Sfla_6734"
                     /note="biotin carboxyl carrier protein of acetyl-CoA
                     carboxylase; Region: PLN02983"
                     /db_xref="CDD:215533"
     gene            complement(89760..90410)
                     /locus_tag="Sfla_6735"
                     /db_xref="GeneID:11372394"
     CDS             complement(89760..90410)
                     /locus_tag="Sfla_6735"
                     /inference="similar to AA sequence:KEGG:Sros_5765"
                     /note="KEGG: sro:Sros_5765 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927378.1"
                     /db_xref="GI:357415643"
                     /db_xref="GeneID:11372394"
                     /translation="MLIVNAVLETPDTVDFSLWPVADLPPYQFMALSGGMSPLEVGSA
                     LAMLADYNSRTGDDDRPVMDASEAIRRLLETDKVIAPGGLRFHDTRINAIVQPGCCCG
                     LEDWREWLDVAGGETLWLGHDPSPRLEHADGSVQLWPDGGDAQETPPGQPIDIVAGDL
                     PGILHTVQEGLQGFLALTMKWAARQSPTLAADLAARLDADLVISAPLPGTSGQHVP"
     gene            90541..91164
                     /locus_tag="Sfla_6736"
                     /db_xref="GeneID:11372395"
     CDS             90541..91164
                     /locus_tag="Sfla_6736"
                     /inference="similar to AA sequence:KEGG:468436"
                     /note="KEGG: ptr:468436 centrobin, centrosomal BRCA2
                     interacting protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927379.1"
                     /db_xref="GI:357415644"
                     /db_xref="GeneID:11372395"
                     /translation="MGQSRPDAMVSDLLHEPPAPAVMPSPTRTHAVRASAARARSTTV
                     HDQRQRAAQPQREYRLTDAQKQRLADMQEERELAGVRAWNRRPYGDRTDQELTRLIAN
                     GPVDARREDRAAAAAEESERALLQEIAEAEAGGTSLGQIEVAPIYVLLDQADEHLAAA
                     RVEQAREQAPPRSPRPPTNTFGSSGPLTARAASRCAWRAPPARSTPS"
     gene            91128..91670
                     /locus_tag="Sfla_6737"
                     /db_xref="GeneID:11372396"
     CDS             91128..91670
                     /locus_tag="Sfla_6737"
                     /inference="similar to AA sequence:KEGG:CHLREDRAFT_195007"
                     /note="KEGG: cre:CHLREDRAFT_195007 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927380.1"
                     /db_xref="GI:357415645"
                     /db_xref="GeneID:11372396"
                     /translation="MAGTSRKEHTQLTKQAEAARAAAWREGADARVAARQAAADAWKV
                     LRDSPYVTVLGATERQAPDVDTLATRLAEMRETKVPARAQQKDTGDEKRVARCHGQAT
                     TARENAAMYRAVAADARTEKTLRAQIAEQHPRLHESEVRARTELQQARDARTTRVAAQ
                     SSRSYQPPSQARSGPSRGRR"
     gene            complement(91807..92067)
                     /locus_tag="Sfla_6738"
                     /db_xref="GeneID:11372397"
     CDS             complement(91807..92067)
                     /locus_tag="Sfla_6738"
                     /inference="similar to AA sequence:KEGG:SGR_7096t"
                     /note="KEGG: sgr:SGR_7096t hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927381.1"
                     /db_xref="GI:357415646"
                     /db_xref="GeneID:11372397"
                     /translation="MTTPTNDDGTTSSHNQVQPAPPVQVASGSGPLLTSHAALILLTA
                     VMVGGAVAVLTYLSASNGAAAALAGLMGAGASTPVLHTLIGS"
     gene            92544..92789
                     /locus_tag="Sfla_6739"
                     /db_xref="GeneID:11372398"
     CDS             92544..92789
                     /locus_tag="Sfla_6739"
                     /inference="similar to AA sequence:KEGG:SGR_308"
                     /note="KEGG: sgr:SGR_308 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927382.1"
                     /db_xref="GI:357415647"
                     /db_xref="GeneID:11372398"
                     /translation="MFGTEHDAPTTGQQPGHTYRELVGGPLDGQLIEVTGWTDEEITT
                     GARLITPHSAYGPGGRASYGPTFSRPDGPWVWEGDLP"
     gene            92902..93192
                     /locus_tag="Sfla_6740"
                     /db_xref="GeneID:11372399"
     CDS             92902..93192
                     /locus_tag="Sfla_6740"
                     /inference="similar to AA sequence:KEGG:292918"
                     /note="KEGG: rno:292918 otogelin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927383.1"
                     /db_xref="GI:357415648"
                     /db_xref="GeneID:11372399"
                     /translation="MSCTCAEGFTVQLHDGGTRYPVVPVDQHTEISYYFDARCTRCRS
                     KYEAPFARVDSKGQALTDQMQDVPVVDRVWFSKQCGPFTCGCGEESQAGDPA"
     gene            94857..95864
                     /locus_tag="Sfla_6741"
                     /db_xref="GeneID:11372400"
     CDS             94857..95864
                     /locus_tag="Sfla_6741"
                     /inference="protein motif:PFAM:PF01022"
                     /note="KEGG: sgr:SGR_7060t ArsR family transcriptional
                     regulator;
                     PFAM: regulatory protein ArsR;
                     SMART: regulatory protein ArsR"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_004927384.1"
                     /db_xref="GI:357415649"
                     /db_xref="GO:0003700"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:11372400"
                     /translation="MLRIHFTSKDLARVTLGYNSSLPVSEAVMSLQALRRGSGPKFSA
                     WRHHLAGKQLPARVSLLGSLVPASGWAPDFLTPGPEHASPTTGAFDVIRATPRRRLAA
                     ELHRLSSHHRLPAWTHLLADGDREALDTVTDTLAAYYDVAVTPYADRMRAVLDADHAW
                     RVHTMARLGVGAVLAGLHPQVRWEEPVLELAGFAGQGQVDFHLEGRGLLLSAHIFCGS
                     RPRALLNEVGTPVLVYAPVWNLQSDSLVAAPADARPHVSTALAALLGRTRAAVLEALA
                     TPAGHNTKQLAERLAISPASASEHVAALRAAGLVTSLRHANMVRHTATTLGKNLISTA
