GenomeNet

Database: RefSeq
Entry: NC_016634
LinkDB: NC_016634
Original site: NC_016634 
LOCUS       NC_016634              19716 bp    DNA     circular CON 07-APR-2017
DEFINITION  Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence.
ACCESSION   NC_016634
VERSION     NC_016634.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603100
            Assembly: GCF_000236585.1
KEYWORDS    RefSeq.
SOURCE      Thermus sp. CCB_US3_UF1
  ORGANISM  Thermus sp. CCB_US3_UF1
            Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae;
            Thermus.
REFERENCE   1  (bases 1 to 19716)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Complete genome sequence of thermophilic Thermus sp. CCB_US3_UF1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 19716)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2011) Centre for Chemical Biology (CCB@USM),
            Universiti Sains Malaysia (USM), 1st Floor, Block B No.10,
            Persiaran Bukit Jambul, Bayan Lepas, Pulau Pinang 11900, Malaysia
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP003127.
            Bacteria available from Centre for Chemical Biology (CCB@USM)
            (info@ccbusm.edu.my).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 04/07/2017 08:43:50
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,314
            CDS (total)                       :: 2,257
            Genes (coding)                    :: 2,220
            CDS (coding)                      :: 2,220
            Genes (RNA)                       :: 57
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 48
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 37
            Pseudo Genes (ambiguous residues) :: 0 of 37
            Pseudo Genes (frameshifted)       :: 18 of 37
            Pseudo Genes (incomplete)         :: 19 of 37
            Pseudo Genes (internal stop)      :: 4 of 37
            Pseudo Genes (multiple problems)  :: 4 of 37
            CRISPR Arrays                     :: 8
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..19716
                     /organism="Thermus sp. CCB_US3_UF1"
                     /mol_type="genomic DNA"
                     /strain="CCB_US3_UF1"
                     /db_xref="taxon:1111069"
                     /plasmid="pTCCB09"
     gene            join(19473..19716,1..5)
                     /locus_tag="TCCBUS3UF1_RS11690"
     CDS             join(19473..19716,1..5)
                     /locus_tag="TCCBUS3UF1_RS11690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017136943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081477250.1"
                     /translation="MPKEGGNRKYLHVVRRGEGWAVEREGAKRASKIFRTQEEAKAYA
                     REVAEREKGEVIVHDQKGRIRERDSYGSDPHPPKDREH"
     gene            complement(2..265)
                     /locus_tag="TCCBUS3UF1_RS11335"
                     /old_locus_tag="TCCBUS3UF1_p10"
     CDS             complement(2..265)
                     /locus_tag="TCCBUS3UF1_RS11335"
                     /old_locus_tag="TCCBUS3UF1_p10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271867.1"
                     /translation="MPRRPLYDPEKFRGLPCSARLVWFHIWATGGGEYAARRLAEVLE
                     ISPNAVALALRLLVQRGLLEVVRPPAGSRAGVYRVPSRPLEKA"
     gene            complement(341..718)
                     /locus_tag="TCCBUS3UF1_RS11340"
                     /old_locus_tag="TCCBUS3UF1_p20"
     CDS             complement(341..718)
                     /locus_tag="TCCBUS3UF1_RS11340"
                     /old_locus_tag="TCCBUS3UF1_p20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271868.1"
                     /translation="MKPELAARLEEVLAALRERGRSLIAAVAAHAEARLAYEAALDAL
                     EDARARAIREGLEGRNEQARQAELLERTREQEEAARSARAVLRVAEANLEMARVAWAV
                     EKETLKALASLAEEALPEVRPRG"
     gene            complement(903..1229)
                     /locus_tag="TCCBUS3UF1_RS11345"
                     /old_locus_tag="TCCBUS3UF1_p40"
     CDS             complement(903..1229)
                     /locus_tag="TCCBUS3UF1_RS11345"
                     /old_locus_tag="TCCBUS3UF1_p40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271870.1"
                     /translation="MKELSTQAQVQVLSREGALSRAAWALIRARERVVELYGWFLAGE
                     TDSYLTPFLLARDIAEAVEEAKVLAISFAILENFSESATAFLEQARLEAARILAEKSA
                     GEEVPF"
     gene            complement(1334..1783)
                     /locus_tag="TCCBUS3UF1_RS11350"
                     /old_locus_tag="TCCBUS3UF1_p60"
     CDS             complement(1334..1783)
                     /locus_tag="TCCBUS3UF1_RS11350"
                     /old_locus_tag="TCCBUS3UF1_p60"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018461188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081477251.1"
                     /translation="MAAFAGSRHGSPWPAAPVVALVLASGGQVRVGDQRGVDWAVRLA
                     CPSAVVVEASRFPGPPAARLHQRTRAVVLGHAGLGLPPASCLLVFPPSGGAPALGPGS
                     SLALSLARGAGLPVWVAGEPSPGPGWLPLSLAGVPGWVLLPVQNKLF"
     gene            2105..2791
                     /locus_tag="TCCBUS3UF1_RS11355"
                     /old_locus_tag="TCCBUS3UF1_p70"
     CDS             2105..2791
                     /locus_tag="TCCBUS3UF1_RS11355"
                     /old_locus_tag="TCCBUS3UF1_p70"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_014271873.1"
                     /translation="MRAIPLLLVWGLSLVLALSPQGRLQGPLAVLKVVDGDTVELRGL
                     GPVRLIGIDAPESSYNRRTSGAEEVQMGLEAKAFLNRLLRGKQVWVELDLQERDRYRR
                     VLAYLYLEDTQGDWTHGGRRFRQVNLEMVRAGWAEPYTVPPNVRYAELYLQASREART
                     RGLGMWGRPSRPPGRGEGRCDPVYPAVCIPPPPPDLDCGDIPYRNFPVLPPDPHGFDR
                     DRDGVGCEGR"
     gene            complement(2800..4452)
                     /locus_tag="TCCBUS3UF1_RS11360"
                     /old_locus_tag="TCCBUS3UF1_p80"
     CDS             complement(2800..4452)
                     /locus_tag="TCCBUS3UF1_RS11360"
                     /old_locus_tag="TCCBUS3UF1_p80"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_014271874.1"
                     /translation="MTAGTHLAGAALAAGLLRGLGLEVGLVEGLALAWGSVMPDVDTT
                     TSGPGKFIRPVSSWLERRFGHRTLTHSLLFTAALALLLYPLLRANPSAYWAFLAGYLS
                     HLLLDTLNVNGVPLLWPWRVQFWFFAAREWRIRYASPQEATLALSLALFAFALWPLSA
                     QGFASAFRHLVGTPEVAVLDYLDWRERREVWAEVRGFNRETQEAVEGRFLVVEALGRE
                     GFLMEDELGRTLAVSRDGQVVAYRVRMHRGRPQVLREWRLDLSGRLLGDLLQALPRGA
                     RRVWITGEAAPATEPPPLVPPVGTYPRVKASTTPPRLVLHAARPEDLTSLAGLYLRAG
                     SAVVRAAFSPEGAGEASLALPHLPSLPRVHPVLIPDLPSLSALLVRPGDAVEEGEPLA
                     RYVDEVPLEELAQQAQSRREEASRLEGELARLEERFRSEREALMGELARAREERDRLR
                     YLVAQGAEPRLKLQEAEARTEELSARLKRLVLDYTGERARLEERLREAGLEAVRLERR
                     RDREAERQLVRSPVAGRVAEVKVRDITPKGVTVEVVVLGSGP"
     gene            complement(4449..4715)
                     /locus_tag="TCCBUS3UF1_RS11365"
                     /old_locus_tag="TCCBUS3UF1_p90"
     CDS             complement(4449..4715)
                     /locus_tag="TCCBUS3UF1_RS11365"
                     /old_locus_tag="TCCBUS3UF1_p90"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271875.1"
                     /translation="MGEAELRRKVAELEGRVRGLEAERQKLLARLAYLEASGRRSRGR
                     LSREQVLELHALLSEVWMELNATCPRLVPELDRALRLLEEVLGG"
     gene            complement(4716..5165)
                     /locus_tag="TCCBUS3UF1_RS11370"
                     /old_locus_tag="TCCBUS3UF1_p100"
     CDS             complement(4716..5165)
                     /locus_tag="TCCBUS3UF1_RS11370"
                     /old_locus_tag="TCCBUS3UF1_p100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271876.1"
                     /translation="MRFSVFSLTLFLLLSLAGCEAPVATHEEEVPLRFYRWTPGGEVP
                     PEVLSGPPLRVQVLLYRQGAEASAHLRAQGGLPAEGEAVLFLEGAGGERVAEGYSNGR
                     PFVEVRGRAGRPACAWWSVLFSPDPWRQEDAEARLYQAHGRVCEGER"
     gene            complement(5186..5863)
                     /locus_tag="TCCBUS3UF1_RS11375"
                     /old_locus_tag="TCCBUS3UF1_p110"
     CDS             complement(5186..5863)
                     /locus_tag="TCCBUS3UF1_RS11375"
                     /old_locus_tag="TCCBUS3UF1_p110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271877.1"
                     /translation="MRRWVYPFLLGMALAQAPGLTPAEVRLLDRLVEEALPRDPGYLR
                     ALADLEAARQTLGILGALSAEAGAALAGEYGQVAPAYRLSLSLNLAEVFRDRSPALRA
                     LEAQAEAAKREARVRVAGAFFRYLAAREAARTAADGVEAREAELKALQARARVGAATP
                     AEVLSAAERLSQARLALYRANLDLALAQEELARAVGLSLEALRAFLRPLEGSGGTPGT
                     PQAPKAP"
     gene            complement(5856..6056)
                     /locus_tag="TCCBUS3UF1_RS11380"
                     /old_locus_tag="TCCBUS3UF1_p120"
     CDS             complement(5856..6056)
                     /locus_tag="TCCBUS3UF1_RS11380"
                     /old_locus_tag="TCCBUS3UF1_p120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271878.1"
                     /translation="MAEFLQALEEAVWVRADATGQYYLLRAPGGPWRLYQRGIEAAFL
                     LAEGEKALLWAPEFGVLLPDHA"
     gene            complement(6065..6982)
                     /locus_tag="TCCBUS3UF1_RS11385"
                     /old_locus_tag="TCCBUS3UF1_p130"
     CDS             complement(6065..6982)
                     /locus_tag="TCCBUS3UF1_RS11385"
                     /old_locus_tag="TCCBUS3UF1_p130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271879.1"
                     /translation="MFVGRKEEGRALLLSVRAGRGVVLVGPPGYGKSALLQELRPALE
                     AWSAVLWVDKVAPFGAFLKDLFRALWDARIPVEGVDLSKDVEADLRTWGKRYPSNDEK
                     AKSLVKALRRYGESGVNRATLVVDDATGVQGSMVPWLVALAEAASLVLAAHPDTLKKA
                     NTKRLWMRLDRVDLPPLSPKETRELAEALVERYGVVAEEREAYLSRVAALSAGVPGEV
                     ERLVRYVSAEDIVRNRDVGTGYAESLARREERGIALAPILLVAGGVAIAARYLGLARG
                     EMDLYVAGGLGIAAFVVLAPWLRKAVVAQ"
     gene            7119..7349
                     /locus_tag="TCCBUS3UF1_RS11390"
                     /old_locus_tag="TCCBUS3UF1_p140"
     CDS             7119..7349
                     /locus_tag="TCCBUS3UF1_RS11390"
                     /old_locus_tag="TCCBUS3UF1_p140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014271880.1"
                     /translation="MRNLGRMPSVGKPLFLTPEELAGALRVSPETVRRWLRTGEVKGH
                     RAGRLWRVPWEEGVRLLGGEERLQEALREVKG"
     gene            7346..8008
                     /locus_tag="TCCBUS3UF1_RS11395"
                     /old_locus_tag="TCCBUS3UF1_p150"
     CDS             7346..8008
                     /locus_tag="TCCBUS3UF1_RS11395"
                     /old_locus_tag="TCCBUS3UF1_p150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271881.1"
                     /translation="MRVVAVVNGKGGVGKTTTAVNLAAILAERAPVLLVDADPQGSAS
                     WWAGRGEMPFDLAQETDPSLLGRLRQVRGYGAVVVDTPPALRSEGLEAVLRAADYAVL
                     PTPPAPLDLEALVETVRQAVRPLGVAHRVLLTRVDPRSLGEALEAQTALMEAGVPAFH
                     AFVRAYKAHERAALEGKPITRWRGPNAREGEADYRRVAEELLRELGEEALARAGLAKE
                     GA"
     gene            8005..>8304
                     /locus_tag="TCCBUS3UF1_RS11695"
                     /old_locus_tag="TCCBUS3UF1_p160"
                     /pseudo
     CDS             8005..>8304
                     /locus_tag="TCCBUS3UF1_RS11695"
                     /old_locus_tag="TCCBUS3UF1_p160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014511109.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
     gene            8360..9178
                     /locus_tag="TCCBUS3UF1_RS11700"
                     /old_locus_tag="TCCBUS3UF1_p170"
     CDS             8360..9178
                     /locus_tag="TCCBUS3UF1_RS11700"
                     /old_locus_tag="TCCBUS3UF1_p170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271883.1"
                     /translation="MKLDKDSHCKNLIHSCGADPKAIKDFLLQLYQEHQECLDYLYEC
                     FLSDLREANNNLIPKEPPRKGKGALCLLALYLAYKKGAPWFPKNTLNELNGNADCQFP
                     RHARRNYGIKILSSRSKKNVLGIYPPQGKGYFYALESLKLDEISPYRHVGILEEDFER
                     LKAQYRNRCATCGAEEGKPHYNPYYNQNETIYLQKGHMNPRKPLEPGNIIPQCQFCNR
                     AYRNWLVFDKNGRTVGVADWIFLIKSLKNGYLKEHPPEELFHLLEKIGKKGEAK"
     gene            9175..10140
                     /locus_tag="TCCBUS3UF1_RS11705"
                     /old_locus_tag="TCCBUS3UF1_p180"
     CDS             9175..10140
                     /locus_tag="TCCBUS3UF1_RS11705"
                     /old_locus_tag="TCCBUS3UF1_p180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_014271884.1"
                     /translation="MKTPIEWNKIYLGDASELLEMLVKDSVDLVLTDPPYFLDKLDNG
                     WDPKEVKVHTQNQLIKHLPAGMKFDPSQGRELQLWYGAISKKIFDSLKPGGFFLSFSS
                     PRLVHRMAIAIEDAGFHIRDIFIWLYKEGRPKAASLERYVDKEDRPKLAGWKTPQVRG
                     NYEPIIVAQKPPEGPLVRNFLKHQVGLFNFTEKLEGGYTPSNVLQVEELEGIPPIFLV
                     PKPKVGEKGEWNDHPTVKPVNLLRFLIRLTTKKGGLVLDPFIGTGSTAIAATLEKRHF
                     IGFEINAHYYEIAQKRLALVNREKGRGGEKESSLLPLLPLLADQT"
     gene            complement(10137..10910)
                     /locus_tag="TCCBUS3UF1_RS11710"
                     /old_locus_tag="TCCBUS3UF1_p190"
     CDS             complement(10137..10910)
                     /locus_tag="TCCBUS3UF1_RS11710"
                     /old_locus_tag="TCCBUS3UF1_p190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271885.1"
                     /translation="MARRLGGDLNDGDLIRPILESRSPFWLVRDFWVELFSSLRESEI
                     EVDRLIERYKGLLLENLKYYRSKGINMPYEQDNRQPEEYIYDVVESWFIEEIVARWIK
                     SNLLHTFPDVKLEVRFSGGDRNRQFVFEKKRGDETTTEPDLAILAPKGIFFVELQNSR
                     RGRREIYDIKSSKVRRIRHRHGMLLFSLLPSESSFFFVPNDQFHLMKKRTNISWGKKL
                     TYFVSQEQLQKNGWGYYSFEEGLPALFVDLFEKFLIYSG"
     gene            11329..11574
                     /locus_tag="TCCBUS3UF1_RS11405"
                     /old_locus_tag="TCCBUS3UF1_p200"
     CDS             11329..11574
                     /locus_tag="TCCBUS3UF1_RS11405"
                     /old_locus_tag="TCCBUS3UF1_p200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271886.1"
                     /translation="MLCYVCMRLTVYLPEDVDRLLRETAANEGKSLSTLTVEALVFYL
                     RERRRAALGRKVLERAGKVPLGEEAFLLLEEGRRDRP"
     gene            11561..11944
                     /locus_tag="TCCBUS3UF1_RS11410"
                     /old_locus_tag="TCCBUS3UF1_p210"
     CDS             11561..11944
                     /locus_tag="TCCBUS3UF1_RS11410"
                     /old_locus_tag="TCCBUS3UF1_p210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="WP_014271887.1"
                     /translation="MTALDTGFFLRLVEGHPEAVRVWRDLVEGVEGIVSGLSLVELLR
                     LSLKGALPREDGELLLEAIPAVCRVVWPDWSIGERAARLSHGLALPLVDALVLATALE
                     AGAETLYTTDAHLEIYRGQLRVVRL"
     gene            complement(12017..13147)
                     /locus_tag="TCCBUS3UF1_RS11415"
                     /old_locus_tag="TCCBUS3UF1_p220"
     CDS             complement(12017..13147)
                     /locus_tag="TCCBUS3UF1_RS11415"
                     /old_locus_tag="TCCBUS3UF1_p220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014511178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041434094.1"
                     /translation="MTGAMPTAQYLLSAILALLPSPHLQESLKALLLLLLQGHGKARP
                     QHSQTKSASALSRFFNRYAWPTRTLIRLARREAEKALDRARPRRGPKPRLLVVLDLVT
                     LEKRGLFRALPLSFFHGKWGLHLGVVYLVHGELRIPWSYRVWRGKGEKSLSLLALRLL
                     ASLPPWMRKAFRVRVVADTAFGTIRFLRGVRELGLEAVVGMRRDRRLWGGERLADLRR
                     QGSRVHLRGVSFPLWAFRYRYPLPGGGWEWRYGVATFPASPRTLLVWGRRRFSIEHFF
                     KAMKSEFSLGQFGQRTALGVHRFLVLSLLAYLLAHWVKLASEEKGCTWWEAGREAARR
                     LFPELVALILSRELSLLGLWPPPPGKGVEDACLCGICGRCKF"
     gene            complement(13289..14221)
                     /locus_tag="TCCBUS3UF1_RS11420"
                     /old_locus_tag="TCCBUS3UF1_p240"
     CDS             complement(13289..14221)
                     /locus_tag="TCCBUS3UF1_RS11420"
                     /old_locus_tag="TCCBUS3UF1_p240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="WP_014271890.1"
                     /translation="MTPDPHAEVFARFRRYLEMEEGRSPRTAEEYLLDASLFSRWFRE
                     RYGRPVRFEEVGSPQIRAFLASREVSPHRAGRLLASLRKLFRYLSEVEGLPILKDPTE
                     GVRRPKLPRRLPVYLTPPEVARLLEAAYRHRSPRVGLRDWALLAFLYGTGLRLSEALG
                     LTFSQLIYQDGIPYALRVQGKGGKERVVVLSPTAQRALHQWLKHRNLEGHPTSPYIWS
                     HTFGRNRGKPFSPRAVEAMVKRVARRAGLAEWSRITPHKLRHSYASALVEAGRGIEEV
                     RELLGHTSISTTQVYVHVSRKRLEEAARSLPDVL"
     gene            14204..14428
                     /locus_tag="TCCBUS3UF1_RS11715"
                     /old_locus_tag="TCCBUS3UF1_p250"
     CDS             14204..14428
                     /locus_tag="TCCBUS3UF1_RS11715"
                     /old_locus_tag="TCCBUS3UF1_p250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271891.1"
                     /translation="MGVWGHGVLHPAALGALEAPRGGFSRVYHSQNISLAKSSKRGPT
                     ERKYPSKRQKLPAKTPTGPEEGVRKMATKS"
     gene            14539..14838
                     /locus_tag="TCCBUS3UF1_RS11425"
                     /old_locus_tag="TCCBUS3UF1_p260"
     CDS             14539..14838
                     /locus_tag="TCCBUS3UF1_RS11425"
                     /old_locus_tag="TCCBUS3UF1_p260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014271893.1"
                     /translation="MPEVGKAQAKEGAHKDPLEGKLLLTYAEVQRALGVSRTTVWRLV
                     RAGHLKLVRPTPRSARITRESLEAFLRSLEGPARVEGVGRRAVDRAREVLKRFGL"
     gene            14849..15802
                     /locus_tag="TCCBUS3UF1_RS11430"
                     /old_locus_tag="TCCBUS3UF1_p280"
     CDS             14849..15802
                     /locus_tag="TCCBUS3UF1_RS11430"
                     /old_locus_tag="TCCBUS3UF1_p280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271894.1"
                     /translation="MGEAQGEAKSPKGEKRLPHQAVLFLPGVLEGGRFRSERLPEGVE
                     VALGGRALGDPEGEAGEGVFSLWPRTDGEGRLLRVQAATRLRQPYGGPEVAVQGILLY
                     ADRERLVLLVVPKEGEAFKVALRRDRGFAARLEPKRAYRVEGRLGGAHLLAERAWPLA
                     RFLEARKGGQALPPAIQGRENPYWAPAPGKGAEAPPPRGQRPSPPKEEGQKPPPRERG
                     RRDPVRVWRAPESPEDPAPPDLGRPPALGKGQVMGIAGTGPYYLVLLPQAVAEWWPRV
                     ERLLPEFPRRYEVRFYPDGSRAVVAGDLEALKVWYKRLFRG"
     gene            complement(15792..16304)
                     /locus_tag="TCCBUS3UF1_RS11435"
                     /old_locus_tag="TCCBUS3UF1_p290"
     CDS             complement(15792..16304)
                     /locus_tag="TCCBUS3UF1_RS11435"
                     /old_locus_tag="TCCBUS3UF1_p290"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081477249.1"
                     /translation="MERILEGARQAHRRASQRAAGRGGEFHAWAEGYLRGEDPPLPEG
                     EPERRMALDLKAWWEGSGGKAVRLEEAVFHPEHGYAGRTDLVARLGGKLWVVDLKTSP
                     RAYPEHFLQVGAYALALEGEGLRVEGGLVLCLGDGASPVEVPLWEAAEAFLSLRRVWS
                     FLELLKGSSP"
     gene            complement(16573..16857)
                     /locus_tag="TCCBUS3UF1_RS11720"
     CDS             complement(16573..16857)
                     /locus_tag="TCCBUS3UF1_RS11720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015065474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081477252.1"
                     /translation="MEELALGLAREFRDPGSLPFYAFLLWGVLRAELYGFHPRALEVL
                     LWAVGRVREALVALWGSRKRVGRPGALLAHLLKEGGLLSVLQGAPRWRVA"
     gene            complement(17675..17956)
                     /locus_tag="TCCBUS3UF1_RS11725"
                     /old_locus_tag="TCCBUS3UF1_p310"
     CDS             complement(17675..17956)
                     /locus_tag="TCCBUS3UF1_RS11725"
                     /old_locus_tag="TCCBUS3UF1_p310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271897.1"
                     /translation="MVPTRFCPFPPFGPRYNSGQWEDGAPLGPKAAGPREDQKKLPLG
                     RDPRETNYLPFRSLGYPLPAETARGTWQVRGGVLSPTRKGRGSHAPRAV"
     gene            18194..19465
                     /locus_tag="TCCBUS3UF1_RS11445"
                     /old_locus_tag="TCCBUS3UF1_p320"
     CDS             18194..19465
                     /locus_tag="TCCBUS3UF1_RS11445"
                     /old_locus_tag="TCCBUS3UF1_p320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014271898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014271898.1"
                     /translation="MGPDGRVDLEAVRHFLQVGRYAEAEAALDRDPRPEDPGWLRLKG
                     WARWHLGDERGLELLRQATRRAREGAGWIWQDLGALLFRAGRWEEAEEALRRALDHFA
                     AEEDHLGRAWTLHGLGVAALHRGRPGLALKRGEEAWALVRSKALGSFRNRVLVLLSSA
                     HRARGELKEALYRARQAAEGRLDPDDRVVALRNLGTTLRLAGKPALGRARLEDALRLS
                     GEGARRGATLAELAAGYLALGWRKEARRAAGEALEHLDTHAPARSRLLVVLAELDRQG
                     GGTGALPLLEEALAVGPYPLMEEALGFPELFAFAEAHGLRLPRTRKAPDKPGVRLEAG
                     KTPRMMVGRREVPLEGSGRAFDLMALLAAEGPLSWREAALRLWGEDGPGLRERLHTTA
                     SRARDLVADREAVRWKGEVLSLDPERRWQLL"
CONTIG      join(CP003127.1:1..19716)
//
DBGET integrated database retrieval system