GenomeNet

Database: RefSeq
Entry: NC_016634
LinkDB: NC_016634
Original site: NC_016634 
LOCUS       NC_016634              19716 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence.
ACCESSION   NC_016634
VERSION     NC_016634.1  GI:384440648
DBLINK      Project: 81197
            BioProject: PRJNA81197
KEYWORDS    RefSeq.
SOURCE      Thermus sp. CCB_US3_UF1
  ORGANISM  Thermus sp. CCB_US3_UF1
            Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae;
            Thermus.
REFERENCE   1  (bases 1 to 19716)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Complete genome sequence of thermophilic Thermus sp. CCB_US3_UF1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 19716)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 19716)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2011) Centre for Chemical Biology (CCB@USM),
            Universiti Sains Malaysia (USM), 1st Floor, Block B No.10,
            Persiaran Bukit Jambul, Bayan Lepas, Pulau Pinang 11900, Malaysia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003127.
            Bacteria available from Centre for Chemical Biology (CCB@USM)
            (info@ccbusm.edu.my).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..19716
                     /organism="Thermus sp. CCB_US3_UF1"
                     /mol_type="genomic DNA"
                     /strain="CCB_US3_UF1"
                     /db_xref="taxon:1111069"
                     /plasmid="pTCCB09"
     gene            complement(2..265)
                     /locus_tag="TCCBUS3UF1_p10"
                     /db_xref="GeneID:11538242"
     CDS             complement(2..265)
                     /locus_tag="TCCBUS3UF1_p10"
                     /note="similar to Putative uncharacterized protein of
                     Thermus sp. 4C UniRef RepID=A6MN95_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064038.1"
                     /db_xref="GI:384440649"
                     /db_xref="GeneID:11538242"
                     /translation="MPRRPLYDPEKFRGLPCSARLVWFHIWATGGGEYAARRLAEVLE
                     ISPNAVALALRLLVQRGLLEVVRPPAGSRAGVYRVPSRPLEKA"
     misc_feature    complement(77..229)
                     /locus_tag="TCCBUS3UF1_p10"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:258026"
     gene            complement(341..718)
                     /locus_tag="TCCBUS3UF1_p20"
                     /db_xref="GeneID:11538243"
     CDS             complement(341..718)
                     /locus_tag="TCCBUS3UF1_p20"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064039.1"
                     /db_xref="GI:384440650"
                     /db_xref="GeneID:11538243"
                     /translation="MKPELAARLEEVLAALRERGRSLIAAVAAHAEARLAYEAALDAL
                     EDARARAIREGLEGRNEQARQAELLERTREQEEAARSARAVLRVAEANLEMARVAWAV
                     EKETLKALASLAEEALPEVRPRG"
     misc_feature    complement(365..>706)
                     /locus_tag="TCCBUS3UF1_p20"
                     /note="PV-1 protein (PLVAP); Region: PV-1; pfam06637"
                     /db_xref="CDD:115307"
     gene            complement(769..903)
                     /locus_tag="TCCBUS3UF1_p30"
                     /db_xref="GeneID:11538244"
     CDS             complement(769..903)
                     /locus_tag="TCCBUS3UF1_p30"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064040.1"
                     /db_xref="GI:384440651"
                     /db_xref="GeneID:11538244"
                     /translation="MRAFLALILALLLVAAPAAALGAQDPGRVQPLSDEVKGLGPGRK
                     "
     gene            complement(903..1229)
                     /locus_tag="TCCBUS3UF1_p40"
                     /db_xref="GeneID:11538245"
     CDS             complement(903..1229)
                     /locus_tag="TCCBUS3UF1_p40"
                     /note="similar to Putative uncharacterized protein of
                     Thermus sp. 4C UniRef RepID=A6MN65_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064041.1"
                     /db_xref="GI:384440652"
                     /db_xref="GeneID:11538245"
                     /translation="MKELSTQAQVQVLSREGALSRAAWALIRARERVVELYGWFLAGE
                     TDSYLTPFLLARDIAEAVEEAKVLAISFAILENFSESATAFLEQARLEAARILAEKSA
                     GEEVPF"
     misc_feature    complement(<975..>1178)
                     /locus_tag="TCCBUS3UF1_p40"
                     /note="DNA polymerase IV; Validated; Region: PRK03352"
                     /db_xref="CDD:179564"
     gene            complement(1334..1732)
                     /locus_tag="TCCBUS3UF1_p60"
                     /db_xref="GeneID:11538246"
     CDS             complement(1334..1732)
                     /locus_tag="TCCBUS3UF1_p60"
                     /note="similar to motif PHA03307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064042.1"
                     /db_xref="GI:384440653"
                     /db_xref="GeneID:11538246"
                     /translation="MVALVLASGGQVRVGDQRGVDWAVRLACPSAVVVEASRFPGPPA
                     ARLHQRTRAVVLGHAGLGLPPASCLLVFPPSGGAPALGPGSSLALSLARGAGLPVWVA
                     GEPSPGPGWLPLSLAGVPGWVLLPVQNKLF"
     gene            1956..2108
                     /locus_tag="TCCBUS3UF1_p50"
                     /db_xref="GeneID:11538247"
     CDS             1956..2108
                     /locus_tag="TCCBUS3UF1_p50"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064043.1"
                     /db_xref="GI:384440654"
                     /db_xref="GeneID:11538247"
                     /translation="MGPSPAQGRRPPHPPRPPSGEDAGRGAGGRGWGEGVGEDAANRK
                     GDRVNS"
     gene            2105..2791
                     /locus_tag="TCCBUS3UF1_p70"
                     /db_xref="GeneID:11538248"
     CDS             2105..2791
                     /locus_tag="TCCBUS3UF1_p70"
                     /note="similar to Micrococcal nuclease-like protein of
                     Thermus sp. 4C UniRef RepID=A6MN67_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064044.1"
                     /db_xref="GI:384440655"
                     /db_xref="GeneID:11538248"
                     /translation="MRAIPLLLVWGLSLVLALSPQGRLQGPLAVLKVVDGDTVELRGL
                     GPVRLIGIDAPESSYNRRTSGAEEVQMGLEAKAFLNRLLRGKQVWVELDLQERDRYRR
                     VLAYLYLEDTQGDWTHGGRRFRQVNLEMVRAGWAEPYTVPPNVRYAELYLQASREART
                     RGLGMWGRPSRPPGRGEGRCDPVYPAVCIPPPPPDLDCGDIPYRNFPVLPPDPHGFDR
                     DRDGVGCEGR"
     misc_feature    2192..2602
                     /locus_tag="TCCBUS3UF1_p70"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    2198..2602
                     /locus_tag="TCCBUS3UF1_p70"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    order(2213..2215,2243..2245,2261..2263,2270..2272,
                     2399..2404,2408..2410)
                     /locus_tag="TCCBUS3UF1_p70"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            complement(2800..4452)
                     /locus_tag="TCCBUS3UF1_p80"
                     /db_xref="GeneID:11538249"
     CDS             complement(2800..4452)
                     /locus_tag="TCCBUS3UF1_p80"
                     /note="similar to Putative membrane-bound metal-dependent
                     hydrolase of Thermus sp. 4C UniRef RepID=A6MN70_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound metal-dependent hydrolase"
                     /protein_id="YP_005064045.1"
                     /db_xref="GI:384440656"
                     /db_xref="GeneID:11538249"
                     /translation="MTAGTHLAGAALAAGLLRGLGLEVGLVEGLALAWGSVMPDVDTT
                     TSGPGKFIRPVSSWLERRFGHRTLTHSLLFTAALALLLYPLLRANPSAYWAFLAGYLS
                     HLLLDTLNVNGVPLLWPWRVQFWFFAAREWRIRYASPQEATLALSLALFAFALWPLSA
                     QGFASAFRHLVGTPEVAVLDYLDWRERREVWAEVRGFNRETQEAVEGRFLVVEALGRE
                     GFLMEDELGRTLAVSRDGQVVAYRVRMHRGRPQVLREWRLDLSGRLLGDLLQALPRGA
                     RRVWITGEAAPATEPPPLVPPVGTYPRVKASTTPPRLVLHAARPEDLTSLAGLYLRAG
                     SAVVRAAFSPEGAGEASLALPHLPSLPRVHPVLIPDLPSLSALLVRPGDAVEEGEPLA
                     RYVDEVPLEELAQQAQSRREEASRLEGELARLEERFRSEREALMGELARAREERDRLR
                     YLVAQGAEPRLKLQEAEARTEELSARLKRLVLDYTGERARLEERLREAGLEAVRLERR
                     RDREAERQLVRSPVAGRVAEVKVRDITPKGVTVEVVVLGSGP"
     misc_feature    complement(3985..>4350)
                     /locus_tag="TCCBUS3UF1_p80"
                     /note="Predicted membrane-bound metal-dependent hydrolase
                     (DUF457); Region: DUF457; cl00868"
                     /db_xref="CDD:260669"
     misc_feature    complement(3007..3306)
                     /locus_tag="TCCBUS3UF1_p80"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:251274"
     gene            complement(4449..4715)
                     /locus_tag="TCCBUS3UF1_p90"
                     /db_xref="GeneID:11538269"
     CDS             complement(4449..4715)
                     /locus_tag="TCCBUS3UF1_p90"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064046.1"
                     /db_xref="GI:384440657"
                     /db_xref="GeneID:11538269"
                     /translation="MGEAELRRKVAELEGRVRGLEAERQKLLARLAYLEASGRRSRGR
                     LSREQVLELHALLSEVWMELNATCPRLVPELDRALRLLEEVLGG"
     gene            complement(4716..5165)
                     /locus_tag="TCCBUS3UF1_p100"
                     /db_xref="GeneID:11538250"
     CDS             complement(4716..5165)
                     /locus_tag="TCCBUS3UF1_p100"
                     /note="similar to motif PHA03307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064047.1"
                     /db_xref="GI:384440658"
                     /db_xref="GeneID:11538250"
                     /translation="MRFSVFSLTLFLLLSLAGCEAPVATHEEEVPLRFYRWTPGGEVP
                     PEVLSGPPLRVQVLLYRQGAEASAHLRAQGGLPAEGEAVLFLEGAGGERVAEGYSNGR
                     PFVEVRGRAGRPACAWWSVLFSPDPWRQEDAEARLYQAHGRVCEGER"
     gene            complement(5186..5863)
                     /locus_tag="TCCBUS3UF1_p110"
                     /db_xref="GeneID:11538270"
     CDS             complement(5186..5863)
                     /locus_tag="TCCBUS3UF1_p110"
                     /note="similar to Outer membrane protein COG1538;
                     similar to Putative uncharacterized protein of Thermus sp.
                     4C UniRef RepID=A6MN73_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064048.1"
                     /db_xref="GI:384440659"
                     /db_xref="GeneID:11538270"
                     /translation="MRRWVYPFLLGMALAQAPGLTPAEVRLLDRLVEEALPRDPGYLR
                     ALADLEAARQTLGILGALSAEAGAALAGEYGQVAPAYRLSLSLNLAEVFRDRSPALRA
                     LEAQAEAAKREARVRVAGAFFRYLAAREAARTAADGVEAREAELKALQARARVGAATP
                     AEVLSAAERLSQARLALYRANLDLALAQEELARAVGLSLEALRAFLRPLEGSGGTPGT
                     PQAPKAP"
     misc_feature    complement(5276..5782)
                     /locus_tag="TCCBUS3UF1_p110"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(<5237..>5569)
                     /locus_tag="TCCBUS3UF1_p110"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     gene            complement(5856..6056)
                     /locus_tag="TCCBUS3UF1_p120"
                     /db_xref="GeneID:11538251"
     CDS             complement(5856..6056)
                     /locus_tag="TCCBUS3UF1_p120"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064049.1"
                     /db_xref="GI:384440660"
                     /db_xref="GeneID:11538251"
                     /translation="MAEFLQALEEAVWVRADATGQYYLLRAPGGPWRLYQRGIEAAFL
                     LAEGEKALLWAPEFGVLLPDHA"
     gene            complement(6065..6982)
                     /locus_tag="TCCBUS3UF1_p130"
                     /db_xref="GeneID:11538252"
     CDS             complement(6065..6982)
                     /locus_tag="TCCBUS3UF1_p130"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064050.1"
                     /db_xref="GI:384440661"
                     /db_xref="GeneID:11538252"
                     /translation="MFVGRKEEGRALLLSVRAGRGVVLVGPPGYGKSALLQELRPALE
                     AWSAVLWVDKVAPFGAFLKDLFRALWDARIPVEGVDLSKDVEADLRTWGKRYPSNDEK
                     AKSLVKALRRYGESGVNRATLVVDDATGVQGSMVPWLVALAEAASLVLAAHPDTLKKA
                     NTKRLWMRLDRVDLPPLSPKETRELAEALVERYGVVAEEREAYLSRVAALSAGVPGEV
                     ERLVRYVSAEDIVRNRDVGTGYAESLARREERGIALAPILLVAGGVAIAARYLGLARG
                     EMDLYVAGGLGIAAFVVLAPWLRKAVVAQ"
     misc_feature    complement(<6758..6979)
                     /locus_tag="TCCBUS3UF1_p130"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(<6269..6529)
                     /locus_tag="TCCBUS3UF1_p130"
                     /note="Tenuivirus/Phlebovirus nucleocapsid protein;
                     Region: Tenui_N; pfam05733"
                     /db_xref="CDD:253357"
     gene            7119..7349
                     /locus_tag="TCCBUS3UF1_p140"
                     /db_xref="GeneID:11538253"
     CDS             7119..7349
                     /locus_tag="TCCBUS3UF1_p140"
                     /note="similar to Putative uncharacterized protein of
                     Thermus sp. 4C UniRef RepID=A6MN77_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064051.1"
                     /db_xref="GI:384440662"
                     /db_xref="GeneID:11538253"
                     /translation="MRNLGRMPSVGKPLFLTPEELAGALRVSPETVRRWLRTGEVKGH
                     RAGRLWRVPWEEGVRLLGGEERLQEALREVKG"
     misc_feature    7161..7286
                     /locus_tag="TCCBUS3UF1_p140"
                     /note="Helix-turn-helix domain; Region: HTH_17; cl17695"
                     /db_xref="CDD:266777"
     gene            7346..8008
                     /locus_tag="TCCBUS3UF1_p150"
                     /db_xref="GeneID:11538254"
     CDS             7346..8008
                     /locus_tag="TCCBUS3UF1_p150"
                     /note="similar to ATPases involved in chromosome
                     partitioning COG1192;
                     similar to Cobyrinic acid a,c-diamide synthase of Bacteria
                     UniRef RepID=B2JBV0_NOSP7"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_005064052.1"
                     /db_xref="GI:384440663"
                     /db_xref="GeneID:11538254"
                     /translation="MRVVAVVNGKGGVGKTTTAVNLAAILAERAPVLLVDADPQGSAS
                     WWAGRGEMPFDLAQETDPSLLGRLRQVRGYGAVVVDTPPALRSEGLEAVLRAADYAVL
                     PTPPAPLDLEALVETVRQAVRPLGVAHRVLLTRVDPRSLGEALEAQTALMEAGVPAFH
                     AFVRAYKAHERAALEGKPITRWRGPNAREGEADYRRVAEELLRELGEEALARAGLAKE
                     GA"
     misc_feature    7346..7894
                     /locus_tag="TCCBUS3UF1_p150"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    7352..7753
                     /locus_tag="TCCBUS3UF1_p150"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    7373..7393
                     /locus_tag="TCCBUS3UF1_p150"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(7391..7393,7583..7585)
                     /locus_tag="TCCBUS3UF1_p150"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            8005..8370
                     /locus_tag="TCCBUS3UF1_p160"
                     /db_xref="GeneID:11538255"
     CDS             8005..8370
                     /locus_tag="TCCBUS3UF1_p160"
                     /note="similar to Putative chromosome segregation ATPases
                     of Thermus sp. 4C UniRef RepID=A6MN79_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation ATPase"
                     /protein_id="YP_005064053.1"
                     /db_xref="GI:384440664"
                     /db_xref="GeneID:11538255"
                     /translation="MKRKRLAELVREEAEGLKEAIPEPAPAERRAEPAPPEPPKERPT
                     PKYLTYVRKECRLRPDQLDALTALARKLNRERARLGLRARVTENTLIRIAVRFLLKKP
                     SLFLNEKSLLEEEEDCYEA"
     gene            8360..9178
                     /locus_tag="TCCBUS3UF1_p170"
                     /db_xref="GeneID:11538256"
     CDS             8360..9178
                     /locus_tag="TCCBUS3UF1_p170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064054.1"
                     /db_xref="GI:384440665"
                     /db_xref="GeneID:11538256"
                     /translation="MKLDKDSHCKNLIHSCGADPKAIKDFLLQLYQEHQECLDYLYEC
                     FLSDLREANNNLIPKEPPRKGKGALCLLALYLAYKKGAPWFPKNTLNELNGNADCQFP
                     RHARRNYGIKILSSRSKKNVLGIYPPQGKGYFYALESLKLDEISPYRHVGILEEDFER
                     LKAQYRNRCATCGAEEGKPHYNPYYNQNETIYLQKGHMNPRKPLEPGNIIPQCQFCNR
                     AYRNWLVFDKNGRTVGVADWIFLIKSLKNGYLKEHPPEELFHLLEKIGKKGEAK"
     gene            9175..10140
                     /locus_tag="TCCBUS3UF1_p180"
                     /db_xref="GeneID:11538257"
     CDS             9175..10140
                     /locus_tag="TCCBUS3UF1_p180"
                     /note="similar to Csp231I DNA methyltransferase of
                     Burkholderia glumae BGR1 UniRef RepID=C5A9A5_BURGB"
                     /codon_start=1
                     /transl_table=11
                     /product="Csp231I DNA methyltransferase"
                     /protein_id="YP_005064055.1"
                     /db_xref="GI:384440666"
                     /db_xref="GeneID:11538257"
                     /translation="MKTPIEWNKIYLGDASELLEMLVKDSVDLVLTDPPYFLDKLDNG
                     WDPKEVKVHTQNQLIKHLPAGMKFDPSQGRELQLWYGAISKKIFDSLKPGGFFLSFSS
                     PRLVHRMAIAIEDAGFHIRDIFIWLYKEGRPKAASLERYVDKEDRPKLAGWKTPQVRG
                     NYEPIIVAQKPPEGPLVRNFLKHQVGLFNFTEKLEGGYTPSNVLQVEELEGIPPIFLV
                     PKPKVGEKGEWNDHPTVKPVNLLRFLIRLTTKKGGLVLDPFIGTGSTAIAATLEKRHF
                     IGFEINAHYYEIAQKRLALVNREKGRGGEKESSLLPLLPLLADQT"
     misc_feature    9253..10047
                     /locus_tag="TCCBUS3UF1_p180"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(10137..10910)
                     /locus_tag="TCCBUS3UF1_p190"
                     /db_xref="GeneID:11538258"
     CDS             complement(10137..10910)
                     /locus_tag="TCCBUS3UF1_p190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064056.1"
                     /db_xref="GI:384440667"
                     /db_xref="GeneID:11538258"
                     /translation="MARRLGGDLNDGDLIRPILESRSPFWLVRDFWVELFSSLRESEI
                     EVDRLIERYKGLLLENLKYYRSKGINMPYEQDNRQPEEYIYDVVESWFIEEIVARWIK
                     SNLLHTFPDVKLEVRFSGGDRNRQFVFEKKRGDETTTEPDLAILAPKGIFFVELQNSR
                     RGRREIYDIKSSKVRRIRHRHGMLLFSLLPSESSFFFVPNDQFHLMKKRTNISWGKKL
                     TYFVSQEQLQKNGWGYYSFEEGLPALFVDLFEKFLIYSG"
     gene            11329..11574
                     /locus_tag="TCCBUS3UF1_p200"
                     /db_xref="GeneID:11538259"
     CDS             11329..11574
                     /locus_tag="TCCBUS3UF1_p200"
                     /note="similar to Putative uncharacterized protein of
                     Thermus UniRef RepID=Q745W3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064057.1"
                     /db_xref="GI:384440668"
                     /db_xref="GeneID:11538259"
                     /translation="MLCYVCMRLTVYLPEDVDRLLRETAANEGKSLSTLTVEALVFYL
                     RERRRAALGRKVLERAGKVPLGEEAFLLLEEGRRDRP"
     gene            11561..11944
                     /locus_tag="TCCBUS3UF1_p210"
                     /db_xref="GeneID:11538260"
     CDS             11561..11944
                     /locus_tag="TCCBUS3UF1_p210"
                     /note="similar to Putative uncharacterized protein of
                     Thermus UniRef RepID=Q745W2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064058.1"
                     /db_xref="GI:384440669"
                     /db_xref="GeneID:11538260"
                     /translation="MTALDTGFFLRLVEGHPEAVRVWRDLVEGVEGIVSGLSLVELLR
                     LSLKGALPREDGELLLEAIPAVCRVVWPDWSIGERAARLSHGLALPLVDALVLATALE
                     AGAETLYTTDAHLEIYRGQLRVVRL"
     misc_feature    11567..11908
                     /locus_tag="TCCBUS3UF1_p210"
                     /note="PIN domain of ribonucleases (toxins), VapC, FitB,
                     and PAE0151 of bacterial and archaeal toxin/antitoxin-like
                     operons, and other similar homologs; Region:
                     PIN_VapC-like; cd09861"
                     /db_xref="CDD:189031"
     misc_feature    order(11573..11575,11681..11683,11837..11839,11894..11896)
                     /locus_tag="TCCBUS3UF1_p210"
                     /note="putative active site [active]"
                     /db_xref="CDD:189031"
     gene            complement(12017..13135)
                     /locus_tag="TCCBUS3UF1_p220"
                     /db_xref="GeneID:11538261"
     CDS             complement(12017..13135)
                     /locus_tag="TCCBUS3UF1_p220"
                     /note="similar to Putative uncharacterized protein of
                     Thermaceae UniRef RepID=Q72HQ3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064059.1"
                     /db_xref="GI:384440670"
                     /db_xref="GeneID:11538261"
                     /translation="MPTAQYLLSAILALLPSPHLQESLKALLLLLLQGHGKARPQHSQ
                     TKSASALSRFFNRYAWPTRTLIRLARREAEKALDRARPRRGPKPRLLVVLDLVTLEKR
                     GLFRALPLSFFHGKWGLHLGVVYLVHGELRIPWSYRVWRGKGEKSLSLLALRLLASLP
                     PWMRKAFRVRVVADTAFGTIRFLRGVRELGLEAVVGMRRDRRLWGGERLADLRRQGSR
                     VHLRGVSFPLWAFRYRYPLPGGGWEWRYGVATFPASPRTLLVWGRRRFSIEHFFKAMK
                     SEFSLGQFGQRTALGVHRFLVLSLLAYLLAHWVKLASEEKGCTWWEAGREAARRLFPE
                     LVALILSRELSLLGLWPPPPGKGVEDACLCGICGRCKF"
     misc_feature    complement(12251..>12634)
                     /locus_tag="TCCBUS3UF1_p220"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            13104..13238
                     /locus_tag="TCCBUS3UF1_p230"
                     /db_xref="GeneID:11538262"
     CDS             13104..13238
                     /locus_tag="TCCBUS3UF1_p230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064060.1"
                     /db_xref="GI:384440671"
                     /db_xref="GeneID:11538262"
                     /translation="MAESRYWAVGMAPVIRRETRSPFQVPRLHRVEREWISASFEVKN
                     "
     gene            complement(13289..14221)
                     /locus_tag="TCCBUS3UF1_p240"
                     /db_xref="GeneID:11538263"
     CDS             complement(13289..14221)
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="similar to site-specific tyrosine recombinase XerC
                     PRK00236;
                     similar to Putative integrase of Thermus UniRef
                     RepID=Q6UQ62_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_005064061.1"
                     /db_xref="GI:384440672"
                     /db_xref="GeneID:11538263"
                     /translation="MTPDPHAEVFARFRRYLEMEEGRSPRTAEEYLLDASLFSRWFRE
                     RYGRPVRFEEVGSPQIRAFLASREVSPHRAGRLLASLRKLFRYLSEVEGLPILKDPTE
                     GVRRPKLPRRLPVYLTPPEVARLLEAAYRHRSPRVGLRDWALLAFLYGTGLRLSEALG
                     LTFSQLIYQDGIPYALRVQGKGGKERVVVLSPTAQRALHQWLKHRNLEGHPTSPYIWS
                     HTFGRNRGKPFSPRAVEAMVKRVARRAGLAEWSRITPHKLRHSYASALVEAGRGIEEV
                     RELLGHTSISTTQVYVHVSRKRLEEAARSLPDVL"
     misc_feature    complement(13316..14221)
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    complement(13319..14194)
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(13349..13351,13454..13462,13679..13681,
                     13757..13762))
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(13349..13351,13376..13378,13445..13447,
                     13454..13456,13679..13681,13760..13762))
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(13349..13351,13376..13378,13445..13447,
                     13454..13456,13760..13762))
                     /locus_tag="TCCBUS3UF1_p240"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            14204..14428
                     /locus_tag="TCCBUS3UF1_p250"
                     /db_xref="GeneID:11538264"
     CDS             14204..14428
                     /locus_tag="TCCBUS3UF1_p250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064062.1"
                     /db_xref="GI:384440673"
                     /db_xref="GeneID:11538264"
                     /translation="MGVWGHGVLHPAALGALEAPRGGFSRVYHSQNISLAKSSKRGPT
                     ERKYPSKRQKLPAKTPTGPEEGVRKMATKS"
     gene            complement(14467..14580)
                     /locus_tag="TCCBUS3UF1_p270"
                     /db_xref="GeneID:11538265"
     CDS             complement(14467..14580)
                     /locus_tag="TCCBUS3UF1_p270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064063.1"
                     /db_xref="GI:384440674"
                     /db_xref="GeneID:11538265"
                     /translation="MGPLLRLSLSDLRHAPMLRDGSARVGETLELPDIQTL"
     gene            14539..14838
                     /locus_tag="TCCBUS3UF1_p260"
                     /db_xref="GeneID:11538266"
     CDS             14539..14838
                     /locus_tag="TCCBUS3UF1_p260"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064064.1"
                     /db_xref="GI:384440675"
                     /db_xref="GeneID:11538266"
                     /translation="MPEVGKAQAKEGAHKDPLEGKLLLTYAEVQRALGVSRTTVWRLV
                     RAGHLKLVRPTPRSARITRESLEAFLRSLEGPARVEGVGRRAVDRAREVLKRFGL"
     misc_feature    14605..14754
                     /locus_tag="TCCBUS3UF1_p260"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     gene            14849..15802
                     /locus_tag="TCCBUS3UF1_p280"
                     /db_xref="GeneID:11538267"
     CDS             14849..15802
                     /locus_tag="TCCBUS3UF1_p280"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064065.1"
                     /db_xref="GI:384440676"
                     /db_xref="GeneID:11538267"
                     /translation="MGEAQGEAKSPKGEKRLPHQAVLFLPGVLEGGRFRSERLPEGVE
                     VALGGRALGDPEGEAGEGVFSLWPRTDGEGRLLRVQAATRLRQPYGGPEVAVQGILLY
                     ADRERLVLLVVPKEGEAFKVALRRDRGFAARLEPKRAYRVEGRLGGAHLLAERAWPLA
                     RFLEARKGGQALPPAIQGRENPYWAPAPGKGAEAPPPRGQRPSPPKEEGQKPPPRERG
                     RRDPVRVWRAPESPEDPAPPDLGRPPALGKGQVMGIAGTGPYYLVLLPQAVAEWWPRV
                     ERLLPEFPRRYEVRFYPDGSRAVVAGDLEALKVWYKRLFRG"
     misc_feature    <15323..>15565
                     /locus_tag="TCCBUS3UF1_p280"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14965"
                     /db_xref="CDD:237871"
     gene            complement(15792..16538)
                     /locus_tag="TCCBUS3UF1_p290"
                     /db_xref="GeneID:11538268"
     CDS             complement(15792..16538)
                     /locus_tag="TCCBUS3UF1_p290"
                     /note="similar to Putative uncharacterized protein of
                     Thermus sp. 4C UniRef RepID=A6MN92_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064066.1"
                     /db_xref="GI:384440677"
                     /db_xref="GeneID:11538268"
                     /translation="MAYQDWLFKDHPSGWRLRYRRQGGGYEASQDGELWRPVPSVTQI
                     TGLLHKNLHEWAVGRVVEYLKGELVPGLPLTQGDVERILEGARQAHRRASQRAAGRGG
                     EFHAWAEGYLRGEDPPLPEGEPERRMALDLKAWWEGSGGKAVRLEEAVFHPEHGYAGR
                     TDLVARLGGKLWVVDLKTSPRAYPEHFLQVGAYALALEGEGLRVEGGLVLCLGDGASP
                     VEVPLWEAAEAFLSLRRVWSFLELLKGSSP"
     misc_feature    complement(<15870..16181)
                     /locus_tag="TCCBUS3UF1_p290"
                     /note="CRISPR/Cas system-associated protein Cas4; Region:
                     Cas4_I-A_I-B_I-C_I-D_II-B; cl00641"
                     /db_xref="CDD:260548"
     gene            complement(16573..17694)
                     /locus_tag="TCCBUS3UF1_p300"
                     /db_xref="GeneID:11538271"
     CDS             complement(16573..17694)
                     /locus_tag="TCCBUS3UF1_p300"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064067.1"
                     /db_xref="GI:384440678"
                     /db_xref="GeneID:11538271"
                     /translation="MPQEQFEGKEYQKEGISAAGRAFLEALARRKEARGEEVPPLYRA
                     LLEAPPRPLGNPEVGEALPRPAGDLPRPVWAPESPLALADRLLALGDSRATLPPLSPR
                     ARRVYRLLLALGLAHLRRHLGERPLPRSLSQLTLFLPNEALGVLLPPASLYRVLGELA
                     EKGLVQRRAWRVRATVHGRTGVYAAGTLYALRLPHRERRPRLEREDFLHPWRDLEGDI
                     ARGRTAWRAVRESKESPPKEDSRVLEFLLGLSLPPQKARVPLSLDTLTALLRTPPPER
                     RRRVEELALGLAREFRDPGSLPFYAFLLWGVLRAELYGFHPRALEVLLWAVGRVREAL
                     VALWGSRKRVGRPGALLAHLLKEGGLLSVLQGAPRWRVA"
     gene            complement(17675..17956)
                     /locus_tag="TCCBUS3UF1_p310"
                     /db_xref="GeneID:11538240"
     CDS             complement(17675..17956)
                     /locus_tag="TCCBUS3UF1_p310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064068.1"
                     /db_xref="GI:384440679"
                     /db_xref="GeneID:11538240"
                     /translation="MVPTRFCPFPPFGPRYNSGQWEDGAPLGPKAAGPREDQKKLPLG
                     RDPRETNYLPFRSLGYPLPAETARGTWQVRGGVLSPTRKGRGSHAPRAV"
     gene            18194..19465
                     /locus_tag="TCCBUS3UF1_p320"
                     /db_xref="GeneID:11538241"
     CDS             18194..19465
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005064069.1"
                     /db_xref="GI:384440680"
                     /db_xref="GeneID:11538241"
                     /translation="MGPDGRVDLEAVRHFLQVGRYAEAEAALDRDPRPEDPGWLRLKG
                     WARWHLGDERGLELLRQATRRAREGAGWIWQDLGALLFRAGRWEEAEEALRRALDHFA
                     AEEDHLGRAWTLHGLGVAALHRGRPGLALKRGEEAWALVRSKALGSFRNRVLVLLSSA
                     HRARGELKEALYRARQAAEGRLDPDDRVVALRNLGTTLRLAGKPALGRARLEDALRLS
                     GEGARRGATLAELAAGYLALGWRKEARRAAGEALEHLDTHAPARSRLLVVLAELDRQG
                     GGTGALPLLEEALAVGPYPLMEEALGFPELFAFAEAHGLRLPRTRKAPDKPGVRLEAG
                     KTPRMMVGRREVPLEGSGRAFDLMALLAAEGPLSWREAALRLWGEDGPGLRERLHTTA
                     SRARDLVADREAVRWKGEVLSLDPERRWQLL"
     misc_feature    18233..18496
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(18233..18235,18314..18319,18323..18328,18335..18340,
                     18416..18421,18428..18433,18440..18445)
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(18263..18265,18272..18274,18323..18325,18356..18358,
                     18368..18370,18377..18379,18425..18427,18461..18463,
                     18473..18475,18482..18484)
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    18410..18706
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(18410..18412,18416..18421,18428..18433,18530..18535,
                     18545..18550,18557..18562,18656..18661,18668..18673,
                     18680..18685)
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    18410..18622
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    order(18425..18427,18461..18463,18473..18475,18482..18484,
                     18545..18547,18581..18583,18593..18595,18602..18604,
                     18665..18667,18701..18703)
                     /locus_tag="TCCBUS3UF1_p320"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
CONTIG      join(CP003127.1:1..19716)
//
DBGET integrated database retrieval system