                     T"
     misc_feature    95634..95828
                     /locus_tag="Sfla_6741"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(95634..95639,95643..95645,95652..95654,95661..95666,
                     95673..95678,95685..95687,95778..95780)
                     /locus_tag="Sfla_6741"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(95637..95642,95652..95660,95700..95708,95733..95744,
                     95748..95753,95760..95765,95769..95774,95790..95798,
                     95811..95819)
                     /locus_tag="Sfla_6741"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    95646..>95849
                     /locus_tag="Sfla_6741"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    order(95700..95702,95709..95711)
                     /locus_tag="Sfla_6741"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            96275..96848
                     /locus_tag="Sfla_6742"
                     /pseudo
                     /db_xref="GeneID:11372401"
     gene            complement(96903..97898)
                     /locus_tag="Sfla_6743"
                     /db_xref="GeneID:11372402"
     CDS             complement(96903..97898)
                     /locus_tag="Sfla_6743"
                     /inference="similar to AA sequence:KEGG:ABC2526"
                     /note="KEGG: bcl:ABC2526 competence protein/transcription
                     factor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927385.1"
                     /db_xref="GI:357415650"
                     /db_xref="GeneID:11372402"
                     /translation="MQDDLLVVGFDLETRREVHVSEREPEHWKRLGYGGAGQLVCFYC
                     FHGFEAPAGTRVPLVTRGRLGGKVRRHFAHPPGQAPTGGHGPETVWHITTKHLLAAWA
                     RSRPGVDRVRLEQWTEDHDRRADVEVLLQDGTKVALEAQRKLMTDDGWRARHRDYARQ
                     GVVDVWFWRPRVHFPHVVLDEGLPVWFYSVSKREAATSLGRPHARVHRWWQVPDLAVF
                     GLHHPPCALDELERVTIPLGALGLGPGGAVLPEDLQKRVLDSQRETREEAKRRKDSEA
                     RYARAARESQERAARAPAPVPLPPLPPVPAGGLRCEVCRRPLDPLLARTRRHILC"
     misc_feature    complement(<97401..97712)
                     /locus_tag="Sfla_6743"
                     /note="Competence protein CoiA-like family; Region: CoiA;
                     cl11541"
                     /db_xref="CDD:264414"
     gene            98502..99203
                     /locus_tag="Sfla_6744"
                     /db_xref="GeneID:11372403"
     CDS             98502..99203
                     /locus_tag="Sfla_6744"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11;
                     KEGG: sma:SAV_2064 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="YP_004927386.1"
                     /db_xref="GI:357415651"
                     /db_xref="GO:0008168"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:11372403"
                     /translation="MSSAMTEPTYLHTTRVAYDTVAENYAKLVPSAFEDDLYGRAMIS
                     TFAELTRALDSGPVADLGCGPGHVTAHLQSLGVTAFGIDLSPETVAVARRRHPELQFD
                     EGSMTDLDLADGSLGGVIAWYSIVHTPPELLPVIFAEFHRVLASAGHLLIAFKAGDRL
                     RHLENAYGHELSLDVYWVSPDRIAELLAQAGLMVDARLIREPNEQEKPRQGQQAYLLA
                     RKPVEQGARAADTIA"
     misc_feature    98673..99074
                     /locus_tag="Sfla_6744"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    98673..98963
                     /locus_tag="Sfla_6744"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(98682..98702,98748..98753,98811..98819,98865..98867)
                     /locus_tag="Sfla_6744"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(99240..99602)
                     /locus_tag="Sfla_6745"
                     /pseudo
                     /db_xref="GeneID:11372404"
     gene            complement(99708..100898)
                     /locus_tag="Sfla_6746"
                     /db_xref="GeneID:11372405"
     CDS             complement(99708..100898)
                     /locus_tag="Sfla_6746"
                     /inference="similar to AA sequence:KEGG:CAP2UW1_1872"
                     /note="KEGG: app:CAP2UW1_1872 restriction modification
                     system DNA specificity domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927387.1"
                     /db_xref="GI:357415652"
                     /db_xref="GeneID:11372405"
                     /translation="MSNDWEWVELGVLADFVGYGITRPGRQDPKGVPMLRAGDIANGR
                     IRATGPMLISRDVDGANPQTRLRLGDVVVVLVGRVGEAASVTGEHEDWNTARSVAVVR
                     CAAPALAEWVRVWLTAPAARAWCVAHASGSAQATLGLAKLRRLPVPMPPLGVQDRVLR
                     TVKTIEARIEANERIAETAVALADAHFAVATADRRNWPQHRFKDVVKARTGAAAKPSE
                     PVSEGAGTAWAAPADVMRSPLPYLDQTAERVAEGADGDHEVCPPDTVLVAPKAGEVQA
                     AVNRMPVVAGRGVLAVRPHGPFDGWWLLHEIRSRSGELSALGQGTAGRELSARAFLYA
                     AVSWPPVEARGRFVRLAAPLHARALTAVRENRSLRLLLAESLRREVPATLPAVAFATV
                     PASR"
     misc_feature    complement(99753..100886)
                     /locus_tag="Sfla_6746"
                     /note="EcoKI restriction-modification system protein HsdS;
                     Provisional; Region: PRK09737"
                     /db_xref="CDD:236619"
     misc_feature    complement(100374..>100529)
                     /locus_tag="Sfla_6746"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            complement(100895..102280)
                     /locus_tag="Sfla_6747"
                     /db_xref="GeneID:11372406"
     CDS             complement(100895..102280)
                     /locus_tag="Sfla_6747"
                     /inference="protein motif:PFAM:PF02384"
                     /note="PFAM: N-6 DNA methylase;
                     KEGG: nda:Ndas_3080 site-specific DNA-methyltransferase
                     (adenine-specific)"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_004927388.1"
                     /db_xref="GI:357415653"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0008170"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR003356"
                     /db_xref="GeneID:11372406"
                     /translation="METTEYSQVVGKALDKLRGPLDIQDAQQLLLAVIFLRCVSDIPA
                     GGASGDRPQWRQLAELGSSLAGDHELTWALKQALDAWTSSYLDGGRPMSESIPDHLVA
                     GPLLREVLGLVDRADRLVELYEECLERFSNNKKGGNYFTPRHLVRLLVEMLAPRQGEQ
                     VFDPACGSGGFLVESARYVQEHGGSSAAVGLVGRDINPRARQVAWMNLTARGLEADLG
                     SRPVNSLWADDTPAGAFDVVFVNPPFNLKLARDDLRYDSRWRYGEPPRSNANFAWIQH
                     VVSKLTTRGRAAMLLPDGATFTSGAAAGIRRGLVADDLVSAVVALPAGLFPHTSISAS
                     AWIFSREKPAERRGQVLFVDARKQGNLVGRGRRTLSEGAIESIADTYRSWYAESYQDR
                     PGWCRSATVEEIAAQEFNLQAVRYVGAPAEAPAPQSAEQRVAELTRELYGHFADAARL
                     ETEIRDILGEL"
     misc_feature    complement(101015..101932)
                     /locus_tag="Sfla_6747"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
                     /db_xref="CDD:251262"
     misc_feature    complement(<101549..101800)
                     /locus_tag="Sfla_6747"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(101558..101560,101603..101611,
                     101693..101698,101771..101791))
                     /locus_tag="Sfla_6747"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(102286..102483)
                     /locus_tag="Sfla_6748"
                     /db_xref="GeneID:11372407"
     CDS             complement(102286..102483)
                     /locus_tag="Sfla_6748"
                     /inference="similar to AA sequence:KEGG:SCO5609"
                     /note="KEGG: sco:SCO5609 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927389.1"
                     /db_xref="GI:357415654"
                     /db_xref="GeneID:11372407"
                     /translation="MNQSPGRRVHRICTAGSLSLNVALSAGVVMYGLGSSSGEAIAAG
                     GGAFVAVMALALAIISALQLD"
     sig_peptide     complement(102403..102483)
                     /locus_tag="Sfla_6748"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.752) with cleavage site probability 0.303 at
                     residue 27"
     gene            102725..103753
                     /locus_tag="Sfla_6749"
                     /db_xref="GeneID:11372408"
     CDS             102725..103753
                     /locus_tag="Sfla_6749"
                     /inference="similar to AA sequence:KEGG:SCP1.149c"
                     /note="KEGG: sco:SCP1.149c hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927390.1"
                     /db_xref="GI:357415655"
                     /db_xref="GeneID:11372408"
                     /translation="MADRPSGPLTPTRAPKRNRRRSGPPSVLDFPPVPNGVDYLRSVV
                     THLNPATGGSPRDIKYAVLHLQAAAEVLLKARLSREHWSLIFADPRTATSDAYAEAKF
                     TSCTTGAAVERLRNIAGVSISDKEADALDKLADDRNALQHYGLTFNAKVIEARAATVL
                     DFLVRFIDEHLEPELRKSGPLYLEMEVVRRGLKDIQSFVTKRMNRLRGNELKDAENRT
                     LRCPDCQQLAMLAEAGRSRCCFCGKAWPAYDLADLLRTDEQPEPLDQCPGCYVPTLAD
                     NAVFADGKPTLFCTNCAGRFAPAELGNCAACGCYCSTSDTGGQDLCIFCAEDIRRQEQ
                     EDHERFWM"
     gene            103794..104885
                     /locus_tag="Sfla_6750"
                     /db_xref="GeneID:11372409"
     CDS             103794..104885
                     /locus_tag="Sfla_6750"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein;
                     KEGG: mau:Micau_3171 integrase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_004927391.1"
                     /db_xref="GI:357415656"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:11372409"
                     /translation="MTTTPPAPVPGPRATLTAFRRDPRELWPEYARKLYDHLAAHYGE
                     DDPLPTLAASWIAHQRSLNTQKSYARGFRIFEEFAREHGAHPLTVSFPLADTFRLYLE
                     TTPTWVRVKGGRRGEMVRAGEPYSDASRANALSASSSFYSYLDIVSDTPLKNPFDAVR
                     RPVIDPGYSPTPGYTEAQWAALVVTARDHHRVAAYRKRAYAILLLLYTCCLRIDSLLS
                     AKVEHLGYDQGHHVIKVKVKGGSWRNKPIPPIAWDALQDYLDGRKTGWLICTASGGQL
                     DEPAVWQLLQSLAKRAGLPPRGPHGVKGDAVTHALAKKDARPDKIQRWADHHDSRTTQ
                     RYNRRKDNLDSPGYGIGADLAETLADTPT"
     misc_feature    103926..104801
                     /locus_tag="Sfla_6750"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    103956..104225
                     /locus_tag="Sfla_6750"
                     /note="Phage integrase, N-terminal SAM-like domain;
                     Region: Phage_int_SAM_1; cl12235"
                     /db_xref="CDD:245915"
     misc_feature    104376..104801
                     /locus_tag="Sfla_6750"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(104427..104432,104505..104507,104688..104693,
                     104799..104801)
                     /locus_tag="Sfla_6750"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(104427..104429,104505..104507,104691..104693,
                     104700..104702,104772..104774,104799..104801)
                     /locus_tag="Sfla_6750"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(104427..104429,104691..104693,104700..104702,
                     104772..104774,104799..104801)
                     /locus_tag="Sfla_6750"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(104427..104429,104700..104702,104799..104801)
                     /locus_tag="Sfla_6750"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(105047..105370)
                     /locus_tag="Sfla_6751"
                     /db_xref="GeneID:11372410"
     CDS             complement(105047..105370)
                     /locus_tag="Sfla_6751"
                     /inference="similar to AA sequence:KEGG:Amir_0581"
                     /note="KEGG: ami:Amir_0581 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927392.1"
                     /db_xref="GI:357415657"
                     /db_xref="GeneID:11372410"
                     /translation="MTVTQADLNALSVAHPNLNANGYGSSAFAPQPVRLDEVQAAYAW
                     IAEQTWLTVPAESSYSLKHVMERVTGMYVTNGAFIAAALLHAPAGLEVQLDDLNPAIG
                     IKVEG"
     gene            complement(105471..105802)
                     /locus_tag="Sfla_6752"
                     /pseudo
                     /db_xref="GeneID:11372411"
     gene            105978..106855
                     /locus_tag="Sfla_6753"
                     /pseudo
                     /db_xref="GeneID:11372438"
     gene            complement(106950..107684)
                     /locus_tag="Sfla_6754"
                     /db_xref="GeneID:11372412"
     CDS             complement(106950..107684)
                     /locus_tag="Sfla_6754"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: sco:SCP1.209c hypothetical protein;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004927393.1"
                     /db_xref="GI:357415658"
                     /db_xref="GO:0043565"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:11372412"
                     /translation="MGRPEKPIRTLNPHLLMLATHLRETREEAGLTYAELAARTRHNW
                     SATTLQRAASGERIPRLEVVEAYVLACGARSAERARRLWRHARSYEHGADYTNAPRPR
                     LVESAADLRAALRATYYKAGAMPLREMERRAGLGRLPRTTVRRMLDGATMLDQEQLRS
                     FLTVCDVPERDHQDWLDAWTRVWKRNTVDGLYERSFADEMIVRLAVTTKAMGRQLMGP
                     PLARQRNIRRTLSPFAEGNLGTTQAG"
     misc_feature    complement(107469..107621)
                     /locus_tag="Sfla_6754"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(107523..107525,107604..107606,
                     107616..107618))
                     /locus_tag="Sfla_6754"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(107526..107528,107607..107609))
                     /locus_tag="Sfla_6754"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(107520..107525,107535..107537,
                     107544..107546,107583..107588))
                     /locus_tag="Sfla_6754"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(107693..107926)
                     /locus_tag="Sfla_6755"
                     /db_xref="GeneID:11372413"
     CDS             complement(107693..107926)
                     /locus_tag="Sfla_6755"
                     /inference="similar to AA sequence:KEGG:Rsph17025_1887"
                     /note="KEGG: rsq:Rsph17025_1887
                     phosphate-starvation-inducible E"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927394.1"
                     /db_xref="GI:357415659"
                     /db_xref="GeneID:11372413"
                     /translation="MSRRRHAAGVRLPAPHRLTGTETAVIIVIILTSTALAWGGMDPN
                     ILVQLLASVLLLSVGSVVTLRFVRRAPLPLSRV"
     gene            complement(109019..109810)
                     /locus_tag="Sfla_6756"
                     /db_xref="GeneID:11372439"
     CDS             complement(109019..109810)
                     /locus_tag="Sfla_6756"
                     /inference="similar to AA sequence:KEGG:TVAG_491110"
                     /note="KEGG: tva:TVAG_491110 B-box zinc finger family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927395.1"
                     /db_xref="GI:357415660"
                     /db_xref="GeneID:11372439"
                     /translation="MTTAAFSDDDGDPLEELRDTQDAVRRAADAVSASFADLLAPQRE
                     VARLARETLMPAIDASRFINEVLAPQRAFQGQMRAMMQDITSMQRLVVPNPLDGVLAQ
                     IRENQQQYQDTFSRLTDGLVPRIDTSFLDGLLHDTVPWQGLSGPGRDILAGVLDDARA
                     SVEAGEEREVPEEMVTELEEQAAQFATSAPGLLPPAAQKYLFAVFTAGMVMTTLMYVS
                     VVSDAGNAVLDEVYQHGELAIIVFTAACLAWDRRQRNRGDDGGGD"
     gene            109972..110199
                     /locus_tag="Sfla_6757"
                     /pseudo
                     /db_xref="GeneID:11372414"
     gene            110485..111699
                     /locus_tag="Sfla_6758"
                     /db_xref="GeneID:11372415"
     CDS             110485..111699
                     /locus_tag="Sfla_6758"
                     /inference="similar to AA sequence:KEGG:SAP1p71"
                     /note="KEGG: sma:SAP1p71 putative plasmid partitioning
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid partitioning protein"
                     /protein_id="YP_004927396.1"
                     /db_xref="GI:357415661"
                     /db_xref="GeneID:11372415"
                     /translation="MASPYPGGEREKLVSKLPATLRQALKVRAAQLSTDVQDAVAAGI
                     QAWRDHPDQLPAVDTAGAESFGTYLPEGLYDGFKADCRTREVSYIQGLAQSVALWLAQ
                     NPAASAQPVRRLIVCNQKGGVGKTSVAAGLAQALAEGAEHILKAALAAGLSNEDAQSL
                     AQAGGQRVLLVDYDPQGHLSHQLGLKAIPAGEESLVTHMLHRDQAQHSLLDLTIPIDG
                     ERFGDQLHILPAAFDAFLLDSGLTIFRGPRHAALERALAPIEEHFDVIVIDSPPSLGL
                     SMDAGLYYGRQREDERPAASGLIIPVEAEDTSAQAYGMLINQVDSLARDYDIQIDQLG
                     LVVNKFDSRRGYIATSSRDKWMQLGTPPVLAVVPDLKEQREAVRLQKALLAYAPTSEQ
                     SHAMRQIAKGLK"
     misc_feature    110818..111687
                     /locus_tag="Sfla_6758"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    110821..111498
                     /locus_tag="Sfla_6758"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    110842..110862
                     /locus_tag="Sfla_6758"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(110860..110862,111289..111291)
                     /locus_tag="Sfla_6758"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            111702..112802
                     /locus_tag="Sfla_6759"
                     /db_xref="GeneID:11372416"
     CDS             111702..112802
                     /locus_tag="Sfla_6759"
                     /inference="protein motif:TFAM:TIGR00180"
                     /note="KEGG: sco:SCP1.139 plasmid partitioning protein,
                     ParB1;
                     TIGRFAM: parB-like partition protein;
                     PFAM: ParB domain protein nuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="parB-like partition protein"
                     /protein_id="YP_004927397.1"
                     /db_xref="GI:357415662"
                     /db_xref="GO:0003677"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="GeneID:11372416"
                     /translation="MSKADSLGGSATFEAVAQPISSRAASFARFAGQDAPTGPGNTPT
                     EAATASPRLPITAIARNPYNPREELKAIEEMADSLTSRGIIQPLTVVTRSAFLAAHPG
                     QDEALGTAQYVVVDGNRRLAGAKVAGIDDVPVHIDDSLADDADTLLETALTAAVQHED
                     LDPLDEAKALQRLVEVHGSQRAVARSLGKSSGWVTQRLALLKLTPDLQQAVEDKKLPV
                     EVARTVGQLPEQQQGGAAEAALVKREQKKATRKRGAYAVSTPAGSAAGPAKTAVPTAP
                     SATSSSHQASTPAQHDLGADHMPWADGAAVMDTVFARLNPAQRSAFILRYFQISRGVE
                     DVVADMYGDLTPENRAALAVILDQVATQLRKA"
     misc_feature    111858..112133
                     /locus_tag="Sfla_6759"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     misc_feature    112236..112454
                     /locus_tag="Sfla_6759"
                     /note="KorB domain; Region: KorB; pfam08535"
                     /db_xref="CDD:254862"
     gene            complement(112950..116567)
                     /locus_tag="Sfla_6760"
                     /db_xref="GeneID:11372417"
     CDS             complement(112950..116567)
                     /locus_tag="Sfla_6760"
                     /inference="protein motif:SMART:SM00382"
                     /note="SMART: AAA ATPase;
                     KEGG: sro:Sros_3050 NTPase (NACHT family)-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein with Nacht
                     domain protein"
                     /protein_id="YP_004927398.1"
                     /db_xref="GI:357415663"
                     /db_xref="GO:0000166"
                     /db_xref="GO:0017111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007111"
                     /db_xref="GeneID:11372417"
                     /translation="MVWDKKPGVAASATGAARADSGGLANSGVLHVEKLYQYAPTVEA
                     PSTEEVTAAVEAYAQRVREVFGRLDLEVLTPLSEQGEHPVVELREVFVPPLVRADPPA
                     VELPRELMRRLMEHGEITELGDLPPGADKGALARIREAYRQRPPKQVLHVLADGDVER
                     TALLGDPGAGKSTLARYLALTLTSPVMPEPLSALAGKLPIVVELRRYADERWRDRTFE
                     DFLEHLHSLEGMSVPRPVLDVLLQQQRVVMVFDGLDELFDPAVRNETSRRIGAFAARH
                     PGVRIVVTSRVIGYQRAILDGAGFKHYMLQDLDEDQIGEFARLWYTNACPHDASLAQN
                     LVERVTSAVAHSRPVRELAGNPLLLTILAIIGRRQTLPRDRQGVYKHAVTVLVAHWDR
                     DAKQLTTTGAPEALEVLGADERLELLRLLARRMQDGQGGIAGNHIHARDLEAVFGEYL
                     SEYELPPVQAKAAARGMVAQLRERNFILSRYGGEVYGFVHRAFLEYLAAADIAHRYKE
                     DREWTPEELITSVVEQRADDPAWHEVILLVIGQIPERDAARAIDRLLYMHQQCANRNN
                     RMLVLTIRALAEVRKIGALAPQSRAVVDSLRSAVSHSHYPGAAELQASLPALGTFNEY
                     WTGRQRYLHWFLLLGQHQVKTYDSATVASALYLSLSEPSVLAHFSPSADVRRSSLQHV
                     VDHLDDPTATLALLLDRATTDPHEGPRFIALQLLAERFAKEPGTLALLLDRATTDPHE
                     NPRCTALQLLAERFANEPRTLALLLDRATTDPHENPRCTALQSLAERFANEPRTLALL
                     LDRATTDPHENPRCTALQSLAEHFANEPGTLPLLTDHATDPHEKLRYTALQLLAEHFA
                     NEPGTLPLLTDHATDPHPTPRYIVFQLLAQHFANEPGTLPLLTDHATTDPHPTPRFLA
                     LHLLAQSFAKEPGTLALLLDRATTDPHEDPRDIALNLLAQSFANEPCTLALLLDRATT
                     DPHENPRYTALQLLAEHFTKEPGTLALLLDRATTDPHEEPRYTALQLLADHFANEPGT
                     LALLLDRATTDPHEEPRCTALQLLADHFANEPGTLALLLDRATTDPHEEPRYTAFELL
                     TQRFLEQPETLVFLQGRTRTEREPVLRARAFRALAAALPSGDVYEVGTSALEDDHSDV
                     RAGGAWILAFGCPNDPRGRAVLRDHAQSDPHADVRTAASDALRAAEVLSAQEWKLGSA
                     I"
     misc_feature    complement(115596..116090)
                     /locus_tag="Sfla_6760"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     misc_feature    complement(114111..114389)
                     /locus_tag="Sfla_6760"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(113952..114185)
                     /locus_tag="Sfla_6760"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(113403..113681)
                     /locus_tag="Sfla_6760"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(113001..>113162)
                     /locus_tag="Sfla_6760"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            117149..119215
                     /locus_tag="Sfla_6761"
                     /db_xref="GeneID:11372418"
     CDS             117149..119215
                     /locus_tag="Sfla_6761"
                     /inference="protein motif:PFAM:PF00931"
                     /note="PFAM: NB-ARC domain protein;
                     KEGG: sgr:SGR_6341 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NB-ARC domain protein"
                     /protein_id="YP_004927399.1"
                     /db_xref="GI:357415664"
                     /db_xref="GO:0005524"
                     /db_xref="InterPro:IPR002182"
                     /db_xref="GeneID:11372418"
                     /translation="MKWRRTGQSPSSHASKGNSVRSASVKGSSDPIPADDGAAEKGPH
                     EPATSAAPGTEPAVHLERSGNASASAAQAVAISGHVGHLTVSQSPPRAPVQWPLRLGS
                     VPPLASAFQDRTEVRDQIDQARVSHDTVVLSQVLAGGGGVGKTQLAAVYAHQSLAAGV
                     ELVVWVDASETEQVIARYAQAAYWVQAAEGPAGKAEQDARAFLQWLATTSRSWLLVLD
                     DVTDLEGLQPWWPPPSSGGGGRVLATTRRHDALLSGGGRAVVNIDTYNAEEADTYLSE
                     RLRVANAVHLLDAQAGKVAEALGYLPLALAHAAAYMVNEDVPCTDYLHRFNDSTVRMS
                     ALLPRQADTEGYGRRVAAALMLSLDIAQQCEPVGLAIPALRLASVLDPAGHPRSFWTS
                     EAATRYLSAHRLGPISAARSSDDVQAEGRSVIRLLHRYGLLIDDAQAGPRAVRVHALT
                     ARAVREHTPSDALPDIVKTAADALAELWWTVPPIYREERAVLRTNIDSLDGHAGDLLW
                     EVEGHHLLRWAGRSLTGYGLATAAVHYWQQLTATSERLLGRTHPHTLAVRRDLAVAYF
                     RADNPKQGFAMLQEDFHHQEHVLSLARPTAGEAGTTSQLEGTGTAIELLEDTLAARER
                     LLGPEDPAALNARVQLALAYRHAGMTKNATLTLSALTTDTPQRTRQPGQRAPAHRLQR
                     WWERKR"
     misc_feature    117554..>117886
                     /locus_tag="Sfla_6761"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            120058..120327
                     /locus_tag="Sfla_6762"
                     /db_xref="GeneID:11372419"
     CDS             120058..120327
                     /locus_tag="Sfla_6762"
                     /inference="similar to AA sequence:KEGG:YALI0F19030g"
                     /note="KEGG: yli:YALI0F19030g YALI0F19030p"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927400.1"
                     /db_xref="GI:357415665"
                     /db_xref="GeneID:11372419"
                     /translation="MSIVVIAGLAVIALGNPSSSADGPEKTPRPASPSVYPVKFPKTR
                     KSTAKPRPQPTVSYPIRFPQASKTAARPRPRSTVTYPIPWDRSAR"
     sig_peptide     120058..120123
                     /locus_tag="Sfla_6762"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.816 at
                     residue 22"
     misc_feature    <120070..>120306
                     /locus_tag="Sfla_6762"
                     /note="Protein of unknown function (DUF4106); Region:
                     DUF4106; pfam13388"
                     /db_xref="CDD:257714"
     gene            120324..121031
                     /locus_tag="Sfla_6763"
                     /db_xref="GeneID:11372440"
     CDS             120324..121031
                     /locus_tag="Sfla_6763"
                     /inference="protein motif:PFAM:PF04471"
                     /note="PFAM: restriction endonuclease;
                     KEGG: sco:SCO7763 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="YP_004927401.1"
                     /db_xref="GI:357415666"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004519"
                     /db_xref="InterPro:IPR007560"
                     /db_xref="GeneID:11372440"
                     /translation="MTARRPAPRRRPRRSPARSRKRKQAHTGGEILVGVVVIGWLSSQ
                     LMHWLAAHPWVPLLLALLAGAGAFIWFRSRVQAQALLHTQVRALRYPMAALDGLQHRQ
                     FEHAIRDLMLRDGCADAVQVGGAGDNGADVKATDPYGRRWVIQCKHRRAGLAGAAVGT
                     PDLHVLNGTGRPVHKGDVIVLVTNGRFTKPATEFARSQRLHLVDRHTLATWAAGSQPL
                     WELLRAVPPPRRPTTLS"
     misc_feature    120606..120956
                     /locus_tag="Sfla_6763"
                     /note="Restriction endonuclease; Region: Mrr_cat;
                     pfam04471"
                     /db_xref="CDD:252617"
     gene            121177..121422
                     /locus_tag="Sfla_6764"
                     /db_xref="GeneID:11372441"
     CDS             121177..121422
                     /locus_tag="Sfla_6764"
                     /inference="similar to AA sequence:KEGG:SCAB_0211"
                     /note="KEGG: scb:SCAB_0211 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927402.1"
                     /db_xref="GI:357415667"
                     /db_xref="GeneID:11372441"
                     /translation="MESFPFPDDLIHAQQAWHATYRQLATPRPRHTAALRRRLLALSV
                     RIQWHPFWSTPSGRLPAARAELKRLARHHGQLEARTA"
     gene            complement(121569..125354)
                     /locus_tag="Sfla_6765"
                     /db_xref="GeneID:11372420"
     CDS             complement(121569..125354)
                     /locus_tag="Sfla_6765"
                     /inference="protein motif:PFAM:PF00515"
                     /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
                     protein;
                     KEGG: amd:AMED_4366 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide TPR_1 repeat-containing
                     protein"
                     /protein_id="YP_004927403.1"
                     /db_xref="GI:357415668"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:11372420"
                     /translation="MSGSGTRRLSRGELIRQRAKARFVGRRAQLALFTENLSKDPLSE
                     EAPADFLFHVRGVGGVGKSTLLRQWQEAARRAEAVTAVVDENDVHGVQQAMVELARQL
                     AEQAGPCKEFDKAVEQYRREQAAQADPMLVEGEASVSSRMVTQAALGAASLIPGAGVV
                     TAMANPDAAAQGLDRIRAASRTRAQRRGGQGDETGMSRAFVCELERLCRRQRWVVLFF
                     DTWEQTAQYLDGWLLRLLDEEFGPVPANVIVVLAGRDELSEREWAPLRDQVADVPLEV
                     FTEAETRSLLTSRGVTDVGVVEAVLQLSMGLPLLVELLALARPRTSEDVDAGGNLADV
                     AVERFVQWITDPEKREAVRACALPLQLNEDVFTEAAGPGAEGLWEWLRGQPFISGRGD
                     YKHYHAVVRASMIRQQRTHSPQGWTSAHLRLAETHATWRAAVEARLPEAKRWDDAEWR
                     RHRLDETYHRLCAHPGTYLTDALEQVVQAAGQETAVLRQWIETLEQAAQDTADTTLFA
                     WTGRLRDTLTGDDPRLTCLEVLLSHSQLSSESRSWAHTHRGILLYRSDQDEEALTEFD
                     RAIAHNARNALAWARRGEEHRLLGNEDQAVADLTAALELEPTNAWALGSRGETHQQAG
                     RNQEAVADLTAALELDPTLTWALGARGDTHRQAGRYDEAVTDYTAALELDPTLTWALG
                     ARGETHRQAGRYDEAVTDYTAALELDPTYATALGARGQAHQQAGRHEQAVTDLTAALE
                     LDPTYAAALGARGDTHRLAGRYDEAVTDLTAALELDPTYAAALGARGDTHRQAGRYDE
                     AVTDYTAALELDPTYATALGARGETHRQAGRYDEAVTDLTATLELDPTYAAALGSRGD
                     AHKQASRYDEAVTDYTAALELDPTYATALGSRGDAHRQAGRYDEAVTDLTAALELDPT
                     NAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQAGRYEQAVAD
                     YTAALELDPTNAWAIGSRGQAHQQAGRYDEAVTDLTAALELDPTLTWALGARGETHQQ
                     AGRYEQAVADYTAALELDPTDDWALAQRGETHRQAGRYEQAITDYTAALELDPTDAWA
                     LGSRGQAHQQAGRYEQAVTDLTAALELDPTLDWALASRSQAHRQAGHREEARMDVEQA
                     TEAHPDDLECAFEKLMLETVEGRFEAFREQWRQLLTSPVNPQDETKASYLRLFRTVLI
                     EPEAGVPEATTGVLATHPSEGDIADAVRYLAELSVLEGEVGERARQCHDLIMRRPSS"
     misc_feature    complement(<125031..125291)
                     /locus_tag="Sfla_6765"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(123531..>123725)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(123534..123725)
                     /locus_tag="Sfla_6765"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(123588..123593,123600..123605,
                     123612..123617,123693..123698,123705..123710,
                     123714..123719))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(123549..123551,123558..123560,
                     123570..123572,123606..123608,123651..123653,
                     123660..123662,123672..123674,123708..123710))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(123327..123623)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(123384..123389,123396..123401,
                     123408..123413,123489..123494,123501..123506,
                     123510..123515,123600..123605,123612..123617,
                     123621..123623))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(123345..123347,123354..123356,
                     123366..123368,123402..123404,123447..123449,
                     123456..123458,123468..123470,123504..123506,
                     123549..123551,123558..123560,123570..123572,
                     123606..123608))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(122730..123590)
                     /locus_tag="Sfla_6765"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    complement(123123..123419)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(123180..123185,123192..123197,
                     123204..123209,123285..123290,123297..123302,
                     123306..123311,123396..123401,123408..123413,
                     123417..123419))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(123141..123143,123150..123152,
                     123162..123164,123198..123200,123243..123245,
                     123252..123254,123264..123266,123300..123302,
                     123345..123347,123354..123356,123366..123368,
                     123402..123404))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(123018..123119)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat; Region: TPR_1; pfam00515"
                     /db_xref="CDD:249923"
     misc_feature    complement(122715..123011)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122772..122777,122784..122789,
                     122796..122801,122877..122882,122889..122894,
                     122898..122903,122988..122993,123000..123005,
                     123009..123011))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122733..122735,122742..122744,
                     122754..122756,122790..122792,122835..122837,
                     122844..122846,122856..122858,122892..122894,
                     122937..122939,122946..122948,122958..122960,
                     122994..122996))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(122511..122807)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122568..122573,122580..122585,
                     122592..122597,122673..122678,122685..122690,
                     122694..122699,122784..122789,122796..122801,
                     122805..122807))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122529..122531,122538..122540,
                     122550..122552,122586..122588,122631..122633,
                     122640..122642,122652..122654,122688..122690,
                     122733..122735,122742..122744,122754..122756,
                     122790..122792))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(121941..122768)
                     /locus_tag="Sfla_6765"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    complement(122205..122501)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122262..122267,122274..122279,
                     122286..122291,122367..122372,122379..122384,
                     122388..122393,122478..122483,122490..122495,
                     122499..122501))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122223..122225,122232..122234,
                     122244..122246,122280..122282,122325..122327,
                     122334..122336,122346..122348,122382..122384,
                     122427..122429,122436..122438,122448..122450,
                     122484..122486))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(122001..122297)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122058..122063,122070..122075,
                     122082..122087,122163..122168,122175..122180,
                     122184..122189,122274..122279,122286..122291,
                     122295..122297))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(122019..122021,122028..122030,
                     122040..122042,122076..122078,122121..122123,
                     122130..122132,122142..122144,122178..122180,
                     122223..122225,122232..122234,122244..122246,
                     122280..122282))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(121812..122093)
                     /locus_tag="Sfla_6765"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(121854..121859,121866..121871,
                     121878..121883,121959..121964,121971..121976,
                     121980..121985,122070..122075,122082..122087,
                     122091..122093))
                     /locus_tag="Sfla_6765"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(121815..121817,121824..121826,
                     121836..121838,121872..121874,121917..121919,
                     121926..121928,121938..121940,121974..121976,
                     122019..122021,122028..122030,122040..122042,
                     122076..122078))
                     /locus_tag="Sfla_6765"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            126318..127103
                     /locus_tag="Sfla_6766"
                     /db_xref="GeneID:11372421"
     CDS             126318..127103
                     /locus_tag="Sfla_6766"
                     /inference="similar to AA sequence:KEGG:489964"
                     /note="KEGG: cfa:489964 Rho GTPase activating protein 17"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927404.1"
                     /db_xref="GI:357415669"
                     /db_xref="GeneID:11372421"
                     /translation="MTRPSGQTPDRSLTDGRTDDPAPSPGASRRAGRPSGALERFYGP
                     GARLSAKTADRAVFAVFPGQDRHPAPHPHRHPARFDRNAPPPHDGRVAVGMTVQTGQG
                     GGGHDGQNGRGWRSSHQRAHVWLWVRYRSGGGPGESGAAAGPCQEIPEAVRTATGPTA
                     RHRPDPPGTPCRASQPARIHPPPPRPDIRWRPAERPLAVRWEPSSNRWLDGSQTGASG
                     PPADRQRTPSGPSSGFARLTPRHPKVLSGSPDDVDEAAGLPVR"
     misc_feature    <126708..>127043
                     /locus_tag="Sfla_6766"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK12323"
                     /db_xref="CDD:237057"
     gene            127422..127601
                     /locus_tag="Sfla_6767"
                     /db_xref="GeneID:11372422"
     CDS             127422..127601
                     /locus_tag="Sfla_6767"
                     /inference="similar to AA sequence:KEGG:SCP1.339c"
                     /note="KEGG: sco:SCP1.339c hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927405.1"
                     /db_xref="GI:357415670"
                     /db_xref="GeneID:11372422"
                     /translation="MPTSDRPLLLLLLVLVVGLVLGALAYLSYEHPALTEPLTLVLAG
                     AAVLVPCIALTVTRR"
     sig_peptide     127422..127499
                     /locus_tag="Sfla_6767"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.881 at
                     residue 26"
     gene            127598..127795
                     /locus_tag="Sfla_6768"
                     /db_xref="GeneID:11372442"
     CDS             127598..127795
                     /locus_tag="Sfla_6768"
                     /inference="similar to AA sequence:KEGG:PFHG_01899"
                     /note="KEGG: pfh:PFHG_01899 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927406.1"
                     /db_xref="GI:357415671"
                     /db_xref="GeneID:11372442"
                     /translation="MSLKGRPYDGDNNSDNIPDNNSDDNGDNNGDTRKSAVLAQPQVK
                     PRFSCGEYSDFPLFSRSALLW"
     gene            128520..129395
                     /locus_tag="Sfla_6769"
                     /db_xref="GeneID:11372423"
     CDS             128520..129395
                     /locus_tag="Sfla_6769"
                     /inference="protein motif:PFAM:PF01609"
                     /note="KEGG: fal:FRAAL3080 transposase;
                     manually curated;
                     PFAM: transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_004927407.1"
                     /db_xref="GI:357415672"
                     /db_xref="GO:0003677"
                     /db_xref="GO:0004803"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:11372423"
                     /translation="MSGVGGGYPSDLTDEQWALVEPLLPPARVGPKGGRREKHPRRRI
                     VDAIFYVVRTGCAWRQLPKDFAPWPTVYWYFTWWHDDGTVERIHDALRGKVREADGRN
                     AEPSAGLIDSQSVRTADTVPVASRGFDAGKKVKGRKRFIVTDTLGLLLAVHVVAAGVQ
                     DRDGARRPLLWTRLDHPGVKKIWADQRFAGRLVDWVTQILGRELEIVRKDPDQRGFQV
                     QPKRWAVERTFSWLTAHRRLARDYEASPARSETMIRWAMIGIMVRRLTRTGPATRPGP
                     RPLTRVSAAGHATGW"
     misc_feature    128541..128882
                     /locus_tag="Sfla_6769"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    128553..128786
                     /locus_tag="Sfla_6769"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    128829..129293
                     /locus_tag="Sfla_6769"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <129144..129308
                     /locus_tag="Sfla_6769"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(129405..129806)
                     /locus_tag="Sfla_6770"
                     /db_xref="GeneID:11372424"
     CDS             complement(129405..129806)
                     /locus_tag="Sfla_6770"
                     /inference="similar to AA sequence:KEGG:SGR_6667"
                     /note="KEGG: sgr:SGR_6667 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004927408.1"
                     /db_xref="GI:357415673"
                     /db_xref="GeneID:11372424"
                     /translation="MVSDARVPFVGDFRELEQGSPDGPSLRSAVKAEASVSARELVKY
                     LRSGALLAATTTLVRDVLATDNPVIGGLHLLTDGHWLWYSDLAHYVEHYHAALDPQFI
                     AHAQANGWTVPQLDDADLLALEAVLLGDDTN"
CONTIG      join(CP002477.1:1..130055)
//
DBGET integrated database retrieval